F314915

General Info

Members Datasets Scaffolds Average Seq Length
206 139 206 193

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10015044|Ga0081538_100150445
Length 204
Sequence MDARRSDVLKASPRMFDSNILDRLSRVHPMVPPLIFVPAIIALLVVGARGAPTTLQVIGLVIGGYLFWTLTEYWLHRLIFHFEPEEGIGARFHWIIHGVHHDHPNDPLRLVMPPSVSVPLALAFWGLFVLVLGTPWAHVFMAGFLMGYLVYDMTHRPRTGLGKLMRELHMRHHFQDDTRGFGVSAPFWDYVFRTPQKRRAQTGG

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
13 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
14 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
15 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
17 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
20 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
21 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
31 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
35 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
50 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
51 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
52 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
53 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
54 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
55 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
56 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
57 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
58 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
59 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
60 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
61 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
62 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
63 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
64 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
65 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
66 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
67 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
68 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
69 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
70 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
71 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
72 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
73 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
74 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
75 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
76 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
77 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
78 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
79 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
80 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
81 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
82 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
83 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
84 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
85 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
86 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
87 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
88 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
89 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
90 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
91 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
92 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
93 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
94 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
95 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
96 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
97 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
98 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
99 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
100 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
101 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
102 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
117 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
118 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
119 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
120 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
121 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
122 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
123 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
124 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
125 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
126 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
127 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
128 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
129 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
130 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
131 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
134 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
135 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
136 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
137 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
138 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
139 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0.49
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.97
Nodule 0
Rhizoplane 3.88
Rhizosphere 95.15
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10003977 3300003373 Bacteria 3581
2 Ga0070676_10251723 3300005328 Bacteria 1179
3 Ga0070660_100009576 3300005339 Bacteria 6823
4 Ga0070691_10107367 3300005341 Bacteria 1393
5 Ga0070687_100548721 3300005343 Bacteria 786
6 Ga0070668_100040900 3300005347 Bacteria 3549
7 Ga0070709_10127393 3300005434 Bacteria 1734
8 Ga0070709_10559588 3300005434 Bacteria 876
9 Ga0070711_100013122 3300005439 Bacteria 5196
10 Ga0070700_100021229 3300005441 Bacteria 3773
11 Ga0070694_100396028 3300005444 Bacteria 1080
12 Ga0070662_100032782 3300005457 Bacteria 3653
13 Ga0068861_100066937 3300005719 Bacteria 2770
14 Ga0081538_10000152 3300005981 Bacteria 71751
15 Ga0081538_10000213 3300005981 Bacteria 64771
16 Ga0081538_10000696 3300005981 Bacteria 36915
17 Ga0081538_10004533 3300005981 Bacteria 12794
18 Ga0081538_10014118 3300005981 Bacteria 6276
19 Ga0081538_10015044 3300005981 Bacteria 6016
20 Ga0081538_10019427 3300005981 Bacteria 5051
21 Ga0081538_10020511 3300005981 Bacteria 4859
22 Ga0081538_10042152 3300005981 Bacteria 2885
23 Ga0081538_10047036 3300005981 Bacteria 2652
24 Ga0081540_1050188 3300005983 Bacteria 2074
25 Ga0081539_10150884 3300005985 Bacteria 1118
26 Ga0075363_100038606 3300006048 Bacteria 2512
27 Ga0070712_100007319 3300006175 Bacteria 6889
28 Ga0070712_100165158 3300006175 Bacteria 1713
29 Ga0070712_100249750 3300006175 Bacteria 1417
30 Ga0075428_100057399 3300006844 Bacteria 4262
31 Ga0075428_100074512 3300006844 Bacteria 3708
32 Ga0075430_100000176 3300006846 Bacteria 42404
33 Ga0075430_100112317 3300006846 Bacteria 2271
34 Ga0075430_100234651 3300006846 Bacteria 1521
35 Ga0075431_100003115 3300006847 Bacteria 16051
36 Ga0075431_100245077 3300006847 Bacteria 1822
37 Ga0075429_100109702 3300006880 Bacteria 2413
38 Ga0075429_100149807 3300006880 Bacteria 2042
39 Ga0105240_11079337 3300009093 Bacteria 855
40 Ga0111539_10015829 3300009094 Bacteria 9368
41 Ga0111539_10861979 3300009094 Bacteria 1054
42 Ga0105245_10033865 3300009098 Bacteria 4527
43 Ga0105245_11205202 3300009098 Bacteria 805
44 Ga0114129_10000609 3300009147 Bacteria 44313
45 Ga0114129_10058974 3300009147 Bacteria 5367
46 Ga0114129_10278919 3300009147 Bacteria 2234
47 Ga0114129_10743052 3300009147 Bacteria 1257
48 Ga0114129_11187056 3300009147 Bacteria 951
49 Ga0105241_10582804 3300009174 Bacteria 1008
50 Ga0105237_10001106 3300009545 Bacteria 36105
51 Ga0105249_10035814 3300009553 Bacteria 4500
52 Ga0105239_10455140 3300010375 Bacteria 1452
53 Ga0105246_10779104 3300011119 Bacteria 846
54 Ga0157371_10332911 3300013102 Bacteria 1103
55 Ga0163162_10415813 3300013306 Bacteria 1477
56 Ga0157372_10884166 3300013307 Bacteria 1037
57 Ga0163161_10236914 3300017792 Bacteria 1418
58 Ga0206356_11679709 3300020070 Bacteria 3626
59 Ga0207692_10204220 3300025898 Bacteria 1163
60 Ga0207645_10155892 3300025907 Bacteria 1492
61 Ga0207671_10000491 3300025914 Bacteria 53763
62 Ga0207693_10013407 3300025915 Bacteria 6608
63 Ga0207693_10112912 3300025915 Bacteria 2131
64 Ga0207663_10785515 3300025916 Bacteria 758
65 Ga0207657_10038489 3300025919 Bacteria 4257
66 Ga0207687_10040761 3300025927 Bacteria 3185
67 Ga0207706_10000332 3300025933 Bacteria 51297
68 Ga0207665_10054822 3300025939 Bacteria 2689
69 Ga0207665_10122430 3300025939 Bacteria 1839
70 Ga0207712_10040541 3300025961 Bacteria 3197
71 Ga0207668_10088850 3300025972 Bacteria 2264
72 Ga0207708_10017349 3300026075 Bacteria 5419
73 Ga0207675_100043708 3300026118 Bacteria 4185
74 Ga0207428_10029865 3300027907 Bacteria 4510
75 Ga0207428_10229622 3300027907 Bacteria 1389
76 Ga0265337_1002321 3300028556 Bacteria 8819
77 Ga0265319_1000015 3300028563 Bacteria 176382
78 Ga0265319_1000125 3300028563 Bacteria 57338
79 Ga0265318_10000427 3300028577 Bacteria 32245
80 Ga0265322_10005375 3300028654 Bacteria 3792
81 Ga0265336_10000017 3300028666 Bacteria 231370
82 Ga0265338_10000044 3300028800 Bacteria 223643
83 Ga0265338_10096696 3300028800 Bacteria 2422
84 Ga0265338_10490991 3300028800 Bacteria 865
85 Ga0265324_10005753 3300029957 Bacteria 5282
86 Ga0265320_10005688 3300031240 Bacteria 7954
87 Ga0265340_10000003 3300031247 Bacteria 320583
88 Ga0265339_10074717 3300031249 Bacteria 1800
89 Ga0265327_10033767 3300031251 Bacteria 2846
90 Ga0265316_10025738 3300031344 Bacteria 4905
91 Ga0265342_10028352 3300031712 Bacteria 3490
92 Ga0307410_10309691 3300031852 Bacteria 1249
93 Ga0307406_10020823 3300031901 Bacteria 3870
94 Ga0307416_100031816 3300032002 Bacteria 3977
95 Ga0307416_100215636 3300032002 Bacteria 1836
96 Ga0307411_10770072 3300032005 Bacteria 845
97 Ga0307415_100199134 3300032126 Bacteria 1588
98 Ga0373959_0025274 3300034820 Bacteria 1166
99 Ga0373952_0092174 3300035092 Bacteria 788
100 Ga0373960_0035862 3300035121 Bacteria 1410
101 Ga0373943_0203778 3300035170 Bacteria 1096
102 Ga0373962_0022886 3300035242 Bacteria 1660
103 Ga0373931_0038680 3300035691 Bacteria 2497
104 Ga0373925_0060135 3300037068 Bacteria 2853
105 Ga0395900_0147772 3300037418 Bacteria 2403
106 Ga0395900_0331834 3300037418 Bacteria 1499
107 Ga0395898_0284677 3300037466 Bacteria 1577
108 Ga0395898_0398840 3300037466 Bacteria 1312
109 Ga0395898_0451592 3300037466 Bacteria 1224
110 Ga0395901_0145337 3300038443 Bacteria 2493
111 Ga0395901_0278165 3300038443 Bacteria 1740
112 Ga0439450_059328 3300042008 Bacteria 922
113 Ga0439460_0017136 3300042461 Bacteria 1938
114 Ga0466966_0225458 3300044684 Bacteria 1131
115 Ga0466963_0028647 3300044694 Bacteria 3579
116 Ga0466963_0414751 3300044694 Bacteria 950
117 Ga0466971_0097687 3300044719 Bacteria 1348
118 Ga0466968_0135825 3300044735 Bacteria 1122
119 Ga0466957_0685970 3300044842 Bacteria 722
120 Ga0466959_0431739 3300045049 Bacteria 894
121 Ga0466967_0517948 3300045976 Bacteria 1172
122 Ga0466967_0746857 3300045976 Unclassified 970
123 Ga0495653_0206135 3300046463 Bacteria 1331
124 Ga0495664_0000311 3300046477 Bacteria 23450
125 Ga0495596_0079616 3300046500 Bacteria 1272
126 Ga0495596_0092364 3300046500 Bacteria 1175
127 Ga0495618_0294288 3300046514 Bacteria 1010
128 Ga0495668_0587832 3300046616 Bacteria 615
129 Ga0495658_0238113 3300046683 Bacteria 1143
130 Ga0495600_0058672 3300046809 Bacteria 2514
131 Ga0495672_0132457 3300047320 Bacteria 1310
132 Ga0496102_0000019 3300048905 Bacteria 264583
133 Ga0496103_0000059 3300048906 Bacteria 139196
134 Ga0496104_0000030 3300048907 Bacteria 201919
135 Ga0496105_0148347 3300048908 Bacteria 1928
136 Ga0496110_0000230 3300048913 Bacteria 36192
137 Ga0496110_0672524 3300048913 Bacteria 936
138 Ga0496111_0000016 3300048914 Bacteria 77108
139 Ga0496112_0646249 3300048915 Bacteria 988
140 Ga0501031_0053775 3300049568 Bacteria 2624
141 Ga0501032_0061357 3300049569 Bacteria 2520
142 Ga0501034_0146931 3300049571 Bacteria 2334
143 Ga0501036_0339791 3300049572 Bacteria 1254
144 Ga0501036_0810135 3300049572 Bacteria 771
145 Ga0501037_0040615 3300049573 Bacteria 3423
146 Ga0501038_0142787 3300049574 Bacteria 1957
147 Ga0501038_0246824 3300049574 Bacteria 1415
148 Ga0501039_0021887 3300049575 Bacteria 4905
149 Ga0501039_0041206 3300049575 Bacteria 3566
150 Ga0501040_0017225 3300049576 Bacteria 4796
151 Ga0501040_0210965 3300049576 Bacteria 1381
152 Ga0501040_0217450 3300049576 Bacteria 1359
153 Ga0501041_0012576 3300049577 Bacteria 5012
154 Ga0501042_0140288 3300049578 Bacteria 1742
155 Ga0501042_0148465 3300049578 Bacteria 1690
156 Ga0501042_0201974 3300049578 Bacteria 1433
157 Ga0501042_0209214 3300049578 Bacteria 1407
158 Ga0501043_0005514 3300049579 Bacteria 10217
159 Ga0501046_0017114 3300049580 Bacteria 6057
160 Ga0501046_0165847 3300049580 Bacteria 1660
161 Ga0501047_0145150 3300049581 Bacteria 2250
162 Ga0501048_0083453 3300049582 Bacteria 2253
163 Ga0501067_0049841 3300049583 Bacteria 2320
164 Ga0501069_0027740 3300049585 Bacteria 3104
165 Ga0501069_0028320 3300049585 Bacteria 3071
166 Ga0501071_0065245 3300049587 Bacteria 2643
167 Ga0501071_0176045 3300049587 Bacteria 1602
168 Ga0501071_0216318 3300049587 Bacteria 1441
169 Ga0501071_0519784 3300049587 Bacteria 913
170 Ga0501072_0401229 3300049588 Bacteria 1088
171 Ga0501073_0011917 3300049589 Bacteria 6347
172 Ga0501075_0066767 3300049591 Bacteria 2714
173 Ga0501075_0154101 3300049591 Bacteria 1752
174 Ga0501076_0082358 3300049592 Bacteria 2583
175 Ga0501077_0126478 3300049593 Bacteria 1620
176 Ga0501077_0264507 3300049593 Bacteria 1094
177 Ga0501079_0869034 3300049741 Bacteria 710
178 Ga0501080_0079746 3300049742 Bacteria 3043
179 Ga0501083_0053236 3300049744 Bacteria 2717
180 Ga0501035_0062213 3300049822 Bacteria 3321
181 nmdc:mga05p37_1000684_c1 3300050507 Unclassified 888
182 nmdc:mga05p37_273988_c1 3300050507 Bacteria 2015
183 nmdc:mga05p37_39619_c1 3300050507 Bacteria 5786
184 nmdc:mga05p37_651349_c1 3300050507 Bacteria 1179
185 nmdc:mga05p37_940800_c1 3300050507 Bacteria 926
186 nmdc:mga09592_13018_c1 3300050508 Bacteria 6790
187 nmdc:mga09592_180906_c1 3300050508 Bacteria 1824
188 nmdc:mga0qj67_1366_c1 3300050509 Bacteria 17106
189 nmdc:mga0qj67_28439_c1 3300050509 Bacteria 4339
190 nmdc:mga06r32_1111995_c1 3300050510 Bacteria 739
191 nmdc:mga06r32_22509_c1 3300050510 Bacteria 5826
192 nmdc:mga06r32_76259_c1 3300050510 Bacteria 3255
193 nmdc:mga08y16_18099_c1 3300050511 Bacteria 7421
194 nmdc:mga0n895_312152_c1 3300050512 Bacteria 1593
195 Ga0495612_0295170 3300053078 Bacteria 726
196 Ga0495655_0192044 3300053083 Bacteria 664
197 Ga0500616_0007064 3300053153 Bacteria 7204
198 Ga0501084_0048302 3300054114 Bacteria 3562
199 Ga0501084_0792458 3300054114 Bacteria 798
200 Ga0501082_0020984 3300060353 Bacteria 5634
201 Ga0501082_0068626 3300060353 Bacteria 3052
202 Ga0501082_0092455 3300060353 Bacteria 2613
203 Ga0501082_0202776 3300060353 Bacteria 1726
204 Ga0530510_0011060 3300061734 Bacteria 6330
205 Ga0530510_0024547 3300061734 Bacteria 4303
206 Ga0530510_0115705 3300061734 Bacteria 1966

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044694 Ga0466963_0028647 Ga0466963_0028647_655_1311 148
2 3300045049 Ga0466959_0431739 Ga0466959_0431739_158_814 148
3 3300028800 Ga0265338_10490991 Ga0265338_104909912 152
4 3300045976 Ga0466967_0746857 Ga0466967_0746857_38_703 153
5 3300025915 Ga0207693_10112912 Ga0207693_101129121 159
6 3300025939 Ga0207665_10122430 Ga0207665_101224302 159
7 3300006175 Ga0070712_100165158 Ga0070712_1001651583 162
8 3300038443 Ga0395901_0145337 Ga0395901_0145337_926_1555 163
9 3300049578 Ga0501042_0209214 Ga0501042_0209214_744_1322 163
10 3300005981 Ga0081538_10000696 Ga0081538_1000069625 165
11 3300009545 Ga0105237_10001106 Ga0105237_1000110630 165
12 3300025914 Ga0207671_10000491 Ga0207671_1000049129 165
13 3300046514 Ga0495618_0294288 Ga0495618_0294288_132_785 165
14 3300049576 Ga0501040_0210965 Ga0501040_0210965_642_1217 165
15 3300049588 Ga0501072_0401229 Ga0501072_0401229_245_820 165
16 3300013102 Ga0157371_10332911 Ga0157371_103329112 166
17 3300054114 Ga0501084_0792458 Ga0501084_0792458_117_701 166
18 3300005981 Ga0081538_10004533 Ga0081538_1000453311 168
19 3300005981 Ga0081538_10020511 Ga0081538_100205114 168
20 3300009147 Ga0114129_11187056 Ga0114129_111870562 168
21 3300046616 Ga0495668_0587832 Ga0495668_0587832_30_563 168
22 3300049572 Ga0501036_0810135 Ga0501036_0810135_161_748 168
23 3300049576 Ga0501040_0217450 Ga0501040_0217450_316_945 168
24 3300049578 Ga0501042_0140288 Ga0501042_0140288_12_599 168
25 3300049587 Ga0501071_0176045 Ga0501071_0176045_892_1521 168
26 3300049592 Ga0501076_0082358 Ga0501076_0082358_593_1222 168
27 3300060353 Ga0501082_0092455 Ga0501082_0092455_1988_2575 168
28 3300061734 Ga0530510_0024547 Ga0530510_0024547_332_961 168
29 3300005328 Ga0070676_10251723 Ga0070676_102517232 169
30 3300005341 Ga0070691_10107367 Ga0070691_101073672 169
31 3300005343 Ga0070687_100548721 Ga0070687_1005487211 169
32 3300005347 Ga0070668_100040900 Ga0070668_1000409002 169
33 3300005441 Ga0070700_100021229 Ga0070700_1000212292 169
34 3300005457 Ga0070662_100032782 Ga0070662_1000327822 169
35 3300005719 Ga0068861_100066937 Ga0068861_1000669374 169
36 3300006844 Ga0075428_100074512 Ga0075428_1000745125 169
37 3300006846 Ga0075430_100000176 Ga0075430_10000017621 169
38 3300006847 Ga0075431_100003115 Ga0075431_10000311513 169
39 3300006880 Ga0075429_100149807 Ga0075429_1001498074 169
40 3300009093 Ga0105240_11079337 Ga0105240_110793371 169
41 3300009094 Ga0111539_10861979 Ga0111539_108619792 169
42 3300009098 Ga0105245_10033865 Ga0105245_100338654 169
43 3300009147 Ga0114129_10058974 Ga0114129_100589746 169
44 3300009147 Ga0114129_10278919 Ga0114129_102789192 169
45 3300009553 Ga0105249_10035814 Ga0105249_100358144 169
46 3300010375 Ga0105239_10455140 Ga0105239_104551402 169
47 3300013306 Ga0163162_10415813 Ga0163162_104158132 169
48 3300017792 Ga0163161_10236914 Ga0163161_102369143 169
49 3300025907 Ga0207645_10155892 Ga0207645_101558922 169
50 3300025927 Ga0207687_10040761 Ga0207687_100407612 169
51 3300025933 Ga0207706_10000332 Ga0207706_1000033240 169
52 3300025961 Ga0207712_10040541 Ga0207712_100405412 169
53 3300025972 Ga0207668_10088850 Ga0207668_100888502 169
54 3300026075 Ga0207708_10017349 Ga0207708_100173494 169
55 3300026118 Ga0207675_100043708 Ga0207675_1000437083 169
56 3300027907 Ga0207428_10229622 Ga0207428_102296223 169
57 3300037466 Ga0395898_0284677 Ga0395898_0284677_980_1558 169
58 3300038443 Ga0395901_0278165 Ga0395901_0278165_556_1176 169
59 3300046500 Ga0495596_0079616 Ga0495596_0079616_98_682 169
60 3300049572 Ga0501036_0339791 Ga0501036_0339791_278_859 169
61 3300049578 Ga0501042_0201974 Ga0501042_0201974_284_868 169
62 3300049587 Ga0501071_0519784 Ga0501071_0519784_315_896 169
63 3300049591 Ga0501075_0154101 Ga0501075_0154101_1107_1688 169
64 3300049593 Ga0501077_0264507 Ga0501077_0264507_240_821 169
65 3300050507 nmdc:mga05p37_273988_c1 nmdc:mga05p37_273988_c1_1233_1817 169
66 3300050508 nmdc:mga09592_180906_c1 nmdc:mga09592_180906_c1_71_661 169
67 3300050509 nmdc:mga0qj67_1366_c1 nmdc:mga0qj67_1366_c1_9945_10535 169
68 3300050510 nmdc:mga06r32_22509_c1 nmdc:mga06r32_22509_c1_561_1151 169
69 3300053083 Ga0495655_0192044 Ga0495655_0192044_100_636 169
70 3300060353 Ga0501082_0202776 Ga0501082_0202776_236_817 169
71 3300061734 Ga0530510_0115705 Ga0530510_0115705_1358_1939 169
72 3300005981 Ga0081538_10014118 Ga0081538_100141186 170
73 3300005981 Ga0081538_10047036 Ga0081538_100470365 170
74 3300005983 Ga0081540_1050188 Ga0081540_10501882 170
75 3300011119 Ga0105246_10779104 Ga0105246_107791042 170
76 3300037466 Ga0395898_0451592 Ga0395898_0451592_501_1082 170
77 3300042008 Ga0439450_059328 Ga0439450_059328_86_718 170
78 3300042461 Ga0439460_0017136 Ga0439460_0017136_174_806 170
79 3300005985 Ga0081539_10150884 Ga0081539_101508842 171
80 3300044694 Ga0466963_0414751 Ga0466963_0414751_227_871 171
81 3300006847 Ga0075431_100245077 Ga0075431_1002450774 172
82 3300050510 nmdc:mga06r32_76259_c1 nmdc:mga06r32_76259_c1_2407_2991 172
83 3300028800 Ga0265338_10096696 Ga0265338_100966961 174
84 3300053078 Ga0495612_0295170 Ga0495612_0295170_49_696 175
85 3300006844 Ga0075428_100057399 Ga0075428_1000573993 176
86 3300006846 Ga0075430_100112317 Ga0075430_1001123174 176
87 3300006880 Ga0075429_100109702 Ga0075429_1001097023 176
88 3300009147 Ga0114129_10000609 Ga0114129_1000060919 176
89 3300050507 nmdc:mga05p37_39619_c1 nmdc:mga05p37_39619_c1_3186_3770 176
90 3300050508 nmdc:mga09592_13018_c1 nmdc:mga09592_13018_c1_1072_1656 176
91 3300050509 nmdc:mga0qj67_28439_c1 nmdc:mga0qj67_28439_c1_2036_2620 176
92 3300028556 Ga0265337_1002321 Ga0265337_10023213 177
93 3300028563 Ga0265319_1000125 Ga0265319_100012532 177
94 3300028577 Ga0265318_10000427 Ga0265318_1000042735 177
95 3300028654 Ga0265322_10005375 Ga0265322_100053752 177
96 3300028666 Ga0265336_10000017 Ga0265336_1000001780 177
97 3300028800 Ga0265338_10000044 Ga0265338_1000004480 177
98 3300029957 Ga0265324_10005753 Ga0265324_100057533 177
99 3300031247 Ga0265340_10000003 Ga0265340_10000003196 177
100 3300031249 Ga0265339_10074717 Ga0265339_100747172 177
101 3300031344 Ga0265316_10025738 Ga0265316_100257383 177
102 3300031712 Ga0265342_10028352 Ga0265342_100283524 177
103 3300049585 Ga0501069_0027740 Ga0501069_0027740_723_1355 178
104 3300049568 Ga0501031_0053775 Ga0501031_0053775_842_1447 179
105 3300049574 Ga0501038_0142787 Ga0501038_0142787_404_1009 179
106 3300049575 Ga0501039_0041206 Ga0501039_0041206_1784_2389 179
107 3300049576 Ga0501040_0017225 Ga0501040_0017225_132_737 179
108 3300049577 Ga0501041_0012576 Ga0501041_0012576_1085_1690 179
109 3300049580 Ga0501046_0165847 Ga0501046_0165847_430_1035 179
110 3300049582 Ga0501048_0083453 Ga0501048_0083453_923_1528 179
111 3300049587 Ga0501071_0065245 Ga0501071_0065245_12_617 179
112 3300049591 Ga0501075_0066767 Ga0501075_0066767_160_765 179
113 3300049593 Ga0501077_0126478 Ga0501077_0126478_564_1169 179
114 3300050507 nmdc:mga05p37_651349_c1 nmdc:mga05p37_651349_c1_46_693 179
115 3300050510 nmdc:mga06r32_1111995_c1 nmdc:mga06r32_1111995_c1_30_671 179
116 3300054114 Ga0501084_0048302 Ga0501084_0048302_2426_3031 179
117 3300060353 Ga0501082_0068626 Ga0501082_0068626_1647_2252 179
118 3300061734 Ga0530510_0011060 Ga0530510_0011060_464_1069 179
119 3300006846 Ga0075430_100234651 Ga0075430_1002346513 181
120 3300009094 Ga0111539_10015829 Ga0111539_1001582910 181
121 3300009147 Ga0114129_10743052 Ga0114129_107430522 181
122 3300009174 Ga0105241_10582804 Ga0105241_105828041 181
123 3300025916 Ga0207663_10785515 Ga0207663_107855151 181
124 3300027907 Ga0207428_10029865 Ga0207428_100298653 181
125 3300032002 Ga0307416_100031816 Ga0307416_1000318164 181
126 3300032126 Ga0307415_100199134 Ga0307415_1001991343 181
127 3300034820 Ga0373959_0025274 Ga0373959_0025274_112_693 181
128 3300035092 Ga0373952_0092174 Ga0373952_0092174_100_681 181
129 3300035121 Ga0373960_0035862 Ga0373960_0035862_655_1236 181
130 3300035242 Ga0373962_0022886 Ga0373962_0022886_402_983 181
131 3300035691 Ga0373931_0038680 Ga0373931_0038680_239_820 181
132 3300046500 Ga0495596_0092364 Ga0495596_0092364_215_796 181
133 3300050507 nmdc:mga05p37_1000684_c1 nmdc:mga05p37_1000684_c1_30_611 181
134 3300050511 nmdc:mga08y16_18099_c1 nmdc:mga08y16_18099_c1_5082_5663 181
135 3300050512 nmdc:mga0n895_312152_c1 nmdc:mga0n895_312152_c1_191_772 181
136 3300031852 Ga0307410_10309691 Ga0307410_103096911 182
137 3300031901 Ga0307406_10020823 Ga0307406_100208233 182
138 3300005981 Ga0081538_10015044 Ga0081538_100150445 183
139 3300013307 Ga0157372_10884166 Ga0157372_108841662 183
140 3300048907 Ga0496104_0000030 Ga0496104_0000030_122386_122976 183
141 3300048908 Ga0496105_0148347 Ga0496105_0148347_994_1584 183
142 3300048913 Ga0496110_0000230 Ga0496110_0000230_20811_21401 183
143 3300048914 Ga0496111_0000016 Ga0496111_0000016_60773_61363 183
144 3300005981 Ga0081538_10000213 Ga0081538_1000021331 184
145 3300032002 Ga0307416_100215636 Ga0307416_1002156362 184
146 3300032005 Ga0307411_10770072 Ga0307411_107700721 184
147 3300037418 Ga0395900_0147772 Ga0395900_0147772_1776_2354 184
148 3300037466 Ga0395898_0398840 Ga0395898_0398840_366_944 184
149 3300005981 Ga0081538_10042152 Ga0081538_100421523 187
150 3300048915 Ga0496112_0646249 Ga0496112_0646249_20_589 187
151 3300003373 JGI25407J50210_10003977 JGI25407J50210_100039773 189
152 3300005339 Ga0070660_100009576 Ga0070660_1000095763 189
153 3300005434 Ga0070709_10127393 Ga0070709_101273932 189
154 3300005434 Ga0070709_10559588 Ga0070709_105595881 189
155 3300005439 Ga0070711_100013122 Ga0070711_1000131227 189
156 3300005444 Ga0070694_100396028 Ga0070694_1003960282 189
157 3300005981 Ga0081538_10000152 Ga0081538_1000015249 189
158 3300005981 Ga0081538_10019427 Ga0081538_100194274 189
159 3300006048 Ga0075363_100038606 Ga0075363_1000386062 189
160 3300006175 Ga0070712_100007319 Ga0070712_1000073194 189
161 3300006175 Ga0070712_100249750 Ga0070712_1002497502 189
162 3300009098 Ga0105245_11205202 Ga0105245_112052021 189
163 3300020070 Ga0206356_11679709 Ga0206356_116797093 189
164 3300025898 Ga0207692_10204220 Ga0207692_102042202 189
165 3300025915 Ga0207693_10013407 Ga0207693_100134075 189
166 3300025919 Ga0207657_10038489 Ga0207657_100384893 189
167 3300025939 Ga0207665_10054822 Ga0207665_100548222 189
168 3300028563 Ga0265319_1000015 Ga0265319_100001514 189
169 3300031240 Ga0265320_10005688 Ga0265320_100056888 189
170 3300031251 Ga0265327_10033767 Ga0265327_100337674 189
171 3300035170 Ga0373943_0203778 Ga0373943_0203778_200_859 189
172 3300037068 Ga0373925_0060135 Ga0373925_0060135_1985_2644 189
173 3300037418 Ga0395900_0331834 Ga0395900_0331834_258_920 189
174 3300044684 Ga0466966_0225458 Ga0466966_0225458_77_718 189
175 3300044719 Ga0466971_0097687 Ga0466971_0097687_236_862 189
176 3300044735 Ga0466968_0135825 Ga0466968_0135825_37_684 189
177 3300044842 Ga0466957_0685970 Ga0466957_0685970_30_656 189
178 3300045976 Ga0466967_0517948 Ga0466967_0517948_216_851 189
179 3300046463 Ga0495653_0206135 Ga0495653_0206135_204_818 189
180 3300046477 Ga0495664_0000311 Ga0495664_0000311_22663_23241 189
181 3300046683 Ga0495658_0238113 Ga0495658_0238113_382_1068 189
182 3300046809 Ga0495600_0058672 Ga0495600_0058672_762_1391 189
183 3300047320 Ga0495672_0132457 Ga0495672_0132457_35_655 189
184 3300048905 Ga0496102_0000019 Ga0496102_0000019_251336_251914 189
185 3300048906 Ga0496103_0000059 Ga0496103_0000059_12667_13245 189
186 3300048913 Ga0496110_0672524 Ga0496110_0672524_273_899 189
187 3300049569 Ga0501032_0061357 Ga0501032_0061357_684_1370 189
188 3300049571 Ga0501034_0146931 Ga0501034_0146931_1445_2131 189
189 3300049573 Ga0501037_0040615 Ga0501037_0040615_1309_1995 189
190 3300049574 Ga0501038_0246824 Ga0501038_0246824_43_729 189
191 3300049575 Ga0501039_0021887 Ga0501039_0021887_2386_3072 189
192 3300049578 Ga0501042_0148465 Ga0501042_0148465_631_1305 189
193 3300049579 Ga0501043_0005514 Ga0501043_0005514_621_1307 189
194 3300049580 Ga0501046_0017114 Ga0501046_0017114_2197_2883 189
195 3300049581 Ga0501047_0145150 Ga0501047_0145150_48_734 189
196 3300049583 Ga0501067_0049841 Ga0501067_0049841_984_1670 189
197 3300049585 Ga0501069_0028320 Ga0501069_0028320_885_1559 189
198 3300049587 Ga0501071_0216318 Ga0501071_0216318_832_1425 189
199 3300049589 Ga0501073_0011917 Ga0501073_0011917_552_1238 189
200 3300049741 Ga0501079_0869034 Ga0501079_0869034_41_634 189
201 3300049742 Ga0501080_0079746 Ga0501080_0079746_2026_2712 189
202 3300049744 Ga0501083_0053236 Ga0501083_0053236_1050_1736 189
203 3300049822 Ga0501035_0062213 Ga0501035_0062213_1091_1777 189
204 3300050507 nmdc:mga05p37_940800_c1 nmdc:mga05p37_940800_c1_234_815 189
205 3300053153 Ga0500616_0007064 Ga0500616_0007064_5533_6162 189
206 3300060353 Ga0501082_0020984 Ga0501082_0020984_2463_3149 189

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04116

FA_hydroxylase

Fatty acid hydroxylase

61

194

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zr0-assembly1.cif.gz_A full length scs7p (only hydroxylase domain visible) 0.824 9 185
4zr0-assembly1.cif.gz_A full length scs7p (only hydroxylase domain visible) 0.7727 9 185
7x7y-assembly1.cif.gz_a cryo-em structure of human tric-atp-open state 0.3744 99 161
7x3u-assembly1.cif.gz_A cryo-em structure of human tric-adp 0.3646 105 169
7x0a-assembly1.cif.gz_A cryo-em structure of human tric-npp state 0.3646 105 169
ID Description Score Start End Superfamily
af_Q5A896_302_490_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4271 6 155 1.20.1250.20
af_Q96QE2_73_430_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4156 6 162 1.20.1250.20
af_Q4DA30_210_605_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4047 5 183 1.20.1250.20
af_Q4DWN2_303_707_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.391 2 162 1.20.1250.20
af_P9WLI3_230_442_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3849 4 183 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A4V4H2M0-F1-model_v4 Fatty acid hydroxylase domain-containing protein 0.864 2 155 GO:0005789
GO:0006631
GO:0080132
AF-A0A022Y6U8-F1-model_v4 Ceramide very long chain fatty acid hydroxylase (EC 1.-.-.-) 0.8614 9 148 GO:0005506
GO:0005789
GO:0006633
GO:0020037
GO:0080132
AF-M1ACD2-F1-model_v4 Sphingolipid fatty acid alpha hydroxylase 0.8583 6 162 GO:0005783
GO:0005789
GO:0006631
GO:0080132
AF-A0A7Y5LAD7-F1-model_v4 Fatty acid hydroxylase 0.8504 2 156 GO:0006631
GO:0016020
GO:0080132
AF-A0A3D1DB57-F1-model_v4 deleted 0.8502 2 148

Feature Viewer

pLDDT pTM Quality
82.31 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map