F314193

General Info

Members Datasets Scaffolds Average Seq Length
205 91 205 108

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0775174|Ga0451577_0775174_241_636
Length 131
Sequence MASETLVKFPEPLLNYGCPMTTPQTPPKSSGPILELPADLETVYANLARIAHSPADIVLDFAHLLPGEARAKIRSRVVMTPLSAKLLVKALTENLARYESAFGEINMPTNNSLADTLFRPFQQPPDPPKEP

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
5 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
6 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
14 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
15 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
50 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
53 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
54 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
55 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
56 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
57 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
58 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
59 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
60 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
61 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
62 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
63 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
64 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
65 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
66 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
67 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
68 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
69 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
70 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
72 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
73 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
74 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
75 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
77 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
78 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
79 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
80 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
81 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
82 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
83 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
84 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
85 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
86 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
87 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
88 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
89 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
90 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
91 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.98
Rhizosphere 98.54
Stem 0
Stem Tuber 0
Unclassified 0.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_4124395 2162886006 Unclassified 1658
2 SwRhRL2b_contig_1803320 2162886007 Bacteria 9194
3 Ga0065707_10000474 3300005295 Bacteria 37237
4 Ga0065707_10089649 3300005295 Unclassified 4312
5 Ga0065707_10095270 3300005295 Bacteria 3398
6 Ga0065707_10125247 3300005295 Unclassified 2028
7 Ga0065707_10167961 3300005295 Bacteria 1497
8 Ga0065707_10380007 3300005295 Unclassified 878
9 Ga0070703_10016870 3300005406 Bacteria 2100
10 Ga0070700_100341180 3300005441 Bacteria 1107
11 Ga0070694_100452828 3300005444 Bacteria 1014
12 Ga0070694_100689289 3300005444 Unclassified 830
13 Ga0070694_100866468 3300005444 Bacteria 744
14 Ga0070694_100884830 3300005444 Bacteria 736
15 Ga0070708_100325383 3300005445 Bacteria 1448
16 Ga0070708_101084660 3300005445 Bacteria 750
17 Ga0070706_100112818 3300005467 Bacteria 2531
18 Ga0070706_100455166 3300005467 Bacteria 1191
19 Ga0070706_100575925 3300005467 Bacteria 1047
20 Ga0070707_100121627 3300005468 Bacteria 2535
21 Ga0070707_101081172 3300005468 Unclassified 768
22 Ga0070698_100101534 3300005471 Bacteria 2848
23 Ga0070698_100352517 3300005471 Unclassified 1403
24 Ga0070698_100674860 3300005471 Unclassified 975
25 Ga0070699_100094327 3300005518 Bacteria 2619
26 Ga0070699_101959149 3300005518 Unclassified 536
27 Ga0070697_100124220 3300005536 Bacteria 2161
28 Ga0070695_100036585 3300005545 Bacteria 3090
29 Ga0070695_100314885 3300005545 Unclassified 1161
30 Ga0070696_100183560 3300005546 Unclassified 1553
31 Ga0070696_101513058 3300005546 Unclassified 575
32 Ga0070693_100643946 3300005547 Unclassified 770
33 Ga0070704_100183731 3300005549 Bacteria 1675
34 Ga0068857_100090690 3300005577 Bacteria 2735
35 Ga0068859_100038316 3300005617 Unclassified 4810
36 Ga0068859_100069651 3300005617 Unclassified 3553
37 Ga0068861_100167480 3300005719 Bacteria 1818
38 Ga0068858_100307270 3300005842 Bacteria 1514
39 Ga0068860_101746738 3300005843 Unclassified 644
40 Ga0068862_100489391 3300005844 Unclassified 1166
41 Ga0068862_100691540 3300005844 Unclassified 987
42 Ga0068862_101668000 3300005844 Unclassified 645
43 Ga0081539_10001449 3300005985 Bacteria 40567
44 Ga0081539_10008788 3300005985 Bacteria 8656
45 Ga0075427_10016431 3300006194 Unclassified 1149
46 Ga0075427_10037601 3300006194 Unclassified 809
47 Ga0075428_100032604 3300006844 Bacteria 5753
48 Ga0075428_100033582 3300006844 Bacteria 5664
49 Ga0075428_100399715 3300006844 Bacteria 1473
50 Ga0075428_101950498 3300006844 Unclassified 609
51 Ga0075428_102745978 3300006844 Unclassified 501
52 Ga0075430_100008315 3300006846 Bacteria 8764
53 Ga0075430_100131923 3300006846 Unclassified 2082
54 Ga0075431_100010823 3300006847 Bacteria 9173
55 Ga0075431_100042217 3300006847 Bacteria 4702
56 Ga0075431_100518940 3300006847 Unclassified 1181
57 Ga0075433_11844794 3300006852 Unclassified 519
58 Ga0075429_100003024 3300006880 Bacteria 14254
59 Ga0075429_100006765 3300006880 Bacteria 9939
60 Ga0075429_100009312 3300006880 Bacteria 8526
61 Ga0075429_100020354 3300006880 Bacteria 5756
62 Ga0075429_100042315 3300006880 Bacteria 3964
63 Ga0075429_100708708 3300006880 Unclassified 882
64 Ga0075429_100855502 3300006880 Unclassified 796
65 Ga0097620_100038316 3300006931 Unclassified 4810
66 Ga0097620_100069651 3300006931 Unclassified 3553
67 Ga0097620_100391831 3300006931 Bacteria 1485
68 Ga0097620_101848910 3300006931 Unclassified 667
69 Ga0111539_10149109 3300009094 Unclassified 2738
70 Ga0111539_10928053 3300009094 Bacteria 1012
71 Ga0114129_10005682 3300009147 Bacteria 17658
72 Ga0114129_10016923 3300009147 Bacteria 10382
73 Ga0114129_10020823 3300009147 Bacteria 9315
74 Ga0114129_12335884 3300009147 Unclassified 641
75 Ga0105243_10294538 3300009148 Bacteria 1468
76 Ga0105249_10024594 3300009553 Bacteria 5414
77 Ga0105246_11437706 3300011119 Unclassified 645
78 Ga0163163_10838133 3300014325 Unclassified 983
79 Ga0157380_11051268 3300014326 Unclassified 851
80 Ga0157379_10378914 3300014968 Bacteria 1298
81 Ga0207653_10030570 3300025885 Bacteria 1738
82 Ga0207684_10095105 3300025910 Bacteria 2542
83 Ga0207660_10863688 3300025917 Unclassified 738
84 Ga0207646_10367473 3300025922 Unclassified 1300
85 Ga0207709_10082073 3300025935 Bacteria 2081
86 Ga0207670_11060744 3300025936 Unclassified 683
87 Ga0207712_10772353 3300025961 Bacteria 843
88 Ga0207712_11601586 3300025961 Unclassified 584
89 Ga0207703_10433311 3300026035 Bacteria 1225
90 Ga0207708_10504962 3300026075 Bacteria 1014
91 Ga0207675_100476595 3300026118 Bacteria 1240
92 Ga0207428_11282189 3300027907 Unclassified 508
93 Ga0268265_10425569 3300028380 Bacteria 1234
94 Ga0268264_11812215 3300028381 Unclassified 620
95 Ga0265318_10061658 3300028577 Bacteria 1397
96 Ga0265320_10450530 3300031240 Unclassified 568
97 Ga0265340_10162723 3300031247 Bacteria 1013
98 Ga0265331_10012830 3300031250 Bacteria 4523
99 Ga0316575_10023250 3300031665 Bacteria 2395
100 Ga0316576_10040964 3300031727 Bacteria 3332
101 Ga0316576_10622834 3300031727 Unclassified 786
102 Ga0316578_10016631 3300031728 Unclassified 3985
103 Ga0307405_10225593 3300031731 Bacteria 1378
104 Ga0316577_10370558 3300031733 Unclassified 813
105 Ga0316584_0044174 3300036712 Bacteria 3323
106 Ga0316584_0100085 3300036712 Bacteria 2171
107 Ga0316581_0029736 3300037588 Unclassified 1642
108 Ga0451791_0786477 3300041451 Bacteria 1110
109 Ga0451807_2016489 3300041486 Bacteria 1065
110 Ga0451853_1632928 3300041512 Bacteria 699
111 Ga0451577_0003157 3300042876 Bacteria 18555
112 Ga0451577_0009757 3300042876 Bacteria 9204
113 Ga0451577_0051463 3300042876 Unclassified 3676
114 Ga0451577_0053533 3300042876 Unclassified 3603
115 Ga0451577_0106237 3300042876 Bacteria 2509
116 Ga0451577_0398654 3300042876 Bacteria 1249
117 Ga0451577_0401786 3300042876 Unclassified 1243
118 Ga0451577_0611398 3300042876 Unclassified 989
119 Ga0451577_0699890 3300042876 Unclassified 918
120 Ga0451577_0775174 3300042876 Bacteria 867
121 Ga0451577_1521648 3300042876 Unclassified 591
122 Ga0451577_2001089 3300042876 Bacteria 506
123 Ga0453683_0002512 3300044673 Bacteria 14155
124 Ga0453683_0103420 3300044673 Bacteria 1788
125 Ga0453683_0135645 3300044673 Bacteria 1552
126 Ga0453683_0137955 3300044673 Bacteria 1538
127 Ga0453683_0195101 3300044673 Bacteria 1285
128 Ga0453683_0240272 3300044673 Bacteria 1153
129 Ga0453683_0250066 3300044673 Bacteria 1130
130 Ga0453683_0314923 3300044673 Bacteria 1002
131 Ga0453684_0000012 3300044712 Bacteria 1062512
132 Ga0453684_0000157 3300044712 Bacteria 304259
133 Ga0453684_0000402 3300044712 Bacteria 178427
134 Ga0453684_0011216 3300044712 Bacteria 15086
135 Ga0453684_0026123 3300044712 Bacteria 8450
136 Ga0453684_0027946 3300044712 Bacteria 8069
137 Ga0453684_0030155 3300044712 Bacteria 7670
138 Ga0453684_0038678 3300044712 Bacteria 6515
139 Ga0453684_0079998 3300044712 Bacteria 4083
140 Ga0453684_0092720 3300044712 Bacteria 3722
141 Ga0453684_0102373 3300044712 Unclassified 3502
142 Ga0453684_0136844 3300044712 Bacteria 2931
143 Ga0453684_0139731 3300044712 Bacteria 2895
144 Ga0453684_0180080 3300044712 Bacteria 2482
145 Ga0453684_0190503 3300044712 Unclassified 2399
146 Ga0453684_0272064 3300044712 Bacteria 1935
147 Ga0453684_0580351 3300044712 Bacteria 1231
148 Ga0453684_0663533 3300044712 Bacteria 1137
149 Ga0453684_0672241 3300044712 Unclassified 1128
150 Ga0453684_0743580 3300044712 Unclassified 1062
151 Ga0453684_1025024 3300044712 Unclassified 876
152 Ga0453684_1064696 3300044712 Bacteria 856
153 Ga0453684_1315336 3300044712 Unclassified 753
154 Ga0453684_1326306 3300044712 Bacteria 749
155 Ga0453684_1396477 3300044712 Unclassified 726
156 Ga0453684_1559581 3300044712 Unclassified 679
157 Ga0453684_1571242 3300044712 Bacteria 676
158 Ga0453684_1825939 3300044712 Unclassified 617
159 Ga0451576_0001863 3300045051 Bacteria 34044
160 Ga0451576_0033262 3300045051 Bacteria 5481
161 Ga0451576_0052166 3300045051 Bacteria 4286
162 Ga0451576_0126833 3300045051 Bacteria 2659
163 Ga0451576_0367906 3300045051 Unclassified 1506
164 Ga0451576_0945777 3300045051 Unclassified 904
165 Ga0451576_1327698 3300045051 Bacteria 749
166 Ga0501037_0184174 3300049573 Bacteria 1481
167 Ga0501038_0930675 3300049574 Bacteria 641
168 Ga0501039_0339408 3300049575 Bacteria 1181
169 Ga0501041_1094004 3300049577 Bacteria 514
170 Ga0501042_0451938 3300049578 Bacteria 932
171 Ga0501048_0530099 3300049582 Unclassified 845
172 Ga0501072_0077902 3300049588 Bacteria 2625
173 Ga0501073_0091429 3300049589 Bacteria 2115
174 Ga0501073_0166524 3300049589 Bacteria 1526
175 Ga0501073_0369035 3300049589 Bacteria 991
176 Ga0501074_0248553 3300049590 Bacteria 1265
177 Ga0501074_0551100 3300049590 Unclassified 816
178 Ga0501075_0009289 3300049591 Bacteria 6882
179 Ga0501076_0824038 3300049592 Bacteria 765
180 Ga0501079_0091675 3300049741 Bacteria 2355
181 Ga0501080_0029784 3300049742 Bacteria 5081
182 Ga0501080_0090793 3300049742 Unclassified 2837
183 Ga0501080_0160695 3300049742 Bacteria 2075
184 Ga0501045_1350994 3300049824 Unclassified 518
185 nmdc:mga05p37_166309_c1 3300050507 Bacteria 2692
186 nmdc:mga05p37_454842_c1 3300050507 Bacteria 1481
187 nmdc:mga05p37_55222_c1 3300050507 Bacteria 4887
188 nmdc:mga09592_110047_c1 3300050508 Bacteria 2363
189 nmdc:mga09592_17388_c1 3300050508 Bacteria 5891
190 nmdc:mga09592_185066_c1 3300050508 Bacteria 1802
191 nmdc:mga09592_28008_c1 3300050508 Bacteria 4678
192 nmdc:mga0qj67_54619_c1 3300050509 Bacteria 3163
193 nmdc:mga06r32_438441_c1 3300050510 Unclassified 1286
194 nmdc:mga06r32_59063_c1 3300050510 Bacteria 3687
195 nmdc:mga06r32_90822_c1 3300050510 Bacteria 2984
196 nmdc:mga08y16_610077_c1 3300050511 Unclassified 1099
197 Ga0501084_0000386 3300054114 Bacteria 33878
198 Ga0501084_0144629 3300054114 Bacteria 2003
199 Ga0501084_0233345 3300054114 Bacteria 1553
200 Ga0501082_0259135 3300060353 Bacteria 1513
201 Ga0501082_0843445 3300060353 Bacteria 802
202 Ga0530510_0152423 3300061734 Bacteria 1707
203 Ga0530510_0175592 3300061734 Bacteria 1588
204 Ga0530510_0490670 3300061734 Unclassified 931
205 Ga0530510_1000675 3300061734 Unclassified 640

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0663533 Ga0453684_0663533_781_1068 92
2 3300005444 Ga0070694_100866468 Ga0070694_1008664682 94
3 3300005471 Ga0070698_100101534 Ga0070698_1001015344 94
4 3300005518 Ga0070699_101959149 Ga0070699_1019591491 94
5 3300005545 Ga0070695_100314885 Ga0070695_1003148851 94
6 3300005546 Ga0070696_100183560 Ga0070696_1001835602 94
7 3300005549 Ga0070704_100183731 Ga0070704_1001837313 94
8 3300006194 Ga0075427_10037601 Ga0075427_100376012 94
9 3300006844 Ga0075428_100033582 Ga0075428_1000335822 94
10 3300006844 Ga0075428_100399715 Ga0075428_1003997152 94
11 3300006847 Ga0075431_100518940 Ga0075431_1005189402 94
12 3300006852 Ga0075433_11844794 Ga0075433_118447942 94
13 3300006880 Ga0075429_100006765 Ga0075429_1000067656 94
14 3300006880 Ga0075429_100020354 Ga0075429_1000203541 94
15 3300006880 Ga0075429_100042315 Ga0075429_1000423153 94
16 3300009094 Ga0111539_10928053 Ga0111539_109280532 94
17 3300009147 Ga0114129_10016923 Ga0114129_100169231 94
18 3300009553 Ga0105249_10024594 Ga0105249_100245946 94
19 3300028380 Ga0268265_10425569 Ga0268265_104255692 94
20 3300044673 Ga0453683_0103420 Ga0453683_0103420_674_958 94
21 3300050507 nmdc:mga05p37_454842_c1 nmdc:mga05p37_454842_c1_356_640 94
22 3300050508 nmdc:mga09592_110047_c1 nmdc:mga09592_110047_c1_1690_1977 94
23 3300050508 nmdc:mga09592_185066_c1 nmdc:mga09592_185066_c1_774_1058 94
24 3300050508 nmdc:mga09592_28008_c1 nmdc:mga09592_28008_c1_389_673 94
25 3300050510 nmdc:mga06r32_438441_c1 nmdc:mga06r32_438441_c1_308_592 94
26 3300006844 Ga0075428_101950498 Ga0075428_1019504981 96
27 3300042876 Ga0451577_0398654 Ga0451577_0398654_320_610 96
28 3300042876 Ga0451577_0401786 Ga0451577_0401786_541_831 96
29 3300042876 Ga0451577_0611398 Ga0451577_0611398_594_884 96
30 3300044673 Ga0453683_0135645 Ga0453683_0135645_219_509 96
31 3300044712 Ga0453684_0136844 Ga0453684_0136844_2066_2356 96
32 3300044712 Ga0453684_0743580 Ga0453684_0743580_586_876 96
33 3300031665 Ga0316575_10023250 Ga0316575_100232503 100
34 3300042876 Ga0451577_2001089 Ga0451577_2001089_100_420 102
35 3300044712 Ga0453684_0102373 Ga0453684_0102373_3015_3335 102
36 3300044712 Ga0453684_0580351 Ga0453684_0580351_626_949 102
37 3300044712 Ga0453684_1025024 Ga0453684_1025024_270_602 102
38 3300005444 Ga0070694_100689289 Ga0070694_1006892891 103
39 3300005844 Ga0068862_100489391 Ga0068862_1004893911 103
40 3300006844 Ga0075428_102745978 Ga0075428_1027459781 103
41 3300044712 Ga0453684_1315336 Ga0453684_1315336_49_372 103
42 3300049582 Ga0501048_0530099 Ga0501048_0530099_225_578 103
43 3300049588 Ga0501072_0077902 Ga0501072_0077902_1494_1847 103
44 3300049590 Ga0501074_0551100 Ga0501074_0551100_172_525 103
45 3300049591 Ga0501075_0009289 Ga0501075_0009289_4572_4925 103
46 3300049741 Ga0501079_0091675 Ga0501079_0091675_1817_2170 103
47 3300049742 Ga0501080_0090793 Ga0501080_0090793_54_407 103
48 3300049824 Ga0501045_1350994 Ga0501045_1350994_91_444 103
49 3300054114 Ga0501084_0144629 Ga0501084_0144629_705_1058 103
50 3300060353 Ga0501082_0259135 Ga0501082_0259135_193_546 103
51 3300061734 Ga0530510_0152423 Ga0530510_0152423_890_1243 103
52 3300028577 Ga0265318_10061658 Ga0265318_100616583 104
53 3300031240 Ga0265320_10450530 Ga0265320_104505301 104
54 3300044712 Ga0453684_0672241 Ga0453684_0672241_114_428 104
55 3300005295 Ga0065707_10089649 Ga0065707_100896491 105
56 3300005467 Ga0070706_100575925 Ga0070706_1005759252 105
57 3300005617 Ga0068859_100069651 Ga0068859_1000696515 105
58 3300005844 Ga0068862_100691540 Ga0068862_1006915402 105
59 3300005844 Ga0068862_101668000 Ga0068862_1016680002 105
60 3300006846 Ga0075430_100008315 Ga0075430_1000083157 105
61 3300006847 Ga0075431_100042217 Ga0075431_1000422175 105
62 3300006880 Ga0075429_100003024 Ga0075429_10000302410 105
63 3300006931 Ga0097620_100069651 Ga0097620_1000696515 105
64 3300025961 Ga0207712_11601586 Ga0207712_116015861 105
65 3300050508 nmdc:mga09592_17388_c1 nmdc:mga09592_17388_c1_4729_5109 105
66 3300050509 nmdc:mga0qj67_54619_c1 nmdc:mga0qj67_54619_c1_913_1293 105
67 3300050510 nmdc:mga06r32_90822_c1 nmdc:mga06r32_90822_c1_2084_2464 105
68 3300005444 Ga0070694_100884830 Ga0070694_1008848302 106
69 3300005467 Ga0070706_100112818 Ga0070706_1001128184 106
70 3300025910 Ga0207684_10095105 Ga0207684_100951054 106
71 3300031247 Ga0265340_10162723 Ga0265340_101627232 106
72 3300031250 Ga0265331_10012830 Ga0265331_100128307 106
73 3300031727 Ga0316576_10040964 Ga0316576_100409643 106
74 3300031727 Ga0316576_10622834 Ga0316576_106228342 106
75 3300031728 Ga0316578_10016631 Ga0316578_100166313 106
76 3300031733 Ga0316577_10370558 Ga0316577_103705582 106
77 3300036712 Ga0316584_0100085 Ga0316584_0100085_712_1047 106
78 3300037588 Ga0316581_0029736 Ga0316581_0029736_257_589 106
79 3300041451 Ga0451791_0786477 Ga0451791_0786477_355_702 106
80 3300041486 Ga0451807_2016489 Ga0451807_2016489_514_861 106
81 3300041512 Ga0451853_1632928 Ga0451853_1632928_14_361 106
82 3300042876 Ga0451577_0003157 Ga0451577_0003157_1503_1841 106
83 3300042876 Ga0451577_0106237 Ga0451577_0106237_1290_1619 106
84 3300042876 Ga0451577_0699890 Ga0451577_0699890_182_520 106
85 3300044673 Ga0453683_0002512 Ga0453683_0002512_13385_13723 106
86 3300044673 Ga0453683_0240272 Ga0453683_0240272_433_771 106
87 3300044712 Ga0453684_0000012 Ga0453684_0000012_586135_586473 106
88 3300044712 Ga0453684_0030155 Ga0453684_0030155_4720_5049 106
89 3300044712 Ga0453684_1396477 Ga0453684_1396477_392_712 106
90 3300044712 Ga0453684_1571242 Ga0453684_1571242_37_363 106
91 3300045051 Ga0451576_0001863 Ga0451576_0001863_32887_33225 106
92 3300045051 Ga0451576_0033262 Ga0451576_0033262_331_651 106
93 3300045051 Ga0451576_0367906 Ga0451576_0367906_88_426 106
94 2162886006 SwRhRL3b_contig_4124395 SwRhRL3b_0659.00000200 107
95 2162886007 SwRhRL2b_contig_1803320 SwRhRL2b_0005.00006310 107
96 3300005295 Ga0065707_10000474 Ga0065707_1000047413 107
97 3300005295 Ga0065707_10095270 Ga0065707_100952704 107
98 3300005295 Ga0065707_10125247 Ga0065707_101252472 107
99 3300005295 Ga0065707_10167961 Ga0065707_101679613 107
100 3300005295 Ga0065707_10380007 Ga0065707_103800072 107
101 3300005406 Ga0070703_10016870 Ga0070703_100168703 107
102 3300005441 Ga0070700_100341180 Ga0070700_1003411802 107
103 3300005444 Ga0070694_100452828 Ga0070694_1004528282 107
104 3300005445 Ga0070708_100325383 Ga0070708_1003253832 107
105 3300005445 Ga0070708_101084660 Ga0070708_1010846602 107
106 3300005467 Ga0070706_100455166 Ga0070706_1004551662 107
107 3300005468 Ga0070707_100121627 Ga0070707_1001216272 107
108 3300005468 Ga0070707_101081172 Ga0070707_1010811722 107
109 3300005471 Ga0070698_100352517 Ga0070698_1003525172 107
110 3300005471 Ga0070698_100674860 Ga0070698_1006748602 107
111 3300005518 Ga0070699_100094327 Ga0070699_1000943272 107
112 3300005536 Ga0070697_100124220 Ga0070697_1001242202 107
113 3300005545 Ga0070695_100036585 Ga0070695_1000365855 107
114 3300005546 Ga0070696_101513058 Ga0070696_1015130581 107
115 3300005547 Ga0070693_100643946 Ga0070693_1006439462 107
116 3300005577 Ga0068857_100090690 Ga0068857_1000906902 107
117 3300005617 Ga0068859_100038316 Ga0068859_1000383164 107
118 3300005719 Ga0068861_100167480 Ga0068861_1001674803 107
119 3300005842 Ga0068858_100307270 Ga0068858_1003072702 107
120 3300005843 Ga0068860_101746738 Ga0068860_1017467382 107
121 3300005985 Ga0081539_10001449 Ga0081539_1000144914 107
122 3300005985 Ga0081539_10008788 Ga0081539_100087885 107
123 3300006194 Ga0075427_10016431 Ga0075427_100164311 107
124 3300006844 Ga0075428_100032604 Ga0075428_1000326044 107
125 3300006846 Ga0075430_100131923 Ga0075430_1001319233 107
126 3300006847 Ga0075431_100010823 Ga0075431_1000108237 107
127 3300006880 Ga0075429_100009312 Ga0075429_1000093124 107
128 3300006880 Ga0075429_100708708 Ga0075429_1007087082 107
129 3300006880 Ga0075429_100855502 Ga0075429_1008555021 107
130 3300006931 Ga0097620_100038316 Ga0097620_1000383164 107
131 3300006931 Ga0097620_100391831 Ga0097620_1003918312 107
132 3300006931 Ga0097620_101848910 Ga0097620_1018489102 107
133 3300009094 Ga0111539_10149109 Ga0111539_101491093 107
134 3300009147 Ga0114129_10005682 Ga0114129_100056822 107
135 3300009147 Ga0114129_10020823 Ga0114129_100208237 107
136 3300009147 Ga0114129_12335884 Ga0114129_123358841 107
137 3300009148 Ga0105243_10294538 Ga0105243_102945382 107
138 3300011119 Ga0105246_11437706 Ga0105246_114377062 107
139 3300014325 Ga0163163_10838133 Ga0163163_108381332 107
140 3300014326 Ga0157380_11051268 Ga0157380_110512682 107
141 3300014968 Ga0157379_10378914 Ga0157379_103789142 107
142 3300025885 Ga0207653_10030570 Ga0207653_100305702 107
143 3300025917 Ga0207660_10863688 Ga0207660_108636882 107
144 3300025922 Ga0207646_10367473 Ga0207646_103674732 107
145 3300025935 Ga0207709_10082073 Ga0207709_100820731 107
146 3300025936 Ga0207670_11060744 Ga0207670_110607442 107
147 3300025961 Ga0207712_10772353 Ga0207712_107723532 107
148 3300026035 Ga0207703_10433311 Ga0207703_104333112 107
149 3300026075 Ga0207708_10504962 Ga0207708_105049622 107
150 3300026118 Ga0207675_100476595 Ga0207675_1004765952 107
151 3300027907 Ga0207428_11282189 Ga0207428_112821891 107
152 3300028381 Ga0268264_11812215 Ga0268264_118122152 107
153 3300031731 Ga0307405_10225593 Ga0307405_102255933 107
154 3300036712 Ga0316584_0044174 Ga0316584_0044174_394_732 107
155 3300042876 Ga0451577_0009757 Ga0451577_0009757_730_1068 107
156 3300042876 Ga0451577_0051463 Ga0451577_0051463_444_788 107
157 3300042876 Ga0451577_0053533 Ga0451577_0053533_946_1284 107
158 3300042876 Ga0451577_0775174 Ga0451577_0775174_241_636 107
159 3300042876 Ga0451577_1521648 Ga0451577_1521648_105_443 107
160 3300044673 Ga0453683_0137955 Ga0453683_0137955_953_1297 107
161 3300044673 Ga0453683_0195101 Ga0453683_0195101_336_683 107
162 3300044673 Ga0453683_0250066 Ga0453683_0250066_564_887 107
163 3300044673 Ga0453683_0314923 Ga0453683_0314923_640_963 107
164 3300044712 Ga0453684_0000157 Ga0453684_0000157_274038_274385 107
165 3300044712 Ga0453684_0000402 Ga0453684_0000402_73779_74117 107
166 3300044712 Ga0453684_0011216 Ga0453684_0011216_730_1068 107
167 3300044712 Ga0453684_0026123 Ga0453684_0026123_1384_1731 107
168 3300044712 Ga0453684_0027946 Ga0453684_0027946_5638_5976 107
169 3300044712 Ga0453684_0038678 Ga0453684_0038678_2154_2498 107
170 3300044712 Ga0453684_0079998 Ga0453684_0079998_1615_1953 107
171 3300044712 Ga0453684_0092720 Ga0453684_0092720_2892_3230 107
172 3300044712 Ga0453684_0139731 Ga0453684_0139731_2409_2747 107
173 3300044712 Ga0453684_0180080 Ga0453684_0180080_2015_2353 107
174 3300044712 Ga0453684_0190503 Ga0453684_0190503_1565_1915 107
175 3300044712 Ga0453684_0272064 Ga0453684_0272064_424_762 107
176 3300044712 Ga0453684_1064696 Ga0453684_1064696_508_846 107
177 3300044712 Ga0453684_1326306 Ga0453684_1326306_289_633 107
178 3300044712 Ga0453684_1559581 Ga0453684_1559581_55_393 107
179 3300044712 Ga0453684_1825939 Ga0453684_1825939_223_561 107
180 3300045051 Ga0451576_0052166 Ga0451576_0052166_2014_2361 107
181 3300045051 Ga0451576_0126833 Ga0451576_0126833_1854_2192 107
182 3300045051 Ga0451576_0945777 Ga0451576_0945777_350_673 107
183 3300045051 Ga0451576_1327698 Ga0451576_1327698_143_466 107
184 3300049573 Ga0501037_0184174 Ga0501037_0184174_618_983 107
185 3300049574 Ga0501038_0930675 Ga0501038_0930675_178_501 107
186 3300049575 Ga0501039_0339408 Ga0501039_0339408_187_552 107
187 3300049577 Ga0501041_1094004 Ga0501041_1094004_175_498 107
188 3300049578 Ga0501042_0451938 Ga0501042_0451938_486_809 107
189 3300049589 Ga0501073_0091429 Ga0501073_0091429_702_1064 107
190 3300049589 Ga0501073_0166524 Ga0501073_0166524_371_733 107
191 3300049589 Ga0501073_0369035 Ga0501073_0369035_440_778 107
192 3300049590 Ga0501074_0248553 Ga0501074_0248553_373_696 107
193 3300049592 Ga0501076_0824038 Ga0501076_0824038_79_402 107
194 3300049742 Ga0501080_0029784 Ga0501080_0029784_2245_2610 107
195 3300049742 Ga0501080_0160695 Ga0501080_0160695_1009_1332 107
196 3300050507 nmdc:mga05p37_166309_c1 nmdc:mga05p37_166309_c1_2155_2478 107
197 3300050507 nmdc:mga05p37_55222_c1 nmdc:mga05p37_55222_c1_557_928 107
198 3300050510 nmdc:mga06r32_59063_c1 nmdc:mga06r32_59063_c1_3064_3435 107
199 3300050511 nmdc:mga08y16_610077_c1 nmdc:mga08y16_610077_c1_674_997 107
200 3300054114 Ga0501084_0000386 Ga0501084_0000386_27047_27409 107
201 3300054114 Ga0501084_0233345 Ga0501084_0233345_658_981 107
202 3300060353 Ga0501082_0843445 Ga0501082_0843445_186_551 107
203 3300061734 Ga0530510_0175592 Ga0530510_0175592_23_346 107
204 3300061734 Ga0530510_0490670 Ga0530510_0490670_575_898 107
205 3300061734 Ga0530510_1000675 Ga0530510_1000675_75_404 107

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11950

DUF3467

Protein of unknown function (DUF3467)

20

107

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4l9c-assembly1.cif.gz_A crystal structure of the fp domain of human f-box protein fbxo7 (native) 0.8196 21 61
4ttz-assembly1.cif.gz_C n-terminal domain of c. reinhardtii sas-6 homolog bld12p variant g94e f145w q147k (nn26) 0.758 24 59
1nbw-assembly1.cif.gz_A glycerol dehydratase reactivase 0.7572 23 58
2j4r-assembly2.cif.gz_B structural study of the aquifex aeolicus ppx-gppa enzyme 0.7463 22 58
5dmq-assembly1.cif.gz_A crystal structure of mouse erf1 in complex with reverse transcriptase (rt) of moloney murine leukemia virus 0.7231 28 58
ID Description Score Start End Superfamily
af_G5EBL1_11_313_2.140.10.30 Mainly Beta;8 Propeller;Methanol Dehydrogenase; Chain A;Dipeptidylpeptidase IV, N-terminal domain 0.8057 26 58 2.140.10.30
af_P60484_188_353_2.60.40.1110 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8035 33 60 2.60.40.1110
af_A0A2R8QV90_961_1207_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8027 24 58 2.130.10.10
af_I1K281_4_189_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.781 34 58 2.60.40.150
af_Q8I3H7_28_304_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7746 24 58 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A846P7C1-F1-model_v4 DUF3467 domain-containing protein 0.9216 26 89
AF-A0A1G7PZ88-F1-model_v4 DUF3467 domain-containing protein 0.893 23 91
AF-A0A662DSD9-F1-model_v4 DUF3467 domain-containing protein 0.8622 24 91
AF-A0A352VVB8-F1-model_v4 DUF3467 domain-containing protein 0.8483 24 88
AF-A0A679HP80-F1-model_v4 DUF3467 domain-containing protein 0.8472 23 107

Feature Viewer

pLDDT pTM Quality
77.78 0.55 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map