F314233

General Info

Members Datasets Scaffolds Average Seq Length
205 149 410 340

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0028540|Ga0466967_0028540_2766_3977
Length 384
Sequence MCALGALWQIHDGGRLSGARYRSVTARRSASEAVTKRQHSLATVRLQSSIPQEMLAMLRALASGAATFPYPIYAKWADAYRKETGIRMNYQSIGSGGGIKQITAKTVDFGASDMPLKPEELEKYGLMQFPTVIGGAVPCVKLQGIRPGQLKLDGRTLADIYLGKLKQWNDAAIAKLNPGLKLPATAISVVHRSDGSGTTFIWSNYLSKVSEEWQSKVGEGTAVNWPTGVGGKGNEGVASYVQRIEGAIGYVEYAYVLQNKMAYVQMKNRDGRYLSPSSQSFKAAAAGADWQKAPGMYLILTDAPGPGAWPIAGATFILMHTTQERPENAREVLKFFAWAYRKGDAMAEQLDYVPMPDKVVNLIQAGWKSQIRDSSGKPVYDGAY

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
41 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
56 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
57 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
59 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
90 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
91 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
92 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
93 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
94 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
95 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
99 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
102 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
103 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
104 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
105 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
106 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
107 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
115 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
116 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
117 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
118 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
119 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
120 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
121 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
122 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
123 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
124 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
125 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
126 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
127 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
128 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
129 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
130 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
134 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
135 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
136 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
137 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
138 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
141 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
142 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
143 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
144 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
145 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
146 2547132181 Kosakonia sacchari SP1 Isolate Stem
147 2643221573 Lysobacter sp. Root604 Isolate Unclassified
148 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
149 8055693939 Hafnia alvei A23BA Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.59
Metatranscriptomes 1.46
Isolates 1.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.95
Nodule 0
Rhizoplane 0.49
Rhizosphere 86.83
Stem 0.49
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0028540 3300045976 Bacteria 4659
2 JGI25152J39213_1000148 3300002773 Bacteria 48160
3 rootL2_10029734 3300003322 Bacteria 9836
4 Ga0058692_1014763 3300003856 Bacteria 1781
5 Ga0065712_10089994 3300005290 Bacteria 2437
6 Ga0065712_10148694 3300005290 Bacteria 1387
7 Ga0070658_10017333 3300005327 Bacteria 5763
8 Ga0070683_100302010 3300005329 Bacteria 1523
9 Ga0070670_100097293 3300005331 Bacteria 2532
10 Ga0070680_100047018 3300005336 Bacteria 3513
11 Ga0070689_100193989 3300005340 Bacteria 1655
12 Ga0070661_100000353 3300005344 Bacteria 36189
13 Ga0070669_100065867 3300005353 Bacteria 2669
14 Ga0070675_100186267 3300005354 Bacteria 1796
15 Ga0070674_100122130 3300005356 Bacteria 1930
16 Ga0070659_100016756 3300005366 Bacteria 5505
17 Ga0070709_10233488 3300005434 Bacteria 1317
18 Ga0070714_100062119 3300005435 Bacteria 3210
19 Ga0070714_100197419 3300005435 Bacteria 1839
20 Ga0070713_100053355 3300005436 Bacteria 3350
21 Ga0070710_10104147 3300005437 Bacteria 1695
22 Ga0070711_100079352 3300005439 Bacteria 2334
23 Ga0070705_100007569 3300005440 Bacteria 5350
24 Ga0070681_10052038 3300005458 Bacteria 4084
25 Ga0070681_10121060 3300005458 Bacteria 2552
26 Ga0070679_100127795 3300005530 Bacteria 2523
27 Ga0070684_100253823 3300005535 Bacteria 1607
28 Ga0070697_100001941 3300005536 Bacteria 15825
29 Ga0068853_100361212 3300005539 Bacteria 1353
30 Ga0070672_100275984 3300005543 Bacteria 1420
31 Ga0070696_100028244 3300005546 Bacteria 3827
32 Ga0070696_100057709 3300005546 Bacteria 2710
33 Ga0068855_100008681 3300005563 Bacteria 12282
34 Ga0068855_100029901 3300005563 Bacteria 6515
35 Ga0068855_100171138 3300005563 Bacteria 2460
36 Ga0068852_100014212 3300005616 Bacteria 6116
37 Ga0068859_100022520 3300005617 Bacteria 6318
38 Ga0068858_100011447 3300005842 Bacteria 8375
39 Ga0068858_100042835 3300005842 Bacteria 4197
40 Ga0081539_10003022 3300005985 Bacteria 21833
41 Ga0081539_10036797 3300005985 Bacteria 2923
42 Ga0070712_100075399 3300006175 Bacteria 2425
43 Ga0097621_100014952 3300006237 Bacteria 5825
44 Ga0075434_100116386 3300006871 Bacteria 2686
45 Ga0075436_100002671 3300006914 Bacteria 12262
46 Ga0075436_100004954 3300006914 Bacteria 9153
47 Ga0075436_100017398 3300006914 Bacteria 4921
48 Ga0075436_100030441 3300006914 Bacteria 3715
49 Ga0075436_100057151 3300006914 Bacteria 2695
50 Ga0075436_100103922 3300006914 Bacteria 1980
51 Ga0097620_100022520 3300006931 Bacteria 6318
52 Ga0075435_100013022 3300007076 Bacteria 6174
53 Ga0075435_100109808 3300007076 Bacteria 2293
54 Ga0075435_100119692 3300007076 Bacteria 2197
55 Ga0099794_10069363 3300007265 Bacteria 1725
56 Ga0099795_10046346 3300007788 Bacteria 1566
57 Ga0105240_10008472 3300009093 Bacteria 14707
58 Ga0105240_10047787 3300009093 Bacteria 5413
59 Ga0105240_10160575 3300009093 Bacteria 2670
60 Ga0105240_10258066 3300009093 Bacteria 2012
61 Ga0105245_10054264 3300009098 Bacteria 3599
62 Ga0105241_10024179 3300009174 Bacteria 4512
63 Ga0105242_10020046 3300009176 Bacteria 5241
64 Ga0105238_10020642 3300009551 Bacteria 6710
65 Ga0105238_10148179 3300009551 Bacteria 2323
66 Ga0099796_10010626 3300010159 Bacteria 2537
67 Ga0105239_10480311 3300010375 Bacteria 1412
68 Ga0157370_10008988 3300013104 Bacteria 10726
69 Ga0157369_10007689 3300013105 Bacteria 12400
70 Ga0157369_10027808 3300013105 Bacteria 6265
71 Ga0157369_10182449 3300013105 Bacteria 2208
72 Ga0157374_10004252 3300013296 Bacteria 12040
73 Ga0157374_10371112 3300013296 Bacteria 1424
74 Ga0157378_10199197 3300013297 Bacteria 1893
75 Ga0163162_10358622 3300013306 Bacteria 1591
76 Ga0157372_10001624 3300013307 Bacteria 24382
77 Ga0157372_10093686 3300013307 Bacteria 3419
78 Ga0157372_10120195 3300013307 Bacteria 3016
79 Ga0182006_1000009 3300015261 Bacteria 438243
80 Ga0213875_10000137 3300021388 Bacteria 80801
81 Ga0213875_10001186 3300021388 Bacteria 17826
82 Ga0213875_10015767 3300021388 Bacteria 3673
83 Ga0209563_100005 3300025230 Bacteria 1774893
84 Ga0209129_1000021 3300025258 Bacteria 445018
85 Ga0207697_10071519 3300025315 Bacteria 1453
86 Ga0207692_10008943 3300025898 Bacteria 4165
87 Ga0207699_10029963 3300025906 Bacteria 3040
88 Ga0207699_10118037 3300025906 Bacteria 1711
89 Ga0207705_10011973 3300025909 Bacteria 6268
90 Ga0207654_10084706 3300025911 Bacteria 1917
91 Ga0207707_10120112 3300025912 Bacteria 2297
92 Ga0207695_10004160 3300025913 Bacteria 19870
93 Ga0207695_10066713 3300025913 Bacteria 3694
94 Ga0207695_10150678 3300025913 Bacteria 2265
95 Ga0207693_10008637 3300025915 Bacteria 8334
96 Ga0207660_10031689 3300025917 Bacteria 3644
97 Ga0207652_10102130 3300025921 Bacteria 2534
98 Ga0207694_10029752 3300025924 Bacteria 4168
99 Ga0207659_10184486 3300025926 Bacteria 1655
100 Ga0207700_10023394 3300025928 Bacteria 4259
101 Ga0207664_10011302 3300025929 Bacteria 6334
102 Ga0207664_10056756 3300025929 Bacteria 3111
103 Ga0207664_10182150 3300025929 Bacteria 1804
104 Ga0207690_10020177 3300025932 Bacteria 4114
105 Ga0207690_10025266 3300025932 Bacteria 3727
106 Ga0207706_10007380 3300025933 Bacteria 10161
107 Ga0207686_10013402 3300025934 Bacteria 4536
108 Ga0207686_10025991 3300025934 Bacteria 3413
109 Ga0207686_10174827 3300025934 Bacteria 1517
110 Ga0207709_10203699 3300025935 Bacteria 1415
111 Ga0207670_10029580 3300025936 Bacteria 3491
112 Ga0207665_10038056 3300025939 Bacteria 3202
113 Ga0207665_10256063 3300025939 Bacteria 1295
114 Ga0207691_10267835 3300025940 Bacteria 1472
115 Ga0207711_10051684 3300025941 Bacteria 3520
116 Ga0207667_10002322 3300025949 Bacteria 23821
117 Ga0207667_10015244 3300025949 Bacteria 8739
118 Ga0207667_10108754 3300025949 Bacteria 2860
119 Ga0207703_10152825 3300026035 Bacteria 2014
120 Ga0207702_10029999 3300026078 Bacteria 4530
121 Ga0207648_10076153 3300026089 Bacteria 2924
122 Ga0207674_10219002 3300026116 Bacteria 1852
123 Ga0207698_10083863 3300026142 Bacteria 2581
124 Ga0207698_10120141 3300026142 Bacteria 2222
125 Ga0209371_1000029 3300027312 Bacteria 424797
126 Ga0209371_1006178 3300027312 Bacteria 4519
127 Ga0209179_1018082 3300027512 Bacteria 1343
128 Ga0265337_1003011 3300028556 Bacteria 7460
129 Ga0268256_1000032 3300030500 Bacteria 424603
130 Ga0265340_10049686 3300031247 Bacteria 2036
131 Ga0265339_10033686 3300031249 Bacteria 2882
132 Ga0316579_10007424 3300031691 Bacteria 4526
133 Ga0265314_10020040 3300031711 Bacteria 5168
134 Ga0265342_10071833 3300031712 Bacteria 2016
135 Ga0307412_10355303 3300031911 Bacteria 1178
136 Ga0307416_100008280 3300032002 Bacteria 6694
137 Ga0316583_10001646 3300032133 Bacteria 7554
138 Ga0316593_10064969 3300032168 Bacteria 1253
139 Ga0316593_10065728 3300032168 Bacteria 1247
140 Ga0316592_1025097 3300033524 Bacteria 1284
141 Ga0373953_0034970 3300035117 Bacteria 1972
142 Ga0373954_0000639 3300035118 Bacteria 13372
143 Ga0373955_0135493 3300035172 Bacteria 1440
144 Ga0373931_0042943 3300035691 Bacteria 2379
145 Ga0373935_0210399 3300035692 Bacteria 1347
146 Ga0373933_0010503 3300035724 Bacteria 5077
147 Ga0373947_0145075 3300035725 Bacteria 1525
148 Ga0373937_0009479 3300036401 Bacteria 8463
149 Ga0373937_0117092 3300036401 Bacteria 2482
150 Ga0373925_0251862 3300037068 Bacteria 1416
151 Ga0395898_0042360 3300037466 Bacteria 4493
152 Ga0395898_0115437 3300037466 Bacteria 2572
153 Ga0395905_0000926 3300037471 Bacteria 37874
154 Ga0436364_0095531 3300037853 Bacteria 60654
155 Ga0436364_0198144 3300037853 Bacteria 5858
156 Ga0436364_0259249 3300037853 Bacteria 81192
157 Ga0436365_0336855 3300039437 Bacteria 1971
158 Ga0439452_000012 3300042010 Bacteria 412478
159 Ga0466959_0063367 3300045049 Bacteria 2685
160 Ga0451576_0186480 3300045051 Bacteria 2166
161 Ga0495580_0029418 3300046472 Bacteria 3987
162 Ga0495580_0126207 3300046472 Bacteria 1776
163 Ga0495580_0154748 3300046472 Bacteria 1588
164 Ga0495652_0260214 3300046529 Bacteria 1281
165 Ga0496112_0102287 3300048915 Bacteria 2835
166 Ga0496116_0017402 3300048919 Bacteria 5578
167 Ga0496117_0033209 3300048920 Bacteria 3905
168 Ga0496118_0035909 3300048921 Bacteria 4015
169 Ga0496119_0000105 3300048922 Bacteria 119993
170 Ga0496119_0006730 3300048922 Bacteria 10560
171 Ga0496120_0036132 3300048923 Bacteria 2943
172 Ga0496122_0036437 3300048925 Bacteria 3976
173 Ga0496123_0015537 3300048926 Bacteria 6237
174 Ga0496124_0000578 3300048927 Bacteria 61876
175 Ga0496125_0046948 3300048928 Bacteria 3617
176 Ga0496126_0005766 3300048929 Bacteria 14005
177 Ga0501037_0216576 3300049573 Bacteria 1349
178 Ga0501046_0060698 3300049580 Bacteria 2958
179 Ga0501047_0004552 3300049581 Bacteria 13036
180 Ga0501047_0114972 3300049581 Bacteria 2573
181 Ga0501047_0134197 3300049581 Bacteria 2356
182 Ga0501068_0093743 3300049584 Bacteria 1855
183 Ga0501069_0017768 3300049585 Bacteria 3834
184 Ga0501070_0002387 3300049586 Bacteria 16466
185 Ga0501070_0012809 3300049586 Bacteria 7070
186 Ga0501074_0000199 3300049590 Bacteria 32705
187 Ga0501077_0138537 3300049593 Bacteria 1543
188 Ga0501079_0038417 3300049741 Bacteria 3691
189 Ga0501080_0010689 3300049742 Bacteria 8397
190 Ga0501083_0001605 3300049744 Bacteria 15459
191 Ga0501044_0018597 3300049823 Bacteria 7445
192 Ga0501044_0430172 3300049823 Bacteria 1229
193 nmdc:mga0rr50_142326_c1 3300050513 Bacteria 1931
194 nmdc:mga0rr50_86217_c1 3300050513 Bacteria 2435
195 nmdc:mga08x19_6055_c1 3300050514 Bacteria 7146
196 nmdc:mga08x19_6846_c1 3300050514 Bacteria 6770
197 nmdc:mga08x19_71044_c1 3300050514 Bacteria 2269
198 nmdc:mga08x19_7877_c1 3300050514 Bacteria 6327
199 nmdc:mga08x19_88405_c1 3300050514 Bacteria 2042
200 Ga0500568_0007019 3300053139 Bacteria 5570
201 Ga0501084_0061403 3300054114 Bacteria 3147
202 2547696753 2547132181 Bacteria 4945084
203 2643879505 2643221573 Bacteria 4784121
204 2974436213 2974435778 Bacteria 4876478
205 8055698351 8055693939 Bacteria 4772047
206 Ga0466967_0028540
207 JGI25152J39213_1000148
208 rootL2_10029734
209 Ga0058692_1014763
210 Ga0065712_10089994
211 Ga0065712_10148694
212 Ga0070658_10017333
213 Ga0070683_100302010
214 Ga0070670_100097293
215 Ga0070680_100047018
216 Ga0070689_100193989
217 Ga0070661_100000353
218 Ga0070669_100065867
219 Ga0070675_100186267
220 Ga0070674_100122130
221 Ga0070659_100016756
222 Ga0070709_10233488
223 Ga0070714_100062119
224 Ga0070714_100197419
225 Ga0070713_100053355
226 Ga0070710_10104147
227 Ga0070711_100079352
228 Ga0070705_100007569
229 Ga0070681_10052038
230 Ga0070681_10121060
231 Ga0070679_100127795
232 Ga0070684_100253823
233 Ga0070697_100001941
234 Ga0068853_100361212
235 Ga0070672_100275984
236 Ga0070696_100028244
237 Ga0070696_100057709
238 Ga0068855_100008681
239 Ga0068855_100029901
240 Ga0068855_100171138
241 Ga0068852_100014212
242 Ga0068859_100022520
243 Ga0068858_100011447
244 Ga0068858_100042835
245 Ga0081539_10003022
246 Ga0081539_10036797
247 Ga0070712_100075399
248 Ga0097621_100014952
249 Ga0075434_100116386
250 Ga0075436_100002671
251 Ga0075436_100004954
252 Ga0075436_100017398
253 Ga0075436_100030441
254 Ga0075436_100057151
255 Ga0075436_100103922
256 Ga0097620_100022520
257 Ga0075435_100013022
258 Ga0075435_100109808
259 Ga0075435_100119692
260 Ga0099794_10069363
261 Ga0099795_10046346
262 Ga0105240_10008472
263 Ga0105240_10047787
264 Ga0105240_10160575
265 Ga0105240_10258066
266 Ga0105245_10054264
267 Ga0105241_10024179
268 Ga0105242_10020046
269 Ga0105238_10020642
270 Ga0105238_10148179
271 Ga0099796_10010626
272 Ga0105239_10480311
273 Ga0157370_10008988
274 Ga0157369_10007689
275 Ga0157369_10027808
276 Ga0157369_10182449
277 Ga0157374_10004252
278 Ga0157374_10371112
279 Ga0157378_10199197
280 Ga0163162_10358622
281 Ga0157372_10001624
282 Ga0157372_10093686
283 Ga0157372_10120195
284 Ga0182006_1000009
285 Ga0213875_10000137
286 Ga0213875_10001186
287 Ga0213875_10015767
288 Ga0209563_100005
289 Ga0209129_1000021
290 Ga0207697_10071519
291 Ga0207692_10008943
292 Ga0207699_10029963
293 Ga0207699_10118037
294 Ga0207705_10011973
295 Ga0207654_10084706
296 Ga0207707_10120112
297 Ga0207695_10004160
298 Ga0207695_10066713
299 Ga0207695_10150678
300 Ga0207693_10008637
301 Ga0207660_10031689
302 Ga0207652_10102130
303 Ga0207694_10029752
304 Ga0207659_10184486
305 Ga0207700_10023394
306 Ga0207664_10011302
307 Ga0207664_10056756
308 Ga0207664_10182150
309 Ga0207690_10020177
310 Ga0207690_10025266
311 Ga0207706_10007380
312 Ga0207686_10013402
313 Ga0207686_10025991
314 Ga0207686_10174827
315 Ga0207709_10203699
316 Ga0207670_10029580
317 Ga0207665_10038056
318 Ga0207665_10256063
319 Ga0207691_10267835
320 Ga0207711_10051684
321 Ga0207667_10002322
322 Ga0207667_10015244
323 Ga0207667_10108754
324 Ga0207703_10152825
325 Ga0207702_10029999
326 Ga0207648_10076153
327 Ga0207674_10219002
328 Ga0207698_10083863
329 Ga0207698_10120141
330 Ga0209371_1000029
331 Ga0209371_1006178
332 Ga0209179_1018082
333 Ga0265337_1003011
334 Ga0268256_1000032
335 Ga0265340_10049686
336 Ga0265339_10033686
337 Ga0316579_10007424
338 Ga0265314_10020040
339 Ga0265342_10071833
340 Ga0307412_10355303
341 Ga0307416_100008280
342 Ga0316583_10001646
343 Ga0316593_10064969
344 Ga0316593_10065728
345 Ga0316592_1025097
346 Ga0373953_0034970
347 Ga0373954_0000639
348 Ga0373955_0135493
349 Ga0373931_0042943
350 Ga0373935_0210399
351 Ga0373933_0010503
352 Ga0373947_0145075
353 Ga0373937_0009479
354 Ga0373937_0117092
355 Ga0373925_0251862
356 Ga0395898_0042360
357 Ga0395898_0115437
358 Ga0395905_0000926
359 Ga0436364_0095531
360 Ga0436364_0198144
361 Ga0436364_0259249
362 Ga0436365_0336855
363 Ga0439452_000012
364 Ga0466959_0063367
365 Ga0451576_0186480
366 Ga0495580_0029418
367 Ga0495580_0126207
368 Ga0495580_0154748
369 Ga0495652_0260214
370 Ga0496112_0102287
371 Ga0496116_0017402
372 Ga0496117_0033209
373 Ga0496118_0035909
374 Ga0496119_0000105
375 Ga0496119_0006730
376 Ga0496120_0036132
377 Ga0496122_0036437
378 Ga0496123_0015537
379 Ga0496124_0000578
380 Ga0496125_0046948
381 Ga0496126_0005766
382 Ga0501037_0216576
383 Ga0501046_0060698
384 Ga0501047_0004552
385 Ga0501047_0114972
386 Ga0501047_0134197
387 Ga0501068_0093743
388 Ga0501069_0017768
389 Ga0501070_0002387
390 Ga0501070_0012809
391 Ga0501074_0000199
392 Ga0501077_0138537
393 Ga0501079_0038417
394 Ga0501080_0010689
395 Ga0501083_0001605
396 Ga0501044_0018597
397 Ga0501044_0430172
398 nmdc:mga0rr50_142326_c1
399 nmdc:mga0rr50_86217_c1
400 nmdc:mga08x19_6055_c1
401 nmdc:mga08x19_6846_c1
402 nmdc:mga08x19_71044_c1
403 nmdc:mga08x19_7877_c1
404 nmdc:mga08x19_88405_c1
405 Ga0500568_0007019
406 Ga0501084_0061403
407 2547696753
408 2643879505
409 2974436213
410 8055698351

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

61

346

0.85

PF12849

PBP_like_2

PBP superfamily domain

31

342

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2z22-assembly2.cif.gz_A crystal structure of phosphate preplasmic binding protein psts from yersinia pestis 0.9767 27 338
1quj-assembly1.cif.gz_A phosphate-binding protein mutant with asp 137 replaced by gly complex with chlorine and phosphate 0.9736 27 338
1pbp-assembly1.cif.gz_A fine tuning of the specificity of the periplasmic phosphate transport receptor: site-directed mutagenesis, ligand binding, and crystallographic studies 0.9735 27 338
1a55-assembly1.cif.gz_A phosphate-binding protein mutant a197c 0.9726 27 338
1quk-assembly1.cif.gz_A phosphate-binding protein mutant with asp 137 replaced by asn complex with phosphate 0.9723 27 338
ID Description Score Start End Superfamily
af_P0AG82_103_278_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9923 95 269 3.40.190.10
af_P0AG82_103_278_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9811 95 269 3.40.190.10
af_Q58421_135_323_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9418 97 269 3.40.190.10
1pc3B02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9352 96 269 3.40.190.10
4lvqB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8985 96 269 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A5R2MUA4-F1-model_v4 Extracellular solute-binding protein 0.9955 86 186
AF-A0A1J9PHQ6-F1-model_v4 deleted 0.9928 101 269
AF-A0A4U9DA25-F1-model_v4 Phosphate-binding protein pstS 0.9919 227 338
AF-A0A2X3CRB5-F1-model_v4 Phosphate-binding protein PstS 0.9906 129 269 GO:0035435
GO:0042301
GO:0043190
AF-A0A4S1FX25-F1-model_v4 Phosphate ABC transporter substrate-binding protein PstS 0.9891 108 213

Map