F314915
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 206 | 139 | 206 | 193 |
Family's Representative Sequence
| Representative Sequence | 3300005981|Ga0081538_10015044|Ga0081538_100150445 |
| Length | 204 |
| Sequence | MDARRSDVLKASPRMFDSNILDRLSRVHPMVPPLIFVPAIIALLVVGARGAPTTLQVIGLVIGGYLFWTLTEYWLHRLIFHFEPEEGIGARFHWIIHGVHHDHPNDPLRLVMPPSVSVPLALAFWGLFVLVLGTPWAHVFMAGFLMGYLVYDMTHRPRTGLGKLMRELHMRHHFQDDTRGFGVSAPFWDYVFRTPQKRRAQTGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 5 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 8 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 13 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 14 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 15 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 16 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 17 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 19 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 20 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 21 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 22 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 23 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 24 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 25 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 26 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 32 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 36 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 50 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 51 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 52 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 53 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 54 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 55 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 56 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 57 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 58 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 59 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 60 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 61 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 62 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 63 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 64 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 65 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 66 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 67 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 68 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 69 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 70 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 71 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 72 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 73 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 74 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 75 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 76 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 77 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 78 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 79 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 80 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 81 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 82 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 83 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 84 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 85 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 86 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 87 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 96 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 97 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 98 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 99 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 100 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 101 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 102 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 103 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 104 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 105 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 106 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 107 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 108 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 109 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 110 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 111 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 112 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 113 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 114 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 115 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 116 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 117 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 118 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 119 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 120 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 121 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 122 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 123 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 124 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 125 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 126 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 127 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 128 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 129 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 130 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 131 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 132 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 133 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 134 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 137 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 138 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.51 |
| Metatranscriptomes | 0.49 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.97 |
| Nodule | 0 |
| Rhizoplane | 3.88 |
| Rhizosphere | 95.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25407J50210_10003977 | 3300003373 | Bacteria | 3581 |
| 2 | Ga0070676_10251723 | 3300005328 | Bacteria | 1179 |
| 3 | Ga0070660_100009576 | 3300005339 | Bacteria | 6823 |
| 4 | Ga0070691_10107367 | 3300005341 | Bacteria | 1393 |
| 5 | Ga0070687_100548721 | 3300005343 | Bacteria | 786 |
| 6 | Ga0070668_100040900 | 3300005347 | Bacteria | 3549 |
| 7 | Ga0070709_10127393 | 3300005434 | Bacteria | 1734 |
| 8 | Ga0070709_10559588 | 3300005434 | Bacteria | 876 |
| 9 | Ga0070711_100013122 | 3300005439 | Bacteria | 5196 |
| 10 | Ga0070700_100021229 | 3300005441 | Bacteria | 3773 |
| 11 | Ga0070694_100396028 | 3300005444 | Bacteria | 1080 |
| 12 | Ga0070662_100032782 | 3300005457 | Bacteria | 3653 |
| 13 | Ga0068861_100066937 | 3300005719 | Bacteria | 2770 |
| 14 | Ga0081538_10000152 | 3300005981 | Bacteria | 71751 |
| 15 | Ga0081538_10000213 | 3300005981 | Bacteria | 64771 |
| 16 | Ga0081538_10000696 | 3300005981 | Bacteria | 36915 |
| 17 | Ga0081538_10004533 | 3300005981 | Bacteria | 12794 |
| 18 | Ga0081538_10014118 | 3300005981 | Bacteria | 6276 |
| 19 | Ga0081538_10015044 | 3300005981 | Bacteria | 6016 |
| 20 | Ga0081538_10019427 | 3300005981 | Bacteria | 5051 |
| 21 | Ga0081538_10020511 | 3300005981 | Bacteria | 4859 |
| 22 | Ga0081538_10042152 | 3300005981 | Bacteria | 2885 |
| 23 | Ga0081538_10047036 | 3300005981 | Bacteria | 2652 |
| 24 | Ga0081540_1050188 | 3300005983 | Bacteria | 2074 |
| 25 | Ga0081539_10150884 | 3300005985 | Bacteria | 1118 |
| 26 | Ga0075363_100038606 | 3300006048 | Bacteria | 2512 |
| 27 | Ga0070712_100007319 | 3300006175 | Bacteria | 6889 |
| 28 | Ga0070712_100165158 | 3300006175 | Bacteria | 1713 |
| 29 | Ga0070712_100249750 | 3300006175 | Bacteria | 1417 |
| 30 | Ga0075428_100057399 | 3300006844 | Bacteria | 4262 |
| 31 | Ga0075428_100074512 | 3300006844 | Bacteria | 3708 |
| 32 | Ga0075430_100000176 | 3300006846 | Bacteria | 42404 |
| 33 | Ga0075430_100112317 | 3300006846 | Bacteria | 2271 |
| 34 | Ga0075430_100234651 | 3300006846 | Bacteria | 1521 |
| 35 | Ga0075431_100003115 | 3300006847 | Bacteria | 16051 |
| 36 | Ga0075431_100245077 | 3300006847 | Bacteria | 1822 |
| 37 | Ga0075429_100109702 | 3300006880 | Bacteria | 2413 |
| 38 | Ga0075429_100149807 | 3300006880 | Bacteria | 2042 |
| 39 | Ga0105240_11079337 | 3300009093 | Bacteria | 855 |
| 40 | Ga0111539_10015829 | 3300009094 | Bacteria | 9368 |
| 41 | Ga0111539_10861979 | 3300009094 | Bacteria | 1054 |
| 42 | Ga0105245_10033865 | 3300009098 | Bacteria | 4527 |
| 43 | Ga0105245_11205202 | 3300009098 | Bacteria | 805 |
| 44 | Ga0114129_10000609 | 3300009147 | Bacteria | 44313 |
| 45 | Ga0114129_10058974 | 3300009147 | Bacteria | 5367 |
| 46 | Ga0114129_10278919 | 3300009147 | Bacteria | 2234 |
| 47 | Ga0114129_10743052 | 3300009147 | Bacteria | 1257 |
| 48 | Ga0114129_11187056 | 3300009147 | Bacteria | 951 |
| 49 | Ga0105241_10582804 | 3300009174 | Bacteria | 1008 |
| 50 | Ga0105237_10001106 | 3300009545 | Bacteria | 36105 |
| 51 | Ga0105249_10035814 | 3300009553 | Bacteria | 4500 |
| 52 | Ga0105239_10455140 | 3300010375 | Bacteria | 1452 |
| 53 | Ga0105246_10779104 | 3300011119 | Bacteria | 846 |
| 54 | Ga0157371_10332911 | 3300013102 | Bacteria | 1103 |
| 55 | Ga0163162_10415813 | 3300013306 | Bacteria | 1477 |
| 56 | Ga0157372_10884166 | 3300013307 | Bacteria | 1037 |
| 57 | Ga0163161_10236914 | 3300017792 | Bacteria | 1418 |
| 58 | Ga0206356_11679709 | 3300020070 | Bacteria | 3626 |
| 59 | Ga0207692_10204220 | 3300025898 | Bacteria | 1163 |
| 60 | Ga0207645_10155892 | 3300025907 | Bacteria | 1492 |
| 61 | Ga0207671_10000491 | 3300025914 | Bacteria | 53763 |
| 62 | Ga0207693_10013407 | 3300025915 | Bacteria | 6608 |
| 63 | Ga0207693_10112912 | 3300025915 | Bacteria | 2131 |
| 64 | Ga0207663_10785515 | 3300025916 | Bacteria | 758 |
| 65 | Ga0207657_10038489 | 3300025919 | Bacteria | 4257 |
| 66 | Ga0207687_10040761 | 3300025927 | Bacteria | 3185 |
| 67 | Ga0207706_10000332 | 3300025933 | Bacteria | 51297 |
| 68 | Ga0207665_10054822 | 3300025939 | Bacteria | 2689 |
| 69 | Ga0207665_10122430 | 3300025939 | Bacteria | 1839 |
| 70 | Ga0207712_10040541 | 3300025961 | Bacteria | 3197 |
| 71 | Ga0207668_10088850 | 3300025972 | Bacteria | 2264 |
| 72 | Ga0207708_10017349 | 3300026075 | Bacteria | 5419 |
| 73 | Ga0207675_100043708 | 3300026118 | Bacteria | 4185 |
| 74 | Ga0207428_10029865 | 3300027907 | Bacteria | 4510 |
| 75 | Ga0207428_10229622 | 3300027907 | Bacteria | 1389 |
| 76 | Ga0265337_1002321 | 3300028556 | Bacteria | 8819 |
| 77 | Ga0265319_1000015 | 3300028563 | Bacteria | 176382 |
| 78 | Ga0265319_1000125 | 3300028563 | Bacteria | 57338 |
| 79 | Ga0265318_10000427 | 3300028577 | Bacteria | 32245 |
| 80 | Ga0265322_10005375 | 3300028654 | Bacteria | 3792 |
| 81 | Ga0265336_10000017 | 3300028666 | Bacteria | 231370 |
| 82 | Ga0265338_10000044 | 3300028800 | Bacteria | 223643 |
| 83 | Ga0265338_10096696 | 3300028800 | Bacteria | 2422 |
| 84 | Ga0265338_10490991 | 3300028800 | Bacteria | 865 |
| 85 | Ga0265324_10005753 | 3300029957 | Bacteria | 5282 |
| 86 | Ga0265320_10005688 | 3300031240 | Bacteria | 7954 |
| 87 | Ga0265340_10000003 | 3300031247 | Bacteria | 320583 |
| 88 | Ga0265339_10074717 | 3300031249 | Bacteria | 1800 |
| 89 | Ga0265327_10033767 | 3300031251 | Bacteria | 2846 |
| 90 | Ga0265316_10025738 | 3300031344 | Bacteria | 4905 |
| 91 | Ga0265342_10028352 | 3300031712 | Bacteria | 3490 |
| 92 | Ga0307410_10309691 | 3300031852 | Bacteria | 1249 |
| 93 | Ga0307406_10020823 | 3300031901 | Bacteria | 3870 |
| 94 | Ga0307416_100031816 | 3300032002 | Bacteria | 3977 |
| 95 | Ga0307416_100215636 | 3300032002 | Bacteria | 1836 |
| 96 | Ga0307411_10770072 | 3300032005 | Bacteria | 845 |
| 97 | Ga0307415_100199134 | 3300032126 | Bacteria | 1588 |
| 98 | Ga0373959_0025274 | 3300034820 | Bacteria | 1166 |
| 99 | Ga0373952_0092174 | 3300035092 | Bacteria | 788 |
| 100 | Ga0373960_0035862 | 3300035121 | Bacteria | 1410 |
| 101 | Ga0373943_0203778 | 3300035170 | Bacteria | 1096 |
| 102 | Ga0373962_0022886 | 3300035242 | Bacteria | 1660 |
| 103 | Ga0373931_0038680 | 3300035691 | Bacteria | 2497 |
| 104 | Ga0373925_0060135 | 3300037068 | Bacteria | 2853 |
| 105 | Ga0395900_0147772 | 3300037418 | Bacteria | 2403 |
| 106 | Ga0395900_0331834 | 3300037418 | Bacteria | 1499 |
| 107 | Ga0395898_0284677 | 3300037466 | Bacteria | 1577 |
| 108 | Ga0395898_0398840 | 3300037466 | Bacteria | 1312 |
| 109 | Ga0395898_0451592 | 3300037466 | Bacteria | 1224 |
| 110 | Ga0395901_0145337 | 3300038443 | Bacteria | 2493 |
| 111 | Ga0395901_0278165 | 3300038443 | Bacteria | 1740 |
| 112 | Ga0439450_059328 | 3300042008 | Bacteria | 922 |
| 113 | Ga0439460_0017136 | 3300042461 | Bacteria | 1938 |
| 114 | Ga0466966_0225458 | 3300044684 | Bacteria | 1131 |
| 115 | Ga0466963_0028647 | 3300044694 | Bacteria | 3579 |
| 116 | Ga0466963_0414751 | 3300044694 | Bacteria | 950 |
| 117 | Ga0466971_0097687 | 3300044719 | Bacteria | 1348 |
| 118 | Ga0466968_0135825 | 3300044735 | Bacteria | 1122 |
| 119 | Ga0466957_0685970 | 3300044842 | Bacteria | 722 |
| 120 | Ga0466959_0431739 | 3300045049 | Bacteria | 894 |
| 121 | Ga0466967_0517948 | 3300045976 | Bacteria | 1172 |
| 122 | Ga0466967_0746857 | 3300045976 | Unclassified | 970 |
| 123 | Ga0495653_0206135 | 3300046463 | Bacteria | 1331 |
| 124 | Ga0495664_0000311 | 3300046477 | Bacteria | 23450 |
| 125 | Ga0495596_0079616 | 3300046500 | Bacteria | 1272 |
| 126 | Ga0495596_0092364 | 3300046500 | Bacteria | 1175 |
| 127 | Ga0495618_0294288 | 3300046514 | Bacteria | 1010 |
| 128 | Ga0495668_0587832 | 3300046616 | Bacteria | 615 |
| 129 | Ga0495658_0238113 | 3300046683 | Bacteria | 1143 |
| 130 | Ga0495600_0058672 | 3300046809 | Bacteria | 2514 |
| 131 | Ga0495672_0132457 | 3300047320 | Bacteria | 1310 |
| 132 | Ga0496102_0000019 | 3300048905 | Bacteria | 264583 |
| 133 | Ga0496103_0000059 | 3300048906 | Bacteria | 139196 |
| 134 | Ga0496104_0000030 | 3300048907 | Bacteria | 201919 |
| 135 | Ga0496105_0148347 | 3300048908 | Bacteria | 1928 |
| 136 | Ga0496110_0000230 | 3300048913 | Bacteria | 36192 |
| 137 | Ga0496110_0672524 | 3300048913 | Bacteria | 936 |
| 138 | Ga0496111_0000016 | 3300048914 | Bacteria | 77108 |
| 139 | Ga0496112_0646249 | 3300048915 | Bacteria | 988 |
| 140 | Ga0501031_0053775 | 3300049568 | Bacteria | 2624 |
| 141 | Ga0501032_0061357 | 3300049569 | Bacteria | 2520 |
| 142 | Ga0501034_0146931 | 3300049571 | Bacteria | 2334 |
| 143 | Ga0501036_0339791 | 3300049572 | Bacteria | 1254 |
| 144 | Ga0501036_0810135 | 3300049572 | Bacteria | 771 |
| 145 | Ga0501037_0040615 | 3300049573 | Bacteria | 3423 |
| 146 | Ga0501038_0142787 | 3300049574 | Bacteria | 1957 |
| 147 | Ga0501038_0246824 | 3300049574 | Bacteria | 1415 |
| 148 | Ga0501039_0021887 | 3300049575 | Bacteria | 4905 |
| 149 | Ga0501039_0041206 | 3300049575 | Bacteria | 3566 |
| 150 | Ga0501040_0017225 | 3300049576 | Bacteria | 4796 |
| 151 | Ga0501040_0210965 | 3300049576 | Bacteria | 1381 |
| 152 | Ga0501040_0217450 | 3300049576 | Bacteria | 1359 |
| 153 | Ga0501041_0012576 | 3300049577 | Bacteria | 5012 |
| 154 | Ga0501042_0140288 | 3300049578 | Bacteria | 1742 |
| 155 | Ga0501042_0148465 | 3300049578 | Bacteria | 1690 |
| 156 | Ga0501042_0201974 | 3300049578 | Bacteria | 1433 |
| 157 | Ga0501042_0209214 | 3300049578 | Bacteria | 1407 |
| 158 | Ga0501043_0005514 | 3300049579 | Bacteria | 10217 |
| 159 | Ga0501046_0017114 | 3300049580 | Bacteria | 6057 |
| 160 | Ga0501046_0165847 | 3300049580 | Bacteria | 1660 |
| 161 | Ga0501047_0145150 | 3300049581 | Bacteria | 2250 |
| 162 | Ga0501048_0083453 | 3300049582 | Bacteria | 2253 |
| 163 | Ga0501067_0049841 | 3300049583 | Bacteria | 2320 |
| 164 | Ga0501069_0027740 | 3300049585 | Bacteria | 3104 |
| 165 | Ga0501069_0028320 | 3300049585 | Bacteria | 3071 |
| 166 | Ga0501071_0065245 | 3300049587 | Bacteria | 2643 |
| 167 | Ga0501071_0176045 | 3300049587 | Bacteria | 1602 |
| 168 | Ga0501071_0216318 | 3300049587 | Bacteria | 1441 |
| 169 | Ga0501071_0519784 | 3300049587 | Bacteria | 913 |
| 170 | Ga0501072_0401229 | 3300049588 | Bacteria | 1088 |
| 171 | Ga0501073_0011917 | 3300049589 | Bacteria | 6347 |
| 172 | Ga0501075_0066767 | 3300049591 | Bacteria | 2714 |
| 173 | Ga0501075_0154101 | 3300049591 | Bacteria | 1752 |
| 174 | Ga0501076_0082358 | 3300049592 | Bacteria | 2583 |
| 175 | Ga0501077_0126478 | 3300049593 | Bacteria | 1620 |
| 176 | Ga0501077_0264507 | 3300049593 | Bacteria | 1094 |
| 177 | Ga0501079_0869034 | 3300049741 | Bacteria | 710 |
| 178 | Ga0501080_0079746 | 3300049742 | Bacteria | 3043 |
| 179 | Ga0501083_0053236 | 3300049744 | Bacteria | 2717 |
| 180 | Ga0501035_0062213 | 3300049822 | Bacteria | 3321 |
| 181 | nmdc:mga05p37_1000684_c1 | 3300050507 | Unclassified | 888 |
| 182 | nmdc:mga05p37_273988_c1 | 3300050507 | Bacteria | 2015 |
| 183 | nmdc:mga05p37_39619_c1 | 3300050507 | Bacteria | 5786 |
| 184 | nmdc:mga05p37_651349_c1 | 3300050507 | Bacteria | 1179 |
| 185 | nmdc:mga05p37_940800_c1 | 3300050507 | Bacteria | 926 |
| 186 | nmdc:mga09592_13018_c1 | 3300050508 | Bacteria | 6790 |
| 187 | nmdc:mga09592_180906_c1 | 3300050508 | Bacteria | 1824 |
| 188 | nmdc:mga0qj67_1366_c1 | 3300050509 | Bacteria | 17106 |
| 189 | nmdc:mga0qj67_28439_c1 | 3300050509 | Bacteria | 4339 |
| 190 | nmdc:mga06r32_1111995_c1 | 3300050510 | Bacteria | 739 |
| 191 | nmdc:mga06r32_22509_c1 | 3300050510 | Bacteria | 5826 |
| 192 | nmdc:mga06r32_76259_c1 | 3300050510 | Bacteria | 3255 |
| 193 | nmdc:mga08y16_18099_c1 | 3300050511 | Bacteria | 7421 |
| 194 | nmdc:mga0n895_312152_c1 | 3300050512 | Bacteria | 1593 |
| 195 | Ga0495612_0295170 | 3300053078 | Bacteria | 726 |
| 196 | Ga0495655_0192044 | 3300053083 | Bacteria | 664 |
| 197 | Ga0500616_0007064 | 3300053153 | Bacteria | 7204 |
| 198 | Ga0501084_0048302 | 3300054114 | Bacteria | 3562 |
| 199 | Ga0501084_0792458 | 3300054114 | Bacteria | 798 |
| 200 | Ga0501082_0020984 | 3300060353 | Bacteria | 5634 |
| 201 | Ga0501082_0068626 | 3300060353 | Bacteria | 3052 |
| 202 | Ga0501082_0092455 | 3300060353 | Bacteria | 2613 |
| 203 | Ga0501082_0202776 | 3300060353 | Bacteria | 1726 |
| 204 | Ga0530510_0011060 | 3300061734 | Bacteria | 6330 |
| 205 | Ga0530510_0024547 | 3300061734 | Bacteria | 4303 |
| 206 | Ga0530510_0115705 | 3300061734 | Bacteria | 1966 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044694 | Ga0466963_0028647 | Ga0466963_0028647_655_1311 | 148 |
| 2 | 3300045049 | Ga0466959_0431739 | Ga0466959_0431739_158_814 | 148 |
| 3 | 3300028800 | Ga0265338_10490991 | Ga0265338_104909912 | 152 |
| 4 | 3300045976 | Ga0466967_0746857 | Ga0466967_0746857_38_703 | 153 |
| 5 | 3300025915 | Ga0207693_10112912 | Ga0207693_101129121 | 159 |
| 6 | 3300025939 | Ga0207665_10122430 | Ga0207665_101224302 | 159 |
| 7 | 3300006175 | Ga0070712_100165158 | Ga0070712_1001651583 | 162 |
| 8 | 3300038443 | Ga0395901_0145337 | Ga0395901_0145337_926_1555 | 163 |
| 9 | 3300049578 | Ga0501042_0209214 | Ga0501042_0209214_744_1322 | 163 |
| 10 | 3300005981 | Ga0081538_10000696 | Ga0081538_1000069625 | 165 |
| 11 | 3300009545 | Ga0105237_10001106 | Ga0105237_1000110630 | 165 |
| 12 | 3300025914 | Ga0207671_10000491 | Ga0207671_1000049129 | 165 |
| 13 | 3300046514 | Ga0495618_0294288 | Ga0495618_0294288_132_785 | 165 |
| 14 | 3300049576 | Ga0501040_0210965 | Ga0501040_0210965_642_1217 | 165 |
| 15 | 3300049588 | Ga0501072_0401229 | Ga0501072_0401229_245_820 | 165 |
| 16 | 3300013102 | Ga0157371_10332911 | Ga0157371_103329112 | 166 |
| 17 | 3300054114 | Ga0501084_0792458 | Ga0501084_0792458_117_701 | 166 |
| 18 | 3300005981 | Ga0081538_10004533 | Ga0081538_1000453311 | 168 |
| 19 | 3300005981 | Ga0081538_10020511 | Ga0081538_100205114 | 168 |
| 20 | 3300009147 | Ga0114129_11187056 | Ga0114129_111870562 | 168 |
| 21 | 3300046616 | Ga0495668_0587832 | Ga0495668_0587832_30_563 | 168 |
| 22 | 3300049572 | Ga0501036_0810135 | Ga0501036_0810135_161_748 | 168 |
| 23 | 3300049576 | Ga0501040_0217450 | Ga0501040_0217450_316_945 | 168 |
| 24 | 3300049578 | Ga0501042_0140288 | Ga0501042_0140288_12_599 | 168 |
| 25 | 3300049587 | Ga0501071_0176045 | Ga0501071_0176045_892_1521 | 168 |
| 26 | 3300049592 | Ga0501076_0082358 | Ga0501076_0082358_593_1222 | 168 |
| 27 | 3300060353 | Ga0501082_0092455 | Ga0501082_0092455_1988_2575 | 168 |
| 28 | 3300061734 | Ga0530510_0024547 | Ga0530510_0024547_332_961 | 168 |
| 29 | 3300005328 | Ga0070676_10251723 | Ga0070676_102517232 | 169 |
| 30 | 3300005341 | Ga0070691_10107367 | Ga0070691_101073672 | 169 |
| 31 | 3300005343 | Ga0070687_100548721 | Ga0070687_1005487211 | 169 |
| 32 | 3300005347 | Ga0070668_100040900 | Ga0070668_1000409002 | 169 |
| 33 | 3300005441 | Ga0070700_100021229 | Ga0070700_1000212292 | 169 |
| 34 | 3300005457 | Ga0070662_100032782 | Ga0070662_1000327822 | 169 |
| 35 | 3300005719 | Ga0068861_100066937 | Ga0068861_1000669374 | 169 |
| 36 | 3300006844 | Ga0075428_100074512 | Ga0075428_1000745125 | 169 |
| 37 | 3300006846 | Ga0075430_100000176 | Ga0075430_10000017621 | 169 |
| 38 | 3300006847 | Ga0075431_100003115 | Ga0075431_10000311513 | 169 |
| 39 | 3300006880 | Ga0075429_100149807 | Ga0075429_1001498074 | 169 |
| 40 | 3300009093 | Ga0105240_11079337 | Ga0105240_110793371 | 169 |
| 41 | 3300009094 | Ga0111539_10861979 | Ga0111539_108619792 | 169 |
| 42 | 3300009098 | Ga0105245_10033865 | Ga0105245_100338654 | 169 |
| 43 | 3300009147 | Ga0114129_10058974 | Ga0114129_100589746 | 169 |
| 44 | 3300009147 | Ga0114129_10278919 | Ga0114129_102789192 | 169 |
| 45 | 3300009553 | Ga0105249_10035814 | Ga0105249_100358144 | 169 |
| 46 | 3300010375 | Ga0105239_10455140 | Ga0105239_104551402 | 169 |
| 47 | 3300013306 | Ga0163162_10415813 | Ga0163162_104158132 | 169 |
| 48 | 3300017792 | Ga0163161_10236914 | Ga0163161_102369143 | 169 |
| 49 | 3300025907 | Ga0207645_10155892 | Ga0207645_101558922 | 169 |
| 50 | 3300025927 | Ga0207687_10040761 | Ga0207687_100407612 | 169 |
| 51 | 3300025933 | Ga0207706_10000332 | Ga0207706_1000033240 | 169 |
| 52 | 3300025961 | Ga0207712_10040541 | Ga0207712_100405412 | 169 |
| 53 | 3300025972 | Ga0207668_10088850 | Ga0207668_100888502 | 169 |
| 54 | 3300026075 | Ga0207708_10017349 | Ga0207708_100173494 | 169 |
| 55 | 3300026118 | Ga0207675_100043708 | Ga0207675_1000437083 | 169 |
| 56 | 3300027907 | Ga0207428_10229622 | Ga0207428_102296223 | 169 |
| 57 | 3300037466 | Ga0395898_0284677 | Ga0395898_0284677_980_1558 | 169 |
| 58 | 3300038443 | Ga0395901_0278165 | Ga0395901_0278165_556_1176 | 169 |
| 59 | 3300046500 | Ga0495596_0079616 | Ga0495596_0079616_98_682 | 169 |
| 60 | 3300049572 | Ga0501036_0339791 | Ga0501036_0339791_278_859 | 169 |
| 61 | 3300049578 | Ga0501042_0201974 | Ga0501042_0201974_284_868 | 169 |
| 62 | 3300049587 | Ga0501071_0519784 | Ga0501071_0519784_315_896 | 169 |
| 63 | 3300049591 | Ga0501075_0154101 | Ga0501075_0154101_1107_1688 | 169 |
| 64 | 3300049593 | Ga0501077_0264507 | Ga0501077_0264507_240_821 | 169 |
| 65 | 3300050507 | nmdc:mga05p37_273988_c1 | nmdc:mga05p37_273988_c1_1233_1817 | 169 |
| 66 | 3300050508 | nmdc:mga09592_180906_c1 | nmdc:mga09592_180906_c1_71_661 | 169 |
| 67 | 3300050509 | nmdc:mga0qj67_1366_c1 | nmdc:mga0qj67_1366_c1_9945_10535 | 169 |
| 68 | 3300050510 | nmdc:mga06r32_22509_c1 | nmdc:mga06r32_22509_c1_561_1151 | 169 |
| 69 | 3300053083 | Ga0495655_0192044 | Ga0495655_0192044_100_636 | 169 |
| 70 | 3300060353 | Ga0501082_0202776 | Ga0501082_0202776_236_817 | 169 |
| 71 | 3300061734 | Ga0530510_0115705 | Ga0530510_0115705_1358_1939 | 169 |
| 72 | 3300005981 | Ga0081538_10014118 | Ga0081538_100141186 | 170 |
| 73 | 3300005981 | Ga0081538_10047036 | Ga0081538_100470365 | 170 |
| 74 | 3300005983 | Ga0081540_1050188 | Ga0081540_10501882 | 170 |
| 75 | 3300011119 | Ga0105246_10779104 | Ga0105246_107791042 | 170 |
| 76 | 3300037466 | Ga0395898_0451592 | Ga0395898_0451592_501_1082 | 170 |
| 77 | 3300042008 | Ga0439450_059328 | Ga0439450_059328_86_718 | 170 |
| 78 | 3300042461 | Ga0439460_0017136 | Ga0439460_0017136_174_806 | 170 |
| 79 | 3300005985 | Ga0081539_10150884 | Ga0081539_101508842 | 171 |
| 80 | 3300044694 | Ga0466963_0414751 | Ga0466963_0414751_227_871 | 171 |
| 81 | 3300006847 | Ga0075431_100245077 | Ga0075431_1002450774 | 172 |
| 82 | 3300050510 | nmdc:mga06r32_76259_c1 | nmdc:mga06r32_76259_c1_2407_2991 | 172 |
| 83 | 3300028800 | Ga0265338_10096696 | Ga0265338_100966961 | 174 |
| 84 | 3300053078 | Ga0495612_0295170 | Ga0495612_0295170_49_696 | 175 |
| 85 | 3300006844 | Ga0075428_100057399 | Ga0075428_1000573993 | 176 |
| 86 | 3300006846 | Ga0075430_100112317 | Ga0075430_1001123174 | 176 |
| 87 | 3300006880 | Ga0075429_100109702 | Ga0075429_1001097023 | 176 |
| 88 | 3300009147 | Ga0114129_10000609 | Ga0114129_1000060919 | 176 |
| 89 | 3300050507 | nmdc:mga05p37_39619_c1 | nmdc:mga05p37_39619_c1_3186_3770 | 176 |
| 90 | 3300050508 | nmdc:mga09592_13018_c1 | nmdc:mga09592_13018_c1_1072_1656 | 176 |
| 91 | 3300050509 | nmdc:mga0qj67_28439_c1 | nmdc:mga0qj67_28439_c1_2036_2620 | 176 |
| 92 | 3300028556 | Ga0265337_1002321 | Ga0265337_10023213 | 177 |
| 93 | 3300028563 | Ga0265319_1000125 | Ga0265319_100012532 | 177 |
| 94 | 3300028577 | Ga0265318_10000427 | Ga0265318_1000042735 | 177 |
| 95 | 3300028654 | Ga0265322_10005375 | Ga0265322_100053752 | 177 |
| 96 | 3300028666 | Ga0265336_10000017 | Ga0265336_1000001780 | 177 |
| 97 | 3300028800 | Ga0265338_10000044 | Ga0265338_1000004480 | 177 |
| 98 | 3300029957 | Ga0265324_10005753 | Ga0265324_100057533 | 177 |
| 99 | 3300031247 | Ga0265340_10000003 | Ga0265340_10000003196 | 177 |
| 100 | 3300031249 | Ga0265339_10074717 | Ga0265339_100747172 | 177 |
| 101 | 3300031344 | Ga0265316_10025738 | Ga0265316_100257383 | 177 |
| 102 | 3300031712 | Ga0265342_10028352 | Ga0265342_100283524 | 177 |
| 103 | 3300049585 | Ga0501069_0027740 | Ga0501069_0027740_723_1355 | 178 |
| 104 | 3300049568 | Ga0501031_0053775 | Ga0501031_0053775_842_1447 | 179 |
| 105 | 3300049574 | Ga0501038_0142787 | Ga0501038_0142787_404_1009 | 179 |
| 106 | 3300049575 | Ga0501039_0041206 | Ga0501039_0041206_1784_2389 | 179 |
| 107 | 3300049576 | Ga0501040_0017225 | Ga0501040_0017225_132_737 | 179 |
| 108 | 3300049577 | Ga0501041_0012576 | Ga0501041_0012576_1085_1690 | 179 |
| 109 | 3300049580 | Ga0501046_0165847 | Ga0501046_0165847_430_1035 | 179 |
| 110 | 3300049582 | Ga0501048_0083453 | Ga0501048_0083453_923_1528 | 179 |
| 111 | 3300049587 | Ga0501071_0065245 | Ga0501071_0065245_12_617 | 179 |
| 112 | 3300049591 | Ga0501075_0066767 | Ga0501075_0066767_160_765 | 179 |
| 113 | 3300049593 | Ga0501077_0126478 | Ga0501077_0126478_564_1169 | 179 |
| 114 | 3300050507 | nmdc:mga05p37_651349_c1 | nmdc:mga05p37_651349_c1_46_693 | 179 |
| 115 | 3300050510 | nmdc:mga06r32_1111995_c1 | nmdc:mga06r32_1111995_c1_30_671 | 179 |
| 116 | 3300054114 | Ga0501084_0048302 | Ga0501084_0048302_2426_3031 | 179 |
| 117 | 3300060353 | Ga0501082_0068626 | Ga0501082_0068626_1647_2252 | 179 |
| 118 | 3300061734 | Ga0530510_0011060 | Ga0530510_0011060_464_1069 | 179 |
| 119 | 3300006846 | Ga0075430_100234651 | Ga0075430_1002346513 | 181 |
| 120 | 3300009094 | Ga0111539_10015829 | Ga0111539_1001582910 | 181 |
| 121 | 3300009147 | Ga0114129_10743052 | Ga0114129_107430522 | 181 |
| 122 | 3300009174 | Ga0105241_10582804 | Ga0105241_105828041 | 181 |
| 123 | 3300025916 | Ga0207663_10785515 | Ga0207663_107855151 | 181 |
| 124 | 3300027907 | Ga0207428_10029865 | Ga0207428_100298653 | 181 |
| 125 | 3300032002 | Ga0307416_100031816 | Ga0307416_1000318164 | 181 |
| 126 | 3300032126 | Ga0307415_100199134 | Ga0307415_1001991343 | 181 |
| 127 | 3300034820 | Ga0373959_0025274 | Ga0373959_0025274_112_693 | 181 |
| 128 | 3300035092 | Ga0373952_0092174 | Ga0373952_0092174_100_681 | 181 |
| 129 | 3300035121 | Ga0373960_0035862 | Ga0373960_0035862_655_1236 | 181 |
| 130 | 3300035242 | Ga0373962_0022886 | Ga0373962_0022886_402_983 | 181 |
| 131 | 3300035691 | Ga0373931_0038680 | Ga0373931_0038680_239_820 | 181 |
| 132 | 3300046500 | Ga0495596_0092364 | Ga0495596_0092364_215_796 | 181 |
| 133 | 3300050507 | nmdc:mga05p37_1000684_c1 | nmdc:mga05p37_1000684_c1_30_611 | 181 |
| 134 | 3300050511 | nmdc:mga08y16_18099_c1 | nmdc:mga08y16_18099_c1_5082_5663 | 181 |
| 135 | 3300050512 | nmdc:mga0n895_312152_c1 | nmdc:mga0n895_312152_c1_191_772 | 181 |
| 136 | 3300031852 | Ga0307410_10309691 | Ga0307410_103096911 | 182 |
| 137 | 3300031901 | Ga0307406_10020823 | Ga0307406_100208233 | 182 |
| 138 | 3300005981 | Ga0081538_10015044 | Ga0081538_100150445 | 183 |
| 139 | 3300013307 | Ga0157372_10884166 | Ga0157372_108841662 | 183 |
| 140 | 3300048907 | Ga0496104_0000030 | Ga0496104_0000030_122386_122976 | 183 |
| 141 | 3300048908 | Ga0496105_0148347 | Ga0496105_0148347_994_1584 | 183 |
| 142 | 3300048913 | Ga0496110_0000230 | Ga0496110_0000230_20811_21401 | 183 |
| 143 | 3300048914 | Ga0496111_0000016 | Ga0496111_0000016_60773_61363 | 183 |
| 144 | 3300005981 | Ga0081538_10000213 | Ga0081538_1000021331 | 184 |
| 145 | 3300032002 | Ga0307416_100215636 | Ga0307416_1002156362 | 184 |
| 146 | 3300032005 | Ga0307411_10770072 | Ga0307411_107700721 | 184 |
| 147 | 3300037418 | Ga0395900_0147772 | Ga0395900_0147772_1776_2354 | 184 |
| 148 | 3300037466 | Ga0395898_0398840 | Ga0395898_0398840_366_944 | 184 |
| 149 | 3300005981 | Ga0081538_10042152 | Ga0081538_100421523 | 187 |
| 150 | 3300048915 | Ga0496112_0646249 | Ga0496112_0646249_20_589 | 187 |
| 151 | 3300003373 | JGI25407J50210_10003977 | JGI25407J50210_100039773 | 189 |
| 152 | 3300005339 | Ga0070660_100009576 | Ga0070660_1000095763 | 189 |
| 153 | 3300005434 | Ga0070709_10127393 | Ga0070709_101273932 | 189 |
| 154 | 3300005434 | Ga0070709_10559588 | Ga0070709_105595881 | 189 |
| 155 | 3300005439 | Ga0070711_100013122 | Ga0070711_1000131227 | 189 |
| 156 | 3300005444 | Ga0070694_100396028 | Ga0070694_1003960282 | 189 |
| 157 | 3300005981 | Ga0081538_10000152 | Ga0081538_1000015249 | 189 |
| 158 | 3300005981 | Ga0081538_10019427 | Ga0081538_100194274 | 189 |
| 159 | 3300006048 | Ga0075363_100038606 | Ga0075363_1000386062 | 189 |
| 160 | 3300006175 | Ga0070712_100007319 | Ga0070712_1000073194 | 189 |
| 161 | 3300006175 | Ga0070712_100249750 | Ga0070712_1002497502 | 189 |
| 162 | 3300009098 | Ga0105245_11205202 | Ga0105245_112052021 | 189 |
| 163 | 3300020070 | Ga0206356_11679709 | Ga0206356_116797093 | 189 |
| 164 | 3300025898 | Ga0207692_10204220 | Ga0207692_102042202 | 189 |
| 165 | 3300025915 | Ga0207693_10013407 | Ga0207693_100134075 | 189 |
| 166 | 3300025919 | Ga0207657_10038489 | Ga0207657_100384893 | 189 |
| 167 | 3300025939 | Ga0207665_10054822 | Ga0207665_100548222 | 189 |
| 168 | 3300028563 | Ga0265319_1000015 | Ga0265319_100001514 | 189 |
| 169 | 3300031240 | Ga0265320_10005688 | Ga0265320_100056888 | 189 |
| 170 | 3300031251 | Ga0265327_10033767 | Ga0265327_100337674 | 189 |
| 171 | 3300035170 | Ga0373943_0203778 | Ga0373943_0203778_200_859 | 189 |
| 172 | 3300037068 | Ga0373925_0060135 | Ga0373925_0060135_1985_2644 | 189 |
| 173 | 3300037418 | Ga0395900_0331834 | Ga0395900_0331834_258_920 | 189 |
| 174 | 3300044684 | Ga0466966_0225458 | Ga0466966_0225458_77_718 | 189 |
| 175 | 3300044719 | Ga0466971_0097687 | Ga0466971_0097687_236_862 | 189 |
| 176 | 3300044735 | Ga0466968_0135825 | Ga0466968_0135825_37_684 | 189 |
| 177 | 3300044842 | Ga0466957_0685970 | Ga0466957_0685970_30_656 | 189 |
| 178 | 3300045976 | Ga0466967_0517948 | Ga0466967_0517948_216_851 | 189 |
| 179 | 3300046463 | Ga0495653_0206135 | Ga0495653_0206135_204_818 | 189 |
| 180 | 3300046477 | Ga0495664_0000311 | Ga0495664_0000311_22663_23241 | 189 |
| 181 | 3300046683 | Ga0495658_0238113 | Ga0495658_0238113_382_1068 | 189 |
| 182 | 3300046809 | Ga0495600_0058672 | Ga0495600_0058672_762_1391 | 189 |
| 183 | 3300047320 | Ga0495672_0132457 | Ga0495672_0132457_35_655 | 189 |
| 184 | 3300048905 | Ga0496102_0000019 | Ga0496102_0000019_251336_251914 | 189 |
| 185 | 3300048906 | Ga0496103_0000059 | Ga0496103_0000059_12667_13245 | 189 |
| 186 | 3300048913 | Ga0496110_0672524 | Ga0496110_0672524_273_899 | 189 |
| 187 | 3300049569 | Ga0501032_0061357 | Ga0501032_0061357_684_1370 | 189 |
| 188 | 3300049571 | Ga0501034_0146931 | Ga0501034_0146931_1445_2131 | 189 |
| 189 | 3300049573 | Ga0501037_0040615 | Ga0501037_0040615_1309_1995 | 189 |
| 190 | 3300049574 | Ga0501038_0246824 | Ga0501038_0246824_43_729 | 189 |
| 191 | 3300049575 | Ga0501039_0021887 | Ga0501039_0021887_2386_3072 | 189 |
| 192 | 3300049578 | Ga0501042_0148465 | Ga0501042_0148465_631_1305 | 189 |
| 193 | 3300049579 | Ga0501043_0005514 | Ga0501043_0005514_621_1307 | 189 |
| 194 | 3300049580 | Ga0501046_0017114 | Ga0501046_0017114_2197_2883 | 189 |
| 195 | 3300049581 | Ga0501047_0145150 | Ga0501047_0145150_48_734 | 189 |
| 196 | 3300049583 | Ga0501067_0049841 | Ga0501067_0049841_984_1670 | 189 |
| 197 | 3300049585 | Ga0501069_0028320 | Ga0501069_0028320_885_1559 | 189 |
| 198 | 3300049587 | Ga0501071_0216318 | Ga0501071_0216318_832_1425 | 189 |
| 199 | 3300049589 | Ga0501073_0011917 | Ga0501073_0011917_552_1238 | 189 |
| 200 | 3300049741 | Ga0501079_0869034 | Ga0501079_0869034_41_634 | 189 |
| 201 | 3300049742 | Ga0501080_0079746 | Ga0501080_0079746_2026_2712 | 189 |
| 202 | 3300049744 | Ga0501083_0053236 | Ga0501083_0053236_1050_1736 | 189 |
| 203 | 3300049822 | Ga0501035_0062213 | Ga0501035_0062213_1091_1777 | 189 |
| 204 | 3300050507 | nmdc:mga05p37_940800_c1 | nmdc:mga05p37_940800_c1_234_815 | 189 |
| 205 | 3300053153 | Ga0500616_0007064 | Ga0500616_0007064_5533_6162 | 189 |
| 206 | 3300060353 | Ga0501082_0020984 | Ga0501082_0020984_2463_3149 | 189 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4zr0-assembly1.cif.gz_A | full length scs7p (only hydroxylase domain visible) | 0.824 | 9 | 185 |
| 4zr0-assembly1.cif.gz_A | full length scs7p (only hydroxylase domain visible) | 0.7727 | 9 | 185 |
| 7x7y-assembly1.cif.gz_a | cryo-em structure of human tric-atp-open state | 0.3744 | 99 | 161 |
| 7x3u-assembly1.cif.gz_A | cryo-em structure of human tric-adp | 0.3646 | 105 | 169 |
| 7x0a-assembly1.cif.gz_A | cryo-em structure of human tric-npp state | 0.3646 | 105 | 169 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q5A896_302_490_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4271 | 6 | 155 | 1.20.1250.20 |
| af_Q96QE2_73_430_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4156 | 6 | 162 | 1.20.1250.20 |
| af_Q4DA30_210_605_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4047 | 5 | 183 | 1.20.1250.20 |
| af_Q4DWN2_303_707_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.391 | 2 | 162 | 1.20.1250.20 |
| af_P9WLI3_230_442_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3849 | 4 | 183 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4V4H2M0-F1-model_v4 | Fatty acid hydroxylase domain-containing protein | 0.864 | 2 | 155 |
GO:0005789
GO:0006631 GO:0080132 |
| AF-A0A022Y6U8-F1-model_v4 | Ceramide very long chain fatty acid hydroxylase (EC 1.-.-.-) | 0.8614 | 9 | 148 |
GO:0005506
GO:0005789 GO:0006633 GO:0020037 GO:0080132 |
| AF-M1ACD2-F1-model_v4 | Sphingolipid fatty acid alpha hydroxylase | 0.8583 | 6 | 162 |
GO:0005783
GO:0005789 GO:0006631 GO:0080132 |
| AF-A0A7Y5LAD7-F1-model_v4 | Fatty acid hydroxylase | 0.8504 | 2 | 156 |
GO:0006631
GO:0016020 GO:0080132 |
| AF-A0A3D1DB57-F1-model_v4 | deleted | 0.8502 | 2 | 148 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar