F313935

General Info

Members Datasets Scaffolds Average Seq Length
205 144 410 252

Family's Representative Sequence

Representative Sequence 3300025928|Ga0207700_10084196|Ga0207700_100841962
Length 285
Sequence VKQDDRAPFFGALQRARLSAYAPGEFVEQEGFMRAGEILALAKRSGIAAGVSVLDLCCGVAGPGRLFSRELGCTYTGVDYSSSALAIARERARDLPCRFEVSRIPPIPSGPFDVVILFETMLAFPDKETLLQEVSQALTAGGRFTFTMEEGAPLTDAERERMPDADTVWLTPLEDMLTYLARAGLVVRWQDDCSRSHRAVADSLIDAFAADAADIAEQVGRPAFEELLAGHRLWSDWLREGRVRKLAIVAEKVEAASMGPTRSLASGVQRVGNADDHDDRVSEAQ

Samples

Sample ID Description Type Environment
1 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
10 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
14 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
17 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
18 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
19 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
20 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
21 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
22 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
24 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
28 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
29 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
30 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
31 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
46 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
47 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
48 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
49 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
50 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
51 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
52 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
53 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
54 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
55 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
56 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
57 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
58 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
59 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
60 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
61 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
62 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
63 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
64 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
65 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
66 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
67 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
68 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
69 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
70 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
71 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
72 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
73 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
74 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
75 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
76 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
77 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
78 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
79 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
80 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
81 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
82 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
83 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
84 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
85 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
86 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
87 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
88 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
89 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
90 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
91 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
92 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
93 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
94 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
95 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
96 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
97 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
98 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
99 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
100 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
101 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
102 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
103 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
104 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
105 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
106 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
107 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
108 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
109 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
110 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
111 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
112 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
113 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
114 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
115 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
116 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
117 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
118 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
119 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
120 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
121 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
122 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
123 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
124 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
127 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
130 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
131 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
132 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
133 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
134 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
135 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
136 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
137 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
138 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
139 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
140 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
141 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
142 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
143 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
144 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.39
Rhizosphere 95.61
Stem 0
Stem Tuber 0
Unclassified 10.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207700_10084196 3300025928 Bacteria 2492
2 Ga0070683_100362598 3300005329 Bacteria 1380
3 Ga0070682_100130077 3300005337 Unclassified 1703
4 Ga0070674_100028343 3300005356 Bacteria 3678
5 Ga0070709_10178291 3300005434 Bacteria 1490
6 Ga0070713_100059156 3300005436 Bacteria 3199
7 Ga0070710_10006372 3300005437 Bacteria 5666
8 Ga0070711_100083861 3300005439 Bacteria 2278
9 Ga0068867_100266920 3300005459 Bacteria 1398
10 Ga0070699_100756863 3300005518 Unclassified 888
11 Ga0070679_100033413 3300005530 Bacteria 5093
12 Ga0068856_100011877 3300005614 Bacteria 8435
13 Ga0068859_100368114 3300005617 Unclassified 1533
14 Ga0068858_100029268 3300005842 Bacteria 5114
15 Ga0081455_10024797 3300005937 Bacteria 5545
16 Ga0081540_1004696 3300005983 Bacteria 10338
17 Ga0070717_10029511 3300006028 Bacteria 4400
18 Ga0070717_10245340 3300006028 Unclassified 1581
19 Ga0070712_100000002 3300006175 Bacteria 288475
20 Ga0070712_100010970 3300006175 Bacteria 5733
21 Ga0070712_100087453 3300006175 Bacteria 2274
22 Ga0070712_100206955 3300006175 Unclassified 1545
23 Ga0070712_100339007 3300006175 Unclassified 1227
24 Ga0075431_100627014 3300006847 Bacteria 1057
25 Ga0075434_100000357 3300006871 Bacteria 33121
26 Ga0075436_100018104 3300006914 Bacteria 4824
27 Ga0097620_100368125 3300006931 Unclassified 1533
28 Ga0075435_100002080 3300007076 Bacteria 13133
29 Ga0111539_10369093 3300009094 Bacteria 1670
30 Ga0105245_10036472 3300009098 Bacteria 4368
31 Ga0114129_10504574 3300009147 Bacteria 1580
32 Ga0105242_10073006 3300009176 Bacteria 2851
33 Ga0105249_10129914 3300009553 Bacteria 2403
34 Ga0157380_10520269 3300014326 Unclassified 1160
35 Ga0157379_10081093 3300014968 Bacteria 2906
36 Ga0207642_10182605 3300025899 Bacteria 1144
37 Ga0207699_10076729 3300025906 Bacteria 2059
38 Ga0207699_10117945 3300025906 Bacteria 1712
39 Ga0207705_10062369 3300025909 Bacteria 2693
40 Ga0207693_10000014 3300025915 Bacteria 148984
41 Ga0207693_10000956 3300025915 Bacteria 25897
42 Ga0207693_10213613 3300025915 Unclassified 1516
43 Ga0207663_10086602 3300025916 Bacteria 2066
44 Ga0207652_10067290 3300025921 Bacteria 3106
45 Ga0207687_10209227 3300025927 Bacteria 1529
46 Ga0207669_10238752 3300025937 Bacteria 1346
47 Ga0207712_10345801 3300025961 Bacteria 1235
48 Ga0207703_10144869 3300026035 Unclassified 2065
49 Ga0207702_10005699 3300026078 Bacteria 10859
50 Ga0207648_10032621 3300026089 Bacteria 4596
51 Ga0207674_10011757 3300026116 Bacteria 9821
52 Ga0207698_10863157 3300026142 Bacteria 911
53 Ga0265338_10076107 3300028800 Bacteria 2844
54 Ga0265338_10091430 3300028800 Bacteria 2514
55 Ga0265316_10094497 3300031344 Bacteria 2278
56 Ga0307408_100007539 3300031548 Bacteria 7193
57 Ga0307408_100156610 3300031548 Unclassified 1805
58 Ga0307413_10004343 3300031824 Bacteria 6154
59 Ga0307406_10035145 3300031901 Bacteria 3079
60 Ga0307407_10004258 3300031903 Bacteria 6040
61 Ga0307407_10006827 3300031903 Bacteria 5116
62 Ga0307409_100011378 3300031995 Bacteria 5605
63 Ga0307416_100014304 3300032002 Bacteria 5431
64 Ga0307416_100633492 3300032002 Bacteria 1152
65 Ga0307414_10051813 3300032004 Bacteria 2852
66 Ga0307411_10003214 3300032005 Bacteria 7523
67 Ga0307415_100003780 3300032126 Bacteria 7759
68 Ga0373923_0022839 3300035111 Bacteria 2456
69 Ga0373923_0028835 3300035111 Bacteria 2222
70 Ga0373936_0044398 3300035113 Bacteria 1788
71 Ga0373945_0008066 3300035116 Bacteria 3420
72 Ga0373953_0090697 3300035117 Bacteria 1278
73 Ga0373954_0049682 3300035118 Bacteria 1967
74 Ga0373943_0011768 3300035170 Bacteria 3938
75 Ga0373946_0010084 3300035171 Bacteria 3493
76 Ga0373955_0014203 3300035172 Bacteria 3869
77 Ga0373924_0007148 3300035410 Bacteria 4024
78 Ga0373935_0016012 3300035692 Bacteria 4537
79 Ga0373927_0018270 3300035695 Bacteria 4609
80 Ga0373933_0091605 3300035724 Bacteria 1876
81 Ga0373933_0122887 3300035724 Bacteria 1627
82 Ga0373947_0006798 3300035725 Bacteria 6631
83 Ga0373937_0004316 3300036401 Bacteria 12058
84 Ga0373937_0035648 3300036401 Bacteria 4529
85 Ga0373937_0221342 3300036401 Bacteria 1782
86 Ga0373925_0003728 3300037068 Bacteria 11701
87 Ga0395899_0007344 3300037312 Bacteria 8522
88 Ga0395900_0005661 3300037418 Bacteria 13065
89 Ga0395898_0014362 3300037466 Bacteria 8139
90 Ga0395898_0160100 3300037466 Bacteria 2153
91 Ga0395898_0645800 3300037466 Bacteria 1001
92 Ga0395901_0084991 3300038443 Bacteria 3307
93 Ga0395901_0161903 3300038443 Bacteria 2350
94 Ga0395901_0366277 3300038443 Bacteria 1485
95 Ga0466966_0066185 3300044684 Bacteria 2271
96 Ga0466966_0079278 3300044684 Unclassified 2047
97 Ga0466961_0081792 3300044693 Bacteria 2043
98 Ga0466963_0130760 3300044694 Bacteria 1734
99 Ga0466971_0021193 3300044719 Bacteria 2891
100 Ga0466971_0062556 3300044719 Bacteria 1684
101 Ga0466968_0026329 3300044735 Bacteria 2386
102 Ga0466968_0162298 3300044735 Bacteria 1032
103 Ga0466968_0185841 3300044735 Bacteria 968
104 Ga0466970_0098502 3300044765 Bacteria 1591
105 Ga0466970_0259893 3300044765 Unclassified 974
106 Ga0466957_0017229 3300044842 Bacteria 4229
107 Ga0466957_0069338 3300044842 Bacteria 2178
108 Ga0466957_0169892 3300044842 Unclassified 1420
109 Ga0466959_0097594 3300045049 Bacteria 2106
110 Ga0466958_0002370 3300045836 Bacteria 9436
111 Ga0466958_0022406 3300045836 Bacteria 3700
112 Ga0466958_0058967 3300045836 Bacteria 2334
113 Ga0466958_0097249 3300045836 Bacteria 1827
114 Ga0466967_0026831 3300045976 Bacteria 4779
115 Ga0466967_0059403 3300045976 Bacteria 3385
116 Ga0466967_0215418 3300045976 Bacteria 1823
117 Ga0466967_0518016 3300045976 Bacteria 1172
118 Ga0466967_0608265 3300045976 Bacteria 1079
119 Ga0495592_0030093 3300046454 Bacteria 4106
120 Ga0495603_0079777 3300046455 Bacteria 1918
121 Ga0495629_0045022 3300046459 Bacteria 3096
122 Ga0495641_0014502 3300046461 Bacteria 4259
123 Ga0495641_0015352 3300046461 Bacteria 4093
124 Ga0495641_0030148 3300046461 Unclassified 2605
125 Ga0495641_0074702 3300046461 Bacteria 1520
126 Ga0495651_0003660 3300046462 Bacteria 11773
127 Ga0495651_0077855 3300046462 Bacteria 2509
128 Ga0495653_0001852 3300046463 Bacteria 16708
129 Ga0495653_0144983 3300046463 Unclassified 1665
130 Ga0495639_0000484 3300046475 Bacteria 18956
131 Ga0495662_0007195 3300046476 Bacteria 5512
132 Ga0495608_0005272 3300046511 Bacteria 9235
133 Ga0495608_0024970 3300046511 Bacteria 4082
134 Ga0495608_0087634 3300046511 Bacteria 2016
135 Ga0495618_0019770 3300046514 Bacteria 4145
136 Ga0495618_0022659 3300046514 Bacteria 3880
137 Ga0495628_0226518 3300046516 Bacteria 1402
138 Ga0495630_0010983 3300046517 Bacteria 6546
139 Ga0495630_0201710 3300046517 Unclassified 1518
140 Ga0495630_0276883 3300046517 Bacteria 1282
141 Ga0495637_0124174 3300046520 Unclassified 991
142 Ga0495666_0007679 3300046526 Bacteria 5396
143 Ga0495642_0059706 3300046528 Bacteria 1581
144 Ga0495652_0103327 3300046529 Bacteria 2307
145 Ga0495665_0018249 3300046531 Bacteria 3770
146 Ga0495640_0307762 3300046533 Bacteria 983
147 Ga0495587_0015295 3300046536 Bacteria 4794
148 Ga0495667_0002607 3300046559 Bacteria 12036
149 Ga0495667_0007646 3300046559 Bacteria 7331
150 Ga0495634_0007800 3300046642 Bacteria 8002
151 Ga0495634_0021130 3300046642 Bacteria 4606
152 Ga0495635_0024557 3300046663 Bacteria 4200
153 Ga0495588_0008864 3300046674 Bacteria 4627
154 Ga0495657_0005010 3300046675 Bacteria 10526
155 Ga0495657_0094239 3300046675 Bacteria 1915
156 Ga0495599_0206296 3300046678 Bacteria 1206
157 Ga0495647_0009790 3300046681 Bacteria 3255
158 Ga0495658_0001799 3300046683 Bacteria 11028
159 Ga0495658_0015971 3300046683 Bacteria 3861
160 Ga0495613_0003841 3300046689 Bacteria 11243
161 Ga0495624_0010127 3300046690 Bacteria 6500
162 Ga0495624_0230201 3300046690 Bacteria 1123
163 Ga0495600_0002191 3300046809 Bacteria 11104
164 Ga0495600_0004303 3300046809 Bacteria 8517
165 Ga0495581_0018086 3300047315 Bacteria 4093
166 Ga0495604_0005131 3300047317 Bacteria 10365
167 Ga0495604_0032853 3300047317 Bacteria 4110
168 Ga0495674_0006439 3300047319 Bacteria 11257
169 Ga0495674_0040093 3300047319 Bacteria 4191
170 Ga0495676_0007501 3300047321 Bacteria 10005
171 Ga0495676_0157673 3300047321 Bacteria 1609
172 Ga0495680_0015924 3300047322 Bacteria 6472
173 Ga0495677_0128255 3300047445 Unclassified 970
174 Ga0495684_0013927 3300047471 Bacteria 6186
175 Ga0495684_0283906 3300047471 Bacteria 1193
176 Ga0495593_0002958 3300047673 Bacteria 10219
177 Ga0495593_0040089 3300047673 Bacteria 2523
178 Ga0495602_0463729 3300048088 Unclassified 892
179 Ga0495614_0026363 3300048089 Bacteria 2504
180 Ga0496102_0214354 3300048905 Bacteria 1815
181 Ga0496105_0042219 3300048908 Bacteria 3759
182 Ga0496109_0524271 3300048912 Bacteria 1118
183 Ga0496112_0020594 3300048915 Bacteria 6253
184 Ga0496112_0104672 3300048915 Bacteria 2800
185 Ga0496113_0005449 3300048916 Bacteria 7938
186 Ga0496113_0029851 3300048916 Bacteria 3942
187 Ga0496113_0082374 3300048916 Bacteria 2468
188 Ga0496114_0063339 3300048917 Bacteria 3096
189 Ga0501067_0156647 3300049583 Bacteria 1269
190 Ga0501067_0261942 3300049583 Bacteria 962
191 Ga0501068_0002787 3300049584 Bacteria 9294
192 Ga0501069_0191812 3300049585 Bacteria 1182
193 Ga0501207_024258 3300049654 Unclassified 989
194 Ga0501217_038270 3300049661 Unclassified 1211
195 Ga0501081_0144571 3300049743 Bacteria 1706
196 nmdc:mga05p37_337386_c1 3300050507 Bacteria 1778
197 nmdc:mga06r32_621232_c1 3300050510 Bacteria 1050
198 nmdc:mga0n895_226873_c1 3300050512 Bacteria 1896
199 nmdc:mga08x19_15393_c1 3300050514 Bacteria 4653
200 Ga0495601_0017141 3300053077 Bacteria 4396
201 Ga0495595_0070472 3300053084 Bacteria 1651
202 Ga0495595_0184447 3300053084 Bacteria 1035
203 Ga0495619_0034264 3300053085 Bacteria 3300
204 Ga0495619_0057382 3300053085 Bacteria 2583
205 Ga0466962_0039868 3300061719 Bacteria 2248
206 Ga0207700_10084196
207 Ga0070683_100362598
208 Ga0070682_100130077
209 Ga0070674_100028343
210 Ga0070709_10178291
211 Ga0070713_100059156
212 Ga0070710_10006372
213 Ga0070711_100083861
214 Ga0068867_100266920
215 Ga0070699_100756863
216 Ga0070679_100033413
217 Ga0068856_100011877
218 Ga0068859_100368114
219 Ga0068858_100029268
220 Ga0081455_10024797
221 Ga0081540_1004696
222 Ga0070717_10029511
223 Ga0070717_10245340
224 Ga0070712_100000002
225 Ga0070712_100010970
226 Ga0070712_100087453
227 Ga0070712_100206955
228 Ga0070712_100339007
229 Ga0075431_100627014
230 Ga0075434_100000357
231 Ga0075436_100018104
232 Ga0097620_100368125
233 Ga0075435_100002080
234 Ga0111539_10369093
235 Ga0105245_10036472
236 Ga0114129_10504574
237 Ga0105242_10073006
238 Ga0105249_10129914
239 Ga0157380_10520269
240 Ga0157379_10081093
241 Ga0207642_10182605
242 Ga0207699_10076729
243 Ga0207699_10117945
244 Ga0207705_10062369
245 Ga0207693_10000014
246 Ga0207693_10000956
247 Ga0207693_10213613
248 Ga0207663_10086602
249 Ga0207652_10067290
250 Ga0207687_10209227
251 Ga0207669_10238752
252 Ga0207712_10345801
253 Ga0207703_10144869
254 Ga0207702_10005699
255 Ga0207648_10032621
256 Ga0207674_10011757
257 Ga0207698_10863157
258 Ga0265338_10076107
259 Ga0265338_10091430
260 Ga0265316_10094497
261 Ga0307408_100007539
262 Ga0307408_100156610
263 Ga0307413_10004343
264 Ga0307406_10035145
265 Ga0307407_10004258
266 Ga0307407_10006827
267 Ga0307409_100011378
268 Ga0307416_100014304
269 Ga0307416_100633492
270 Ga0307414_10051813
271 Ga0307411_10003214
272 Ga0307415_100003780
273 Ga0373923_0022839
274 Ga0373923_0028835
275 Ga0373936_0044398
276 Ga0373945_0008066
277 Ga0373953_0090697
278 Ga0373954_0049682
279 Ga0373943_0011768
280 Ga0373946_0010084
281 Ga0373955_0014203
282 Ga0373924_0007148
283 Ga0373935_0016012
284 Ga0373927_0018270
285 Ga0373933_0091605
286 Ga0373933_0122887
287 Ga0373947_0006798
288 Ga0373937_0004316
289 Ga0373937_0035648
290 Ga0373937_0221342
291 Ga0373925_0003728
292 Ga0395899_0007344
293 Ga0395900_0005661
294 Ga0395898_0014362
295 Ga0395898_0160100
296 Ga0395898_0645800
297 Ga0395901_0084991
298 Ga0395901_0161903
299 Ga0395901_0366277
300 Ga0466966_0066185
301 Ga0466966_0079278
302 Ga0466961_0081792
303 Ga0466963_0130760
304 Ga0466971_0021193
305 Ga0466971_0062556
306 Ga0466968_0026329
307 Ga0466968_0162298
308 Ga0466968_0185841
309 Ga0466970_0098502
310 Ga0466970_0259893
311 Ga0466957_0017229
312 Ga0466957_0069338
313 Ga0466957_0169892
314 Ga0466959_0097594
315 Ga0466958_0002370
316 Ga0466958_0022406
317 Ga0466958_0058967
318 Ga0466958_0097249
319 Ga0466967_0026831
320 Ga0466967_0059403
321 Ga0466967_0215418
322 Ga0466967_0518016
323 Ga0466967_0608265
324 Ga0495592_0030093
325 Ga0495603_0079777
326 Ga0495629_0045022
327 Ga0495641_0014502
328 Ga0495641_0015352
329 Ga0495641_0030148
330 Ga0495641_0074702
331 Ga0495651_0003660
332 Ga0495651_0077855
333 Ga0495653_0001852
334 Ga0495653_0144983
335 Ga0495639_0000484
336 Ga0495662_0007195
337 Ga0495608_0005272
338 Ga0495608_0024970
339 Ga0495608_0087634
340 Ga0495618_0019770
341 Ga0495618_0022659
342 Ga0495628_0226518
343 Ga0495630_0010983
344 Ga0495630_0201710
345 Ga0495630_0276883
346 Ga0495637_0124174
347 Ga0495666_0007679
348 Ga0495642_0059706
349 Ga0495652_0103327
350 Ga0495665_0018249
351 Ga0495640_0307762
352 Ga0495587_0015295
353 Ga0495667_0002607
354 Ga0495667_0007646
355 Ga0495634_0007800
356 Ga0495634_0021130
357 Ga0495635_0024557
358 Ga0495588_0008864
359 Ga0495657_0005010
360 Ga0495657_0094239
361 Ga0495599_0206296
362 Ga0495647_0009790
363 Ga0495658_0001799
364 Ga0495658_0015971
365 Ga0495613_0003841
366 Ga0495624_0010127
367 Ga0495624_0230201
368 Ga0495600_0002191
369 Ga0495600_0004303
370 Ga0495581_0018086
371 Ga0495604_0005131
372 Ga0495604_0032853
373 Ga0495674_0006439
374 Ga0495674_0040093
375 Ga0495676_0007501
376 Ga0495676_0157673
377 Ga0495680_0015924
378 Ga0495677_0128255
379 Ga0495684_0013927
380 Ga0495684_0283906
381 Ga0495593_0002958
382 Ga0495593_0040089
383 Ga0495602_0463729
384 Ga0495614_0026363
385 Ga0496102_0214354
386 Ga0496105_0042219
387 Ga0496109_0524271
388 Ga0496112_0020594
389 Ga0496112_0104672
390 Ga0496113_0005449
391 Ga0496113_0029851
392 Ga0496113_0082374
393 Ga0496114_0063339
394 Ga0501067_0156647
395 Ga0501067_0261942
396 Ga0501068_0002787
397 Ga0501069_0191812
398 Ga0501207_024258
399 Ga0501217_038270
400 Ga0501081_0144571
401 nmdc:mga05p37_337386_c1
402 nmdc:mga06r32_621232_c1
403 nmdc:mga0n895_226873_c1
404 nmdc:mga08x19_15393_c1
405 Ga0495601_0017141
406 Ga0495595_0070472
407 Ga0495595_0184447
408 Ga0495619_0034264
409 Ga0495619_0057382
410 Ga0466962_0039868

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13649

Methyltransf_25

Methyltransferase domain

53

142

0.91

PF08241

Methyltransf_11

Methyltransferase domain

54

146

0.9

PF08242

Methyltransf_12

Methyltransferase domain

54

144

0.89

PF13847

Methyltransf_31

Methyltransferase domain

47

190

0.88

PF13489

Methyltransf_23

Methyltransferase domain

27

190

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
5gm2-assembly3.cif.gz_O crystal structure of methyltransferase tled complexed with sah and teleocidin a1 0.8925 36 246
5gm2-assembly3.cif.gz_N crystal structure of methyltransferase tled complexed with sah and teleocidin a1 0.8866 36 244
2o57-assembly2.cif.gz_D crystal structure of a putative sarcosine dimethylglycine methyltransferase from galdieria sulphuraria 0.8815 35 245
4kri-assembly2.cif.gz_B haemonchus contortus phospholethanolamine n-methyltransferase 2 in complex with phosphomonomethylethanolamine and s-adenosylhomocysteine 0.8808 36 244
2o57-assembly2.cif.gz_C crystal structure of a putative sarcosine dimethylglycine methyltransferase from galdieria sulphuraria 0.8782 35 246
ID Description Score Start End Superfamily
af_Q4CMB6_37_161_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9366 35 102 3.40.50.150
af_K7KE15_1_124_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9206 38 146 3.40.50.150
af_A0A1D6MBP0_252_453_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8916 36 184 3.40.50.150
af_I1K7G0_44_306_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8887 35 192 3.40.50.150
5gm2M00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8843 36 246 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A4Q5IXL2-F1-model_v4 Methyltransferase domain-containing protein 0.9575 3 246 GO:0008168
GO:0008654
GO:0016020
GO:0016780
GO:0032259
AF-A0A4Q5IXL2-F1-model_v4 Methyltransferase domain-containing protein 0.927 3 246 GO:0008168
GO:0008654
GO:0016020
GO:0016780
GO:0032259
AF-A0A524JIS1-F1-model_v4 Class I SAM-dependent methyltransferase 0.9212 12 246 GO:0008168
GO:0032259
AF-A0A1Q7E7W2-F1-model_v4 Methyltransferase type 11 domain-containing protein 0.9208 15 243 GO:0008757
AF-A0A7V5PGY7-F1-model_v4 Class I SAM-dependent methyltransferase 0.9186 35 146 GO:0008168
GO:0008610
GO:0032259

Map