F314386

General Info

Members Datasets Scaffolds Average Seq Length
205 153 410 188

Family's Representative Sequence

Representative Sequence 3300049576|Ga0501040_0264339|Ga0501040_0264339_402_947
Length 181
Sequence MGVSLDGYIVGPDGTFDWTGPDEEVFRFWIDEIRGVGVHLMGRRLYETMLYWETADEDRTLDEAELEWAGLWKPLPKVVFSRTLSTVEGNARLASDGLAEEIERLRAEPGEEGEIAIGGATLAAEAAALDLIDEYRVMVYPVLVGGGIPFFPHLQRRVDLELVETRTFGSRVVYLHYRVAR

Samples

Sample ID Description Type Environment
1 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
45 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
58 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
59 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
60 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
61 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
62 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
63 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
64 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
65 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
66 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
67 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
68 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
69 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
70 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
71 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
72 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
73 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
74 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
75 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
76 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
77 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
78 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
79 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
80 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
81 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
82 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
83 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
84 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
89 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
90 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
91 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
92 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
93 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
94 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
95 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
96 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
97 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
98 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
99 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
100 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
101 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
102 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
103 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
104 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
105 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
106 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
107 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
108 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
109 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
110 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
111 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
112 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
113 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
114 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
115 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
116 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
117 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
118 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
119 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
120 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
121 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
122 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
136 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
137 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
138 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
139 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
140 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
141 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
142 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
143 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
145 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
146 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
147 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
148 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
149 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
150 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
151 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
152 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
153 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0
Isolates 0.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.88
Rhizosphere 93.17
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501040_0264339 3300049576 Bacteria 1228
2 Ga0070683_100019979 3300005329 Bacteria 5954
3 Ga0070660_100572681 3300005339 Bacteria 943
4 Ga0070691_10379409 3300005341 Bacteria 792
5 Ga0070675_100229661 3300005354 Bacteria 1618
6 Ga0070659_100534579 3300005366 Bacteria 1002
7 Ga0070703_10000444 3300005406 Bacteria 16742
8 Ga0070714_100027564 3300005435 Bacteria 4706
9 Ga0070694_100520833 3300005444 Bacteria 949
10 Ga0070708_100008218 3300005445 Bacteria 8375
11 Ga0070708_100022275 3300005445 Bacteria 5370
12 Ga0070708_100083031 3300005445 Bacteria 2903
13 Ga0070708_100428425 3300005445 Bacteria 1248
14 Ga0070708_100761314 3300005445 Bacteria 911
15 Ga0070663_100748650 3300005455 Bacteria 834
16 Ga0070685_10376459 3300005466 Bacteria 977
17 Ga0070706_100001685 3300005467 Bacteria 23030
18 Ga0070706_100177895 3300005467 Bacteria 1986
19 Ga0070706_100278931 3300005467 Bacteria 1560
20 Ga0070707_100214572 3300005468 Bacteria 1875
21 Ga0070698_100238035 3300005471 Bacteria 1754
22 Ga0070698_100617622 3300005471 Bacteria 1025
23 Ga0070684_100352702 3300005535 Bacteria 1353
24 Ga0070684_100636369 3300005535 Bacteria 992
25 Ga0070697_100002871 3300005536 Bacteria 13247
26 Ga0070704_100075419 3300005549 Bacteria 2463
27 Ga0068857_100148719 3300005577 Bacteria 2121
28 Ga0068856_100772084 3300005614 Bacteria 981
29 Ga0068852_100080721 3300005616 Bacteria 2885
30 Ga0068864_100595912 3300005618 Bacteria 1072
31 Ga0081455_10010197 3300005937 Bacteria 9563
32 Ga0081538_10000133 3300005981 Bacteria 77001
33 Ga0081538_10020826 3300005981 Bacteria 4813
34 Ga0081539_10012876 3300005985 Bacteria 6374
35 Ga0070717_10075935 3300006028 Bacteria 2811
36 Ga0070717_10283956 3300006028 Bacteria 1469
37 Ga0070715_10296117 3300006163 Bacteria 864
38 Ga0075428_100653236 3300006844 Bacteria 1121
39 Ga0075430_100056618 3300006846 Bacteria 3297
40 Ga0075433_10648713 3300006852 Bacteria 926
41 Ga0075434_100283983 3300006871 Bacteria 1675
42 Ga0075434_100352513 3300006871 Bacteria 1493
43 Ga0075436_100030124 3300006914 Bacteria 3734
44 Ga0075435_100471439 3300007076 Bacteria 1084
45 Ga0099794_10222802 3300007265 Bacteria 969
46 Ga0111539_10104641 3300009094 Bacteria 3321
47 Ga0111539_10392992 3300009094 Bacteria 1615
48 Ga0114129_10706342 3300009147 Bacteria 1295
49 Ga0114129_11047296 3300009147 Bacteria 1024
50 Ga0105249_10475871 3300009553 Bacteria 1291
51 Ga0157370_10035584 3300013104 Bacteria 4838
52 Ga0157369_10007005 3300013105 Bacteria 13009
53 Ga0157369_10225612 3300013105 Bacteria 1960
54 Ga0157378_11266392 3300013297 Bacteria 778
55 Ga0163162_10121889 3300013306 Bacteria 2712
56 Ga0163162_11617649 3300013306 Bacteria 739
57 Ga0157372_10121903 3300013307 Bacteria 2996
58 Ga0157379_10004652 3300014968 Bacteria 11771
59 Ga0157379_10105133 3300014968 Bacteria 2534
60 Ga0213874_10080330 3300021377 Bacteria 1055
61 Ga0207653_10000452 3300025885 Bacteria 16728
62 Ga0207684_10000087 3300025910 Bacteria 173557
63 Ga0207684_10001043 3300025910 Bacteria 30980
64 Ga0207684_10016586 3300025910 Bacteria 6324
65 Ga0207695_10029327 3300025913 Bacteria 6082
66 Ga0207646_10027220 3300025922 Bacteria 5214
67 Ga0207664_10005809 3300025929 Bacteria 8438
68 Ga0207690_10653184 3300025932 Bacteria 862
69 Ga0207661_10064433 3300025944 Bacteria 2971
70 Ga0207640_10151040 3300025981 Bacteria 1706
71 Ga0207702_10364928 3300026078 Bacteria 1385
72 Ga0207676_11219279 3300026095 Bacteria 746
73 Ga0207674_10045662 3300026116 Bacteria 4504
74 Ga0207674_10077500 3300026116 Bacteria 3329
75 Ga0207698_10167314 3300026142 Bacteria 1931
76 Ga0265319_1010227 3300028563 Bacteria 3928
77 Ga0265318_10057135 3300028577 Bacteria 1458
78 Ga0265322_10054443 3300028654 Bacteria 1135
79 Ga0265336_10033384 3300028666 Bacteria 1594
80 Ga0265338_10025856 3300028800 Bacteria 5939
81 Ga0265324_10004077 3300029957 Bacteria 6713
82 Ga0265332_10048555 3300031238 Bacteria 1826
83 Ga0265328_10242158 3300031239 Bacteria 689
84 Ga0265320_10011265 3300031240 Bacteria 5271
85 Ga0265325_10018706 3300031241 Bacteria 3841
86 Ga0265329_10012919 3300031242 Bacteria 2990
87 Ga0265340_10088713 3300031247 Bacteria 1448
88 Ga0265339_10109140 3300031249 Bacteria 1433
89 Ga0265331_10015237 3300031250 Bacteria 4067
90 Ga0265316_10185507 3300031344 Bacteria 1547
91 Ga0307513_10398568 3300031456 Bacteria 1111
92 Ga0265313_10034760 3300031595 Bacteria 2545
93 Ga0265314_10002825 3300031711 Bacteria 17321
94 Ga0265342_10098091 3300031712 Bacteria 1673
95 Ga0316576_10045098 3300031727 Bacteria 3187
96 Ga0316578_10093269 3300031728 Bacteria 1800
97 Ga0307413_10882297 3300031824 Bacteria 758
98 Ga0307409_100021859 3300031995 Bacteria 4397
99 Ga0307409_100149926 3300031995 Bacteria 2023
100 Ga0307409_100337725 3300031995 Bacteria 1416
101 Ga0307416_100303375 3300032002 Bacteria 1588
102 Ga0307416_101649149 3300032002 Bacteria 746
103 Ga0307416_102158693 3300032002 Bacteria 658
104 Ga0307415_100002612 3300032126 Bacteria 8986
105 Ga0307415_100027917 3300032126 Bacteria 3583
106 Ga0373939_0049199 3300035114 Bacteria 1302
107 Ga0373939_0162470 3300035114 Bacteria 821
108 Ga0316582_0072109 3300036647 Bacteria 2239
109 Ga0395899_0130603 3300037312 Bacteria 1794
110 Ga0395900_0032033 3300037418 Bacteria 5405
111 Ga0395900_0069074 3300037418 Bacteria 3631
112 Ga0395900_0173769 3300037418 Bacteria 2192
113 Ga0395900_0185737 3300037418 Bacteria 2110
114 Ga0395900_0258613 3300037418 Bacteria 1740
115 Ga0395900_0585003 3300037418 Bacteria 1058
116 Ga0395905_0213547 3300037471 Bacteria 1807
117 Ga0395901_0170232 3300038443 Bacteria 2285
118 Ga0395901_1055539 3300038443 Bacteria 785
119 Ga0436363_0321387 3300039450 Bacteria 7455
120 Ga0451802_2148660 3300041460 Bacteria 1792
121 Ga0439455_0138551 3300042012 Bacteria 689
122 Ga0466969_0087714 3300044656 Bacteria 1477
123 Ga0466965_0000151 3300044683 Bacteria 20572
124 Ga0466966_0000700 3300044684 Bacteria 21325
125 Ga0466961_0000641 3300044693 Bacteria 21975
126 Ga0466961_0226855 3300044693 Bacteria 1150
127 Ga0466963_0000385 3300044694 Bacteria 20153
128 Ga0466964_0000412 3300044706 Bacteria 12939
129 Ga0466971_0000447 3300044719 Bacteria 16147
130 Ga0466970_0000892 3300044765 Bacteria 14403
131 Ga0466957_0000167 3300044842 Bacteria 29271
132 Ga0466959_0001184 3300045049 Bacteria 15728
133 Ga0466959_0086191 3300045049 Bacteria 2260
134 Ga0466958_0003957 3300045836 Bacteria 7768
135 Ga0466967_0197247 3300045976 Bacteria 1905
136 Ga0495603_0012344 3300046455 Bacteria 5171
137 Ga0495603_0267127 3300046455 Bacteria 984
138 Ga0495651_0309292 3300046462 Bacteria 1057
139 Ga0495594_0022117 3300046499 Bacteria 3400
140 Ga0495596_0171697 3300046500 Bacteria 843
141 Ga0495632_0329304 3300046519 Bacteria 674
142 Ga0495637_0245205 3300046520 Bacteria 646
143 Ga0495663_0029204 3300046525 Bacteria 1627
144 Ga0495656_0069824 3300046615 Bacteria 1557
145 Ga0495659_0264724 3300046664 Bacteria 719
146 Ga0495671_0161718 3300046692 Bacteria 1089
147 Ga0496101_0466281 3300048904 Bacteria 997
148 Ga0496102_0104638 3300048905 Bacteria 2633
149 Ga0496104_0029098 3300048907 Bacteria 5123
150 Ga0496105_0222434 3300048908 Bacteria 1536
151 Ga0496107_0438797 3300048910 Bacteria 970
152 Ga0496108_0002319 3300048911 Bacteria 15233
153 Ga0496109_0038185 3300048912 Bacteria 4341
154 Ga0496111_0062653 3300048914 Bacteria 2697
155 Ga0496113_0357411 3300048916 Bacteria 1172
156 Ga0501031_0042048 3300049568 Bacteria 2984
157 Ga0501032_0016160 3300049569 Bacteria 5253
158 Ga0501032_0181989 3300049569 Bacteria 1376
159 Ga0501033_0518936 3300049570 Bacteria 823
160 Ga0501034_0062357 3300049571 Bacteria 3743
161 Ga0501036_0021794 3300049572 Bacteria 5386
162 Ga0501036_0024697 3300049572 Bacteria 5067
163 Ga0501036_0588158 3300049572 Bacteria 924
164 Ga0501037_0004791 3300049573 Bacteria 9837
165 Ga0501037_0122362 3300049573 Bacteria 1870
166 Ga0501038_0027982 3300049574 Bacteria 5008
167 Ga0501038_0083324 3300049574 Bacteria 2692
168 Ga0501039_0283850 3300049575 Bacteria 1301
169 Ga0501039_0675237 3300049575 Bacteria 808
170 Ga0501040_0104779 3300049576 Bacteria 1975
171 Ga0501040_0491208 3300049576 Bacteria 885
172 Ga0501042_0006711 3300049578 Bacteria 7502
173 Ga0501043_0003973 3300049579 Bacteria 12112
174 Ga0501043_0069950 3300049579 Bacteria 2757
175 Ga0501046_0020773 3300049580 Bacteria 5425
176 Ga0501046_0038542 3300049580 Bacteria 3834
177 Ga0501047_0028262 3300049581 Bacteria 5406
178 Ga0501047_0332607 3300049581 Bacteria 1357
179 Ga0501047_0375918 3300049581 Bacteria 1255
180 Ga0501048_0011815 3300049582 Bacteria 6510
181 Ga0501048_0215306 3300049582 Bacteria 1362
182 Ga0501068_0289849 3300049584 Bacteria 1047
183 Ga0501071_0188203 3300049587 Bacteria 1547
184 Ga0501071_0590874 3300049587 Bacteria 853
185 Ga0501074_0137810 3300049590 Bacteria 1746
186 Ga0501075_0167587 3300049591 Bacteria 1676
187 Ga0501076_0241998 3300049592 Bacteria 1476
188 Ga0501077_0441251 3300049593 Bacteria 833
189 Ga0501077_0568114 3300049593 Bacteria 728
190 Ga0501080_0025387 3300049742 Bacteria 5499
191 Ga0501080_0165546 3300049742 Bacteria 2040
192 Ga0501081_0294273 3300049743 Bacteria 1190
193 Ga0501081_0560900 3300049743 Bacteria 853
194 Ga0501035_0062863 3300049822 Bacteria 3302
195 Ga0501035_0100114 3300049822 Bacteria 2544
196 Ga0501044_0074721 3300049823 Bacteria 3442
197 nmdc:mga08x19_35903_c1 3300050514 Bacteria 3137
198 Ga0501084_0420716 3300054114 Bacteria 1129
199 Ga0590071_005839 3300059421 Bacteria 2950
200 Ga0590075_003418 3300059424 Bacteria 3776
201 Ga0590077_035616 3300059426 Bacteria 1096
202 Ga0501082_0341770 3300060353 Bacteria 1304
203 Ga0466962_0001549 3300061719 Bacteria 10736
204 Ga0530510_0038859 3300061734 Bacteria 3437
205 2867347035 2867346516 Bacteria 7608576
206 Ga0501040_0264339
207 Ga0070683_100019979
208 Ga0070660_100572681
209 Ga0070691_10379409
210 Ga0070675_100229661
211 Ga0070659_100534579
212 Ga0070703_10000444
213 Ga0070714_100027564
214 Ga0070694_100520833
215 Ga0070708_100008218
216 Ga0070708_100022275
217 Ga0070708_100083031
218 Ga0070708_100428425
219 Ga0070708_100761314
220 Ga0070663_100748650
221 Ga0070685_10376459
222 Ga0070706_100001685
223 Ga0070706_100177895
224 Ga0070706_100278931
225 Ga0070707_100214572
226 Ga0070698_100238035
227 Ga0070698_100617622
228 Ga0070684_100352702
229 Ga0070684_100636369
230 Ga0070697_100002871
231 Ga0070704_100075419
232 Ga0068857_100148719
233 Ga0068856_100772084
234 Ga0068852_100080721
235 Ga0068864_100595912
236 Ga0081455_10010197
237 Ga0081538_10000133
238 Ga0081538_10020826
239 Ga0081539_10012876
240 Ga0070717_10075935
241 Ga0070717_10283956
242 Ga0070715_10296117
243 Ga0075428_100653236
244 Ga0075430_100056618
245 Ga0075433_10648713
246 Ga0075434_100283983
247 Ga0075434_100352513
248 Ga0075436_100030124
249 Ga0075435_100471439
250 Ga0099794_10222802
251 Ga0111539_10104641
252 Ga0111539_10392992
253 Ga0114129_10706342
254 Ga0114129_11047296
255 Ga0105249_10475871
256 Ga0157370_10035584
257 Ga0157369_10007005
258 Ga0157369_10225612
259 Ga0157378_11266392
260 Ga0163162_10121889
261 Ga0163162_11617649
262 Ga0157372_10121903
263 Ga0157379_10004652
264 Ga0157379_10105133
265 Ga0213874_10080330
266 Ga0207653_10000452
267 Ga0207684_10000087
268 Ga0207684_10001043
269 Ga0207684_10016586
270 Ga0207695_10029327
271 Ga0207646_10027220
272 Ga0207664_10005809
273 Ga0207690_10653184
274 Ga0207661_10064433
275 Ga0207640_10151040
276 Ga0207702_10364928
277 Ga0207676_11219279
278 Ga0207674_10045662
279 Ga0207674_10077500
280 Ga0207698_10167314
281 Ga0265319_1010227
282 Ga0265318_10057135
283 Ga0265322_10054443
284 Ga0265336_10033384
285 Ga0265338_10025856
286 Ga0265324_10004077
287 Ga0265332_10048555
288 Ga0265328_10242158
289 Ga0265320_10011265
290 Ga0265325_10018706
291 Ga0265329_10012919
292 Ga0265340_10088713
293 Ga0265339_10109140
294 Ga0265331_10015237
295 Ga0265316_10185507
296 Ga0307513_10398568
297 Ga0265313_10034760
298 Ga0265314_10002825
299 Ga0265342_10098091
300 Ga0316576_10045098
301 Ga0316578_10093269
302 Ga0307413_10882297
303 Ga0307409_100021859
304 Ga0307409_100149926
305 Ga0307409_100337725
306 Ga0307416_100303375
307 Ga0307416_101649149
308 Ga0307416_102158693
309 Ga0307415_100002612
310 Ga0307415_100027917
311 Ga0373939_0049199
312 Ga0373939_0162470
313 Ga0316582_0072109
314 Ga0395899_0130603
315 Ga0395900_0032033
316 Ga0395900_0069074
317 Ga0395900_0173769
318 Ga0395900_0185737
319 Ga0395900_0258613
320 Ga0395900_0585003
321 Ga0395905_0213547
322 Ga0395901_0170232
323 Ga0395901_1055539
324 Ga0436363_0321387
325 Ga0451802_2148660
326 Ga0439455_0138551
327 Ga0466969_0087714
328 Ga0466965_0000151
329 Ga0466966_0000700
330 Ga0466961_0000641
331 Ga0466961_0226855
332 Ga0466963_0000385
333 Ga0466964_0000412
334 Ga0466971_0000447
335 Ga0466970_0000892
336 Ga0466957_0000167
337 Ga0466959_0001184
338 Ga0466959_0086191
339 Ga0466958_0003957
340 Ga0466967_0197247
341 Ga0495603_0012344
342 Ga0495603_0267127
343 Ga0495651_0309292
344 Ga0495594_0022117
345 Ga0495596_0171697
346 Ga0495632_0329304
347 Ga0495637_0245205
348 Ga0495663_0029204
349 Ga0495656_0069824
350 Ga0495659_0264724
351 Ga0495671_0161718
352 Ga0496101_0466281
353 Ga0496102_0104638
354 Ga0496104_0029098
355 Ga0496105_0222434
356 Ga0496107_0438797
357 Ga0496108_0002319
358 Ga0496109_0038185
359 Ga0496111_0062653
360 Ga0496113_0357411
361 Ga0501031_0042048
362 Ga0501032_0016160
363 Ga0501032_0181989
364 Ga0501033_0518936
365 Ga0501034_0062357
366 Ga0501036_0021794
367 Ga0501036_0024697
368 Ga0501036_0588158
369 Ga0501037_0004791
370 Ga0501037_0122362
371 Ga0501038_0027982
372 Ga0501038_0083324
373 Ga0501039_0283850
374 Ga0501039_0675237
375 Ga0501040_0104779
376 Ga0501040_0491208
377 Ga0501042_0006711
378 Ga0501043_0003973
379 Ga0501043_0069950
380 Ga0501046_0020773
381 Ga0501046_0038542
382 Ga0501047_0028262
383 Ga0501047_0332607
384 Ga0501047_0375918
385 Ga0501048_0011815
386 Ga0501048_0215306
387 Ga0501068_0289849
388 Ga0501071_0188203
389 Ga0501071_0590874
390 Ga0501074_0137810
391 Ga0501075_0167587
392 Ga0501076_0241998
393 Ga0501077_0441251
394 Ga0501077_0568114
395 Ga0501080_0025387
396 Ga0501080_0165546
397 Ga0501081_0294273
398 Ga0501081_0560900
399 Ga0501035_0062863
400 Ga0501035_0100114
401 Ga0501044_0074721
402 nmdc:mga08x19_35903_c1
403 Ga0501084_0420716
404 Ga0590071_005839
405 Ga0590075_003418
406 Ga0590077_035616
407 Ga0501082_0341770
408 Ga0466962_0001549
409 Ga0530510_0038859
410 2867347035

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

1

174

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.774 2 186
2gd9-assembly1.cif.gz_B crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution 0.7711 2 186
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.7697 2 186
7rgj-assembly1.cif.gz_A dfra1 complexed with nadph and 5-(3-(7-(4-(aminomethyl)phenyl)benzo[d][1,3]dioxol-5-yl)but-1-yn-1-yl)-6-ethylpyrimidine-2,4-diamine (ucp1223) 0.7568 2 184
7reg-assembly1.cif.gz_A dfra1 complexed with nadph and 4'-chloro-3'-(4-(2,4-diamino-6-ethylpyrimidin-5-yl)but-3-yn-2-yl)-[1,1'-biphenyl]-4-carboxamide (ucp1228) 0.7519 2 185
ID Description Score Start End Superfamily
af_P24719_156_494_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.7922 166 185 1.10.510.10
3fgeA01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7809 166 187 2.30.110.10
3rhuB01 Alpha Beta;2-Layer Sandwich;Threonyl-tRNA Synthetase; Chain A, domain 2;Threonyl-trna Synthetase; Chain A, domain 2 0.7752 166 185 3.30.980.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7729 2 188 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7656 2 183 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A3N1HZN0-F1-model_v4 Dihydrofolate reductase 0.9283 1 187 GO:0008703
GO:0009231
AF-A0A526YXE0-F1-model_v4 Dihydrofolate reductase 0.9212 1 151 GO:0008703
GO:0009231
AF-A0A3N1HZN0-F1-model_v4 Dihydrofolate reductase 0.919 1 187 GO:0008703
GO:0009231
AF-A0A526YXE0-F1-model_v4 Dihydrofolate reductase 0.9152 1 151 GO:0008703
GO:0009231
AF-A0A529UW95-F1-model_v4 deleted 0.9112 1 148

Map