F313858

General Info

Members Datasets Scaffolds Average Seq Length
205 132 406 68

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_11793180|Ga0157375_117931801
Length 80
Sequence VPHFARKECREMAEQGNVKWFNNAKGYGFIQSEAGGDDVFVHHTAIVSEGFRTLNQGEKVSFEIVEGPKGLQARNVLRGS

Samples

Sample ID Description Type Environment
1 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
57 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
59 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
84 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
85 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
86 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
87 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
88 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
91 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
92 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
93 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
94 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
95 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
96 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
97 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
98 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
99 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
100 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
101 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
102 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
103 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
104 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
105 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
106 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
107 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
108 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
109 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
110 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
111 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
112 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
113 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
114 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
115 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
118 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
119 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
120 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
121 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
122 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
123 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
124 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
125 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
126 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
127 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
128 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
129 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
130 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
131 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
132 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.05
Metatranscriptomes 1.95
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.95
Rhizosphere 93.66
Stem 0
Stem Tuber 0
Unclassified 5.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157375_11793180 3300013308 Bacteria 727
2 CNAas_1005773 3300000532 Bacteria 794
3 rootH1_10180472 3300003323 Bacteria 1629
4 Ga0065707_10678235 3300005295 Bacteria 647
5 Ga0070676_10019358 3300005328 Bacteria 3786
6 Ga0070666_10077800 3300005335 Bacteria 2264
7 Ga0070666_11306097 3300005335 Bacteria 541
8 Ga0070682_100824900 3300005337 Bacteria 755
9 Ga0070689_100430759 3300005340 Unclassified 1119
10 Ga0070668_100447498 3300005347 Bacteria 1110
11 Ga0070669_100000006 3300005353 Bacteria 268982
12 Ga0070669_100802478 3300005353 Bacteria 800
13 Ga0070675_100010761 3300005354 Bacteria 7157
14 Ga0070673_100398032 3300005364 Bacteria 1231
15 Ga0070688_100585508 3300005365 Bacteria 852
16 Ga0070667_100083132 3300005367 Bacteria 2742
17 Ga0070709_10988763 3300005434 Bacteria 669
18 Ga0070710_10008439 3300005437 Bacteria 5014
19 Ga0070710_11534394 3300005437 Bacteria 501
20 Ga0070708_101268589 3300005445 Bacteria 689
21 Ga0070685_10009743 3300005466 Bacteria 4979
22 Ga0070685_10780449 3300005466 Bacteria 703
23 Ga0070698_100407186 3300005471 Bacteria 1294
24 Ga0070698_100407742 3300005471 Bacteria 1293
25 Ga0070698_100627997 3300005471 Bacteria 1015
26 Ga0070699_100560755 3300005518 Bacteria 1040
27 Ga0070699_100942605 3300005518 Bacteria 791
28 Ga0070684_102124873 3300005535 Bacteria 530
29 Ga0070697_101024937 3300005536 Bacteria 734
30 Ga0070686_100821460 3300005544 Bacteria 751
31 Ga0070696_100212528 3300005546 Unclassified 1448
32 Ga0070696_100508940 3300005546 Bacteria 959
33 Ga0070693_100045865 3300005547 Unclassified 2480
34 Ga0070693_100510698 3300005547 Bacteria 854
35 Ga0070665_100000171 3300005548 Bacteria 115314
36 Ga0068857_102052007 3300005577 Bacteria 561
37 Ga0068856_101926542 3300005614 Bacteria 602
38 Ga0068859_100117837 3300005617 Bacteria 2721
39 Ga0068859_102035162 3300005617 Bacteria 634
40 Ga0068860_101028715 3300005843 Bacteria 842
41 Ga0068860_101213832 3300005843 Unclassified 774
42 Ga0068860_102302365 3300005843 Bacteria 559
43 Ga0068862_100001184 3300005844 Bacteria 24564
44 Ga0070716_100012359 3300006173 Bacteria 4326
45 Ga0070712_101666142 3300006175 Unclassified 558
46 Ga0097621_101296058 3300006237 Bacteria 688
47 Ga0075428_100138766 3300006844 Bacteria 2643
48 Ga0075428_100222312 3300006844 Bacteria 2039
49 Ga0075433_10000036 3300006852 Bacteria 53672
50 Ga0075433_10652272 3300006852 Bacteria 923
51 Ga0075433_10803096 3300006852 Bacteria 822
52 Ga0075434_100002500 3300006871 Bacteria 16208
53 Ga0075434_100040974 3300006871 Bacteria 4586
54 Ga0075434_100087226 3300006871 Bacteria 3121
55 Ga0075434_100140516 3300006871 Bacteria 2434
56 Ga0075434_100219357 3300006871 Bacteria 1921
57 Ga0075434_100755688 3300006871 Bacteria 989
58 Ga0075434_100952929 3300006871 Unclassified 873
59 Ga0075429_100461330 3300006880 Bacteria 1113
60 Ga0075436_100003791 3300006914 Bacteria 10367
61 Ga0075436_100005820 3300006914 Bacteria 8463
62 Ga0075436_100013454 3300006914 Bacteria 5602
63 Ga0075436_100019293 3300006914 Bacteria 4672
64 Ga0075436_100465751 3300006914 Bacteria 922
65 Ga0097620_100117837 3300006931 Bacteria 2721
66 Ga0097620_102034582 3300006931 Bacteria 634
67 Ga0075435_100000160 3300007076 Bacteria 38776
68 Ga0075435_100005965 3300007076 Bacteria 8572
69 Ga0105240_10104918 3300009093 Bacteria 3431
70 Ga0111539_11502182 3300009094 Bacteria 781
71 Ga0114129_10487665 3300009147 Bacteria 1612
72 Ga0105241_11264222 3300009174 Bacteria 701
73 Ga0105242_10468196 3300009176 Bacteria 1192
74 Ga0105248_10449435 3300009177 Bacteria 1452
75 Ga0105248_11588249 3300009177 Bacteria 741
76 Ga0105237_11372550 3300009545 Bacteria 713
77 Ga0105249_10187849 3300009553 Bacteria 2015
78 Ga0157374_11099474 3300013296 Bacteria 815
79 Ga0157378_11917241 3300013297 Bacteria 642
80 Ga0157380_11675215 3300014326 Bacteria 693
81 Ga0157380_11704485 3300014326 Bacteria 688
82 Ga0157377_10486387 3300014745 Bacteria 860
83 Ga0157377_11002947 3300014745 Bacteria 632
84 Ga0157376_10926172 3300014969 Bacteria 891
85 Ga0206356_11341727 3300020070 Bacteria 667
86 Ga0206355_1701630 3300020076 Bacteria 507
87 Ga0206354_11667498 3300020081 Bacteria 678
88 Ga0154015_1694041 3300020610 Bacteria 582
89 Ga0207692_10004983 3300025898 Bacteria 5285
90 Ga0207680_10072089 3300025903 Bacteria 2143
91 Ga0207680_10968944 3300025903 Bacteria 609
92 Ga0207699_10741010 3300025906 Bacteria 721
93 Ga0207645_10028685 3300025907 Bacteria 3592
94 Ga0207695_10087210 3300025913 Bacteria 3144
95 Ga0207660_10859167 3300025917 Bacteria 740
96 Ga0207681_10000006 3300025923 Bacteria 496979
97 Ga0207659_10145663 3300025926 Bacteria 1844
98 Ga0207686_10411553 3300025934 Bacteria 1032
99 Ga0207665_10172377 3300025939 Bacteria 1563
100 Ga0207665_10234848 3300025939 Bacteria 1349
101 Ga0207711_10148133 3300025941 Bacteria 2116
102 Ga0207651_10469858 3300025960 Bacteria 1082
103 Ga0207712_10602827 3300025961 Bacteria 950
104 Ga0207668_10638479 3300025972 Bacteria 931
105 Ga0207658_10214887 3300025986 Bacteria 1614
106 Ga0207708_11070256 3300026075 Bacteria 702
107 Ga0207675_100655535 3300026118 Bacteria 1056
108 Ga0207675_100764350 3300026118 Bacteria 978
109 Ga0207675_101559849 3300026118 Bacteria 681
110 Ga0210002_1056872 3300027617 Bacteria 679
111 Ga0209971_1019068 3300027682 Bacteria 1629
112 Ga0209998_10016937 3300027717 Bacteria 1537
113 Ga0209974_10003701 3300027876 Bacteria 5494
114 Ga0268266_10000669 3300028379 Bacteria 46196
115 Ga0268265_10000248 3300028380 Bacteria 61738
116 Ga0268264_11254041 3300028381 Bacteria 751
117 Ga0265328_10036692 3300031239 Bacteria 1811
118 Ga0307509_10186343 3300031507 Bacteria 1933
119 Ga0307508_10037148 3300031616 Bacteria 4382
120 Ga0307508_10142651 3300031616 Bacteria 1999
121 Ga0316576_10029910 3300031727 Unclassified 3853
122 Ga0316576_11127173 3300031727 Bacteria 556
123 Ga0316578_10085215 3300031728 Bacteria 1883
124 Ga0316577_10610680 3300031733 Bacteria 620
125 Ga0307416_102716444 3300032002 Bacteria 592
126 Ga0316583_10127663 3300032133 Bacteria 886
127 Ga0373959_0000214 3300034820 Bacteria 12721
128 Ga0373929_0183711 3300035085 Bacteria 578
129 Ga0373951_0263936 3300035091 Bacteria 521
130 Ga0373941_0081062 3300035115 Bacteria 1096
131 Ga0373954_0114935 3300035118 Bacteria 1304
132 Ga0373961_0001417 3300035241 Bacteria 7138
133 Ga0373935_0042113 3300035692 Bacteria 2871
134 Ga0373937_1164105 3300036401 Unclassified 720
135 Ga0400485_20791 3300038735 Bacteria 9104
136 Ga0400483_173823 3300039062 Bacteria 5066
137 Ga0451807_0857039 3300041486 Bacteria 854
138 Ga0451839_0269773 3300041496 Bacteria 617
139 Ga0451849_1541425 3300041505 Bacteria 975
140 Ga0451855_1225407 3300041511 Bacteria 566
141 Ga0451577_0000029 3300042876 Bacteria 395301
142 Ga0451577_0340829 3300042876 Bacteria 1359
143 Ga0451577_0435207 3300042876 Bacteria 1191
144 Ga0451577_0678713 3300042876 Bacteria 934
145 Ga0451577_0777708 3300042876 Bacteria 865
146 Ga0451577_0885641 3300042876 Bacteria 804
147 Ga0451577_1311550 3300042876 Unclassified 644
148 Ga0451577_1785090 3300042876 Bacteria 540
149 Ga0453683_0009848 3300044673 Bacteria 6368
150 Ga0453683_0048314 3300044673 Bacteria 2669
151 Ga0466963_0185350 3300044694 Bacteria 1453
152 Ga0453684_0000088 3300044712 Bacteria 395200
153 Ga0453684_0072476 3300044712 Bacteria 4348
154 Ga0453684_0245546 3300044712 Bacteria 2059
155 Ga0453684_0325637 3300044712 Bacteria 1739
156 Ga0453684_0563209 3300044712 Bacteria 1253
157 Ga0453684_0668348 3300044712 Bacteria 1132
158 Ga0453684_0751557 3300044712 Bacteria 1055
159 Ga0453684_1502442 3300044712 Bacteria 695
160 Ga0451576_0024348 3300045051 Bacteria 6539
161 Ga0451576_0306461 3300045051 Bacteria 1661
162 Ga0451576_0677499 3300045051 Bacteria 1083
163 Ga0451576_1137226 3300045051 Bacteria 816
164 Ga0495632_0388348 3300046519 Bacteria 611
165 Ga0495636_0104399 3300047318 Unclassified 1242
166 Ga0495615_0258960 3300048090 Bacteria 553
167 Ga0496105_0047251 3300048908 Bacteria 3552
168 Ga0496110_1884624 3300048913 Bacteria 508
169 Ga0496114_0000032 3300048917 Bacteria 167029
170 Ga0501034_0581343 3300049571 Unclassified 1027
171 Ga0501067_0005561 3300049583 Bacteria 6986
172 Ga0501068_0002934 3300049584 Bacteria 9086
173 Ga0501068_1026617 3300049584 Bacteria 544
174 Ga0501073_0221232 3300049589 Bacteria 1308
175 Ga0501074_1229356 3300049590 Bacteria 525
176 Ga0501075_0000137 3300049591 Bacteria 36390
177 Ga0501077_0000482 3300049593 Bacteria 24191
178 Ga0501080_0003014 3300049742 Bacteria 14840
179 Ga0501083_0001054 3300049744 Bacteria 18377
180 nmdc:mga05p37_490814_c1 3300050507 Bacteria 1412
181 nmdc:mga09592_1282110_c1 3300050508 Bacteria 603
182 nmdc:mga0n895_137601_c1 3300050512 Bacteria 2470
183 nmdc:mga0n895_138212_c1 3300050512 Bacteria 2464
184 nmdc:mga0n895_2214631_c1 3300050512 Bacteria 505
185 nmdc:mga0n895_244858_c1 3300050512 Bacteria 1820
186 nmdc:mga0n895_284827_c1 3300050512 Bacteria 1676
187 nmdc:mga0n895_458514_c1 3300050512 Bacteria 1287
188 nmdc:mga0n895_885433_c1 3300050512 Unclassified 879
189 nmdc:mga0rr50_11220_c1 3300050513 Bacteria 5721
190 nmdc:mga0rr50_1392_c1 3300050513 Bacteria 13242
191 nmdc:mga0rr50_291035_c1 3300050513 Bacteria 1365
192 nmdc:mga0rr50_91490_c1 3300050513 Bacteria 2370
193 nmdc:mga0rr50_96350_c1 3300050513 Bacteria 2315
194 nmdc:mga08x19_1415_c1 3300050514 Bacteria 13298
195 nmdc:mga08x19_296422_c1 3300050514 Bacteria 1123
196 nmdc:mga08x19_372_c1 3300050514 Bacteria 31585
197 nmdc:mga08x19_74661_c1 3300050514 Bacteria 2216
198 nmdc:mga0a205_1349137_c1 3300050515 Bacteria 561
199 nmdc:mga0a205_2527_c1 3300050515 Bacteria 16118
200 nmdc:mga0a205_671656_c1 3300050515 Bacteria 887
201 Ga0501082_0000095 3300060353 Bacteria 68309
202 Ga0530510_0113772 3300061734 Bacteria 1983
203 Ga0530510_0510447 3300061734 Bacteria 911
204 Ga0157375_11793180
205 CNAas_1005773
206 rootH1_10180472
207 Ga0065707_10678235
208 Ga0070676_10019358
209 Ga0070666_10077800
210 Ga0070666_11306097
211 Ga0070682_100824900
212 Ga0070689_100430759
213 Ga0070668_100447498
214 Ga0070669_100000006
215 Ga0070669_100802478
216 Ga0070675_100010761
217 Ga0070673_100398032
218 Ga0070688_100585508
219 Ga0070667_100083132
220 Ga0070709_10988763
221 Ga0070710_10008439
222 Ga0070710_11534394
223 Ga0070708_101268589
224 Ga0070685_10009743
225 Ga0070685_10780449
226 Ga0070698_100407186
227 Ga0070698_100407742
228 Ga0070698_100627997
229 Ga0070699_100560755
230 Ga0070699_100942605
231 Ga0070684_102124873
232 Ga0070697_101024937
233 Ga0070686_100821460
234 Ga0070696_100212528
235 Ga0070696_100508940
236 Ga0070693_100045865
237 Ga0070693_100510698
238 Ga0070665_100000171
239 Ga0068857_102052007
240 Ga0068856_101926542
241 Ga0068859_100117837
242 Ga0068859_102035162
243 Ga0068860_101028715
244 Ga0068860_101213832
245 Ga0068860_102302365
246 Ga0068862_100001184
247 Ga0070716_100012359
248 Ga0070712_101666142
249 Ga0097621_101296058
250 Ga0075428_100138766
251 Ga0075428_100222312
252 Ga0075433_10000036
253 Ga0075433_10652272
254 Ga0075433_10803096
255 Ga0075434_100002500
256 Ga0075434_100040974
257 Ga0075434_100087226
258 Ga0075434_100140516
259 Ga0075434_100219357
260 Ga0075434_100755688
261 Ga0075434_100952929
262 Ga0075429_100461330
263 Ga0075436_100003791
264 Ga0075436_100005820
265 Ga0075436_100013454
266 Ga0075436_100019293
267 Ga0075436_100465751
268 Ga0097620_100117837
269 Ga0097620_102034582
270 Ga0075435_100000160
271 Ga0075435_100005965
272 Ga0105240_10104918
273 Ga0111539_11502182
274 Ga0114129_10487665
275 Ga0105241_11264222
276 Ga0105242_10468196
277 Ga0105248_10449435
278 Ga0105248_11588249
279 Ga0105237_11372550
280 Ga0105249_10187849
281 Ga0157374_11099474
282 Ga0157378_11917241
283 Ga0157380_11675215
284 Ga0157380_11704485
285 Ga0157377_10486387
286 Ga0157377_11002947
287 Ga0157376_10926172
288 Ga0206356_11341727
289 Ga0206355_1701630
290 Ga0206354_11667498
291 Ga0154015_1694041
292 Ga0207692_10004983
293 Ga0207680_10072089
294 Ga0207680_10968944
295 Ga0207699_10741010
296 Ga0207645_10028685
297 Ga0207695_10087210
298 Ga0207660_10859167
299 Ga0207681_10000006
300 Ga0207659_10145663
301 Ga0207686_10411553
302 Ga0207665_10172377
303 Ga0207665_10234848
304 Ga0207711_10148133
305 Ga0207651_10469858
306 Ga0207712_10602827
307 Ga0207668_10638479
308 Ga0207658_10214887
309 Ga0207708_11070256
310 Ga0207675_100655535
311 Ga0207675_100764350
312 Ga0207675_101559849
313 Ga0210002_1056872
314 Ga0209971_1019068
315 Ga0209998_10016937
316 Ga0209974_10003701
317 Ga0268266_10000669
318 Ga0268265_10000248
319 Ga0268264_11254041
320 Ga0265328_10036692
321 Ga0307509_10186343
322 Ga0307508_10037148
323 Ga0307508_10142651
324 Ga0316576_10029910
325 Ga0316576_11127173
326 Ga0316578_10085215
327 Ga0316577_10610680
328 Ga0307416_102716444
329 Ga0316583_10127663
330 Ga0373959_0000214
331 Ga0373929_0183711
332 Ga0373951_0263936
333 Ga0373941_0081062
334 Ga0373954_0114935
335 Ga0373961_0001417
336 Ga0373935_0042113
337 Ga0373937_1164105
338 Ga0400485_20791
339 Ga0400483_173823
340 Ga0451807_0857039
341 Ga0451839_0269773
342 Ga0451849_1541425
343 Ga0451855_1225407
344 Ga0451577_0000029
345 Ga0451577_0340829
346 Ga0451577_0435207
347 Ga0451577_0678713
348 Ga0451577_0777708
349 Ga0451577_0885641
350 Ga0451577_1311550
351 Ga0451577_1785090
352 Ga0453683_0009848
353 Ga0453683_0048314
354 Ga0466963_0185350
355 Ga0453684_0000088
356 Ga0453684_0072476
357 Ga0453684_0245546
358 Ga0453684_0325637
359 Ga0453684_0563209
360 Ga0453684_0668348
361 Ga0453684_0751557
362 Ga0453684_1502442
363 Ga0451576_0024348
364 Ga0451576_0306461
365 Ga0451576_0677499
366 Ga0451576_1137226
367 Ga0495632_0388348
368 Ga0495636_0104399
369 Ga0495615_0258960
370 Ga0496105_0047251
371 Ga0496110_1884624
372 Ga0496114_0000032
373 Ga0501034_0581343
374 Ga0501067_0005561
375 Ga0501068_0002934
376 Ga0501068_1026617
377 Ga0501073_0221232
378 Ga0501074_1229356
379 Ga0501075_0000137
380 Ga0501077_0000482
381 Ga0501080_0003014
382 Ga0501083_0001054
383 nmdc:mga05p37_490814_c1
384 nmdc:mga09592_1282110_c1
385 nmdc:mga0n895_137601_c1
386 nmdc:mga0n895_138212_c1
387 nmdc:mga0n895_2214631_c1
388 nmdc:mga0n895_244858_c1
389 nmdc:mga0n895_284827_c1
390 nmdc:mga0n895_458514_c1
391 nmdc:mga0n895_885433_c1
392 nmdc:mga0rr50_11220_c1
393 nmdc:mga0rr50_1392_c1
394 nmdc:mga0rr50_291035_c1
395 nmdc:mga0rr50_91490_c1
396 nmdc:mga0rr50_96350_c1
397 nmdc:mga08x19_1415_c1
398 nmdc:mga08x19_296422_c1
399 nmdc:mga08x19_372_c1
400 nmdc:mga08x19_74661_c1
401 nmdc:mga0a205_1349137_c1
402 nmdc:mga0a205_2527_c1
403 nmdc:mga0a205_671656_c1
404 Ga0501082_0000095
405 Ga0530510_0113772
406 Ga0530510_0510447

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00313

CSD

'Cold-shock' DNA-binding domain

14

78

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mjc-assembly1.cif.gz_A crystal structure of cspa, the major cold shock protein of escherichia coli 0.985 2 68
1hza-assembly1.cif.gz_B bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability 0.9786 3 68
3i2z-assembly2.cif.gz_B structure of cold shock protein e from salmonella typhimurium 0.978 3 68
8h1i-assembly1.cif.gz_B crystal structure of plygrcs, a bacteriophage endolysin in complex with cold shock protein c 0.9725 1 68
1c9o-assembly1.cif.gz_B crystal structure analysis of the bacillus caldolyticus cold shock protein bc-csp 0.9707 3 68
ID Description Score Start End Superfamily
af_Q94C69_1_75_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9731 2 65 2.40.50.140
af_P92186_48_133_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.968 1 65 2.40.50.140
af_Q9VRN5_36_116_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9671 1 68 2.40.50.140
af_I1LPN7_1_82_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9618 1 65 2.40.50.140
af_P91306_55_138_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9576 2 65 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A511TFR2-F1-model_v4 Cold-shock protein 1.009 3 68 GO:0003676
GO:0005737
AF-A0A495UUC4-F1-model_v4 deleted 1.009 2 68
AF-A0A540X0A1-F1-model_v4 Cold-shock protein 1.009 3 68 GO:0003676
GO:0005737
AF-A0A1H6AJ04-F1-model_v4 Cold-shock DNA-binding protein family 1.009 3 65 GO:0003677
GO:0005737
AF-A0A4Q7M379-F1-model_v4 Putative cold-shock DNA-binding protein 1.008 2 68 GO:0003677
GO:0005737

Map