F313853

General Info

Members Datasets Scaffolds Average Seq Length
205 142 204 364

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10000236|Ga0157375_1000023645
Length 420
Sequence MDTQLTGTDRAHLMRALELAERGRGRVSPNPLVGAVIVRDGAVVGEGFHAELGELHAERAALADCAGRGEDPRGATMYVTLEPCAHHGRQPPCVDAILEAGISRVVIASEDPSEKAAGRGPGMLRDGEVEVEFAAGEEATAARLLNQPFRKHARTGLPLVTLKLAMSLDGQTETAPGDSPWISGPESQQLVHRWRAESDAIAVGIGTVLADDPLLTARPAASGALLPPIGDEKRTGSDLRQPLRVVFDRQARLPLDSQLLQTLDVSPVVVVVSQHADAQXXXALRDAGAEILVADDIEAALSDLGRRGITSLFLEGGRTLASAFLGSLAVDASRTFIAPVLLGENPSRAGGTAAGAPHNGGRGKAASEHMGEGRRDRTRAPSPPQAKNPASGRGAPGPALHHTVEEIGEDVLITARFKEW

Samples

Sample ID Description Type Environment
1 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
40 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
41 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
42 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
62 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
63 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
64 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
65 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
66 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
67 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
68 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
69 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
70 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
71 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
72 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
73 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
74 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
75 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
76 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
77 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
78 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
79 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
80 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
81 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
82 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
83 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
84 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
85 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
86 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
87 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
88 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
89 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
90 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
91 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
92 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
93 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
94 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
95 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
96 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
97 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
98 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
99 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
100 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
101 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
102 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
103 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
104 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
105 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
106 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
107 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
108 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
109 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
110 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
111 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
112 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
113 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
114 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
115 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
119 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
120 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
121 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
122 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
123 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
124 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
125 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
126 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
127 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
128 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
129 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
130 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
131 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
134 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
135 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
136 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
137 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
138 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
139 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
140 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
141 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
142 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0
Isolates 0.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.39
Nodule 0
Rhizoplane 16.1
Rhizosphere 76.1
Stem 0
Stem Tuber 0
Unclassified 3.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1000187 3300002074 Bacteria 8001
2 JGI24034J26672_10000176 3300002239 Bacteria 8785
3 Ga0070683_100062390 3300005329 Bacteria 3466
4 Ga0070683_100071437 3300005329 Bacteria 3239
5 Ga0070677_10000344 3300005333 Bacteria 16239
6 Ga0070682_100029384 3300005337 Bacteria 3309
7 Ga0068868_100000026 3300005338 Bacteria 81980
8 Ga0068868_100013301 3300005338 Bacteria 6031
9 Ga0070668_100074881 3300005347 Bacteria 2642
10 Ga0070674_100052939 3300005356 Bacteria 2801
11 Ga0070701_10068809 3300005438 Bacteria 1887
12 Ga0070711_100007530 3300005439 Bacteria 6628
13 Ga0070694_100158267 3300005444 Bacteria 1660
14 Ga0070678_100004389 3300005456 Bacteria 7990
15 Ga0068867_100000955 3300005459 Bacteria 19672
16 Ga0070684_100038698 3300005535 Bacteria 4099
17 Ga0070684_100081891 3300005535 Bacteria 2857
18 Ga0070686_100074671 3300005544 Bacteria 2229
19 Ga0070704_100054900 3300005549 Bacteria 2822
20 Ga0068866_10019865 3300005718 Bacteria 3067
21 Ga0068861_100054102 3300005719 Bacteria 3057
22 Ga0068861_100057287 3300005719 Bacteria 2976
23 Ga0068858_100157420 3300005842 Bacteria 2138
24 Ga0068860_100301726 3300005843 Bacteria 1569
25 Ga0081538_10000103 3300005981 Bacteria 83685
26 Ga0081538_10012482 3300005981 Bacteria 6807
27 Ga0070717_10145408 3300006028 Bacteria 2047
28 Ga0075365_10000681 3300006038 Bacteria 13645
29 Ga0075365_10000974 3300006038 Bacteria 12194
30 Ga0075364_10001605 3300006051 Bacteria 12371
31 Ga0075364_10020821 3300006051 Bacteria 4128
32 Ga0070715_10000001 3300006163 Bacteria 693690
33 Ga0070712_100013249 3300006175 Bacteria 5265
34 Ga0070712_100021728 3300006175 Bacteria 4219
35 Ga0075367_10029259 3300006178 Bacteria 3150
36 Ga0075430_100032765 3300006846 Bacteria 4410
37 Ga0075431_100000832 3300006847 Bacteria 26974
38 Ga0075431_100060355 3300006847 Bacteria 3913
39 Ga0075433_10043090 3300006852 Bacteria 3917
40 Ga0075433_10188807 3300006852 Bacteria 1833
41 Ga0075434_100005700 3300006871 Bacteria 11373
42 Ga0075434_100048551 3300006871 Bacteria 4211
43 Ga0068865_100000278 3300006881 Bacteria 28227
44 Ga0111539_10002660 3300009094 Bacteria 23683
45 Ga0111539_10254959 3300009094 Bacteria 2043
46 Ga0105245_10000336 3300009098 Bacteria 44275
47 Ga0105245_10003973 3300009098 Bacteria 13150
48 Ga0114129_10030557 3300009147 Bacteria 7622
49 Ga0114129_10319154 3300009147 Bacteria 2065
50 Ga0157371_10007405 3300013102 Bacteria 8893
51 Ga0157375_10000236 3300013308 Bacteria 51196
52 Ga0157379_10079226 3300014968 Bacteria 2942
53 Ga0163161_10088873 3300017792 Bacteria 2284
54 Ga0213876_10005793 3300021384 Bacteria 6763
55 Ga0213876_10012781 3300021384 Bacteria 4463
56 Ga0207682_10000013 3300025893 Bacteria 83196
57 Ga0207642_10011868 3300025899 Bacteria 3125
58 Ga0207688_10127249 3300025901 Bacteria 1491
59 Ga0207685_10000005 3300025905 Bacteria 289944
60 Ga0207685_10065742 3300025905 Bacteria 1453
61 Ga0207693_10032219 3300025915 Bacteria 4137
62 Ga0207663_10035757 3300025916 Bacteria 2983
63 Ga0207687_10000013 3300025927 Bacteria 299826
64 Ga0207687_10015802 3300025927 Bacteria 4954
65 Ga0207706_10000001 3300025933 Bacteria 423014
66 Ga0207669_10018757 3300025937 Bacteria 3586
67 Ga0207704_10000224 3300025938 Bacteria 28226
68 Ga0207665_10082856 3300025939 Bacteria 2211
69 Ga0207661_10049820 3300025944 Bacteria 3335
70 Ga0207712_10000019 3300025961 Bacteria 317060
71 Ga0207668_10065399 3300025972 Bacteria 2574
72 Ga0207677_10000106 3300026023 Bacteria 68108
73 Ga0207703_10155530 3300026035 Bacteria 1998
74 Ga0207648_10006982 3300026089 Bacteria 11169
75 Ga0207675_100085093 3300026118 Bacteria 2967
76 Ga0207683_10012735 3300026121 Bacteria 7178
77 Ga0265327_10000231 3300031251 Bacteria 113114
78 Ga0307410_10044418 3300031852 Bacteria 2952
79 Ga0307409_100011355 3300031995 Bacteria 5609
80 Ga0373943_0036867 3300035170 Bacteria 2344
81 Ga0373931_0102527 3300035691 Bacteria 1611
82 Ga0373927_0023552 3300035695 Bacteria 4032
83 Ga0373947_0168191 3300035725 Bacteria 1421
84 Ga0373937_0017071 3300036401 Bacteria 6456
85 Ga0395899_0151049 3300037312 Bacteria 1646
86 Ga0395900_0029855 3300037418 Bacteria 5595
87 Ga0395900_0038172 3300037418 Bacteria 4952
88 Ga0395900_0308279 3300037418 Bacteria 1567
89 Ga0395898_0001837 3300037466 Bacteria 27315
90 Ga0395898_0009591 3300037466 Bacteria 10166
91 Ga0395905_0012629 3300037471 Bacteria 8126
92 Ga0395905_0019380 3300037471 Bacteria 6449
93 Ga0436364_0500128 3300037853 Bacteria 4730
94 Ga0436364_0885640 3300037853 Bacteria 2775
95 Ga0395901_0028487 3300038443 Bacteria 5743
96 Ga0395901_0037321 3300038443 Bacteria 5025
97 Ga0395901_0203232 3300038443 Bacteria 2076
98 Ga0436365_1132967 3300039437 Bacteria 7496
99 Ga0436361_0421378 3300039447 Bacteria 2337
100 Ga0466965_0008933 3300044683 Bacteria 4647
101 Ga0466963_0004174 3300044694 Bacteria 8363
102 Ga0466963_0007696 3300044694 Bacteria 6435
103 Ga0466963_0009981 3300044694 Bacteria 5738
104 Ga0466963_0052028 3300044694 Bacteria 2716
105 Ga0466968_0006030 3300044735 Bacteria 4549
106 Ga0466968_0028233 3300044735 Bacteria 2313
107 Ga0466957_0004062 3300044842 Bacteria 8099
108 Ga0466960_0042300 3300044901 Bacteria 2163
109 Ga0466960_0166580 3300044901 Bacteria 1187
110 Ga0466959_0215536 3300045049 Bacteria 1333
111 Ga0466958_0004963 3300045836 Bacteria 7096
112 Ga0466967_0003691 3300045976 Bacteria 10078
113 Ga0466967_0010118 3300045976 Bacteria 7052
114 Ga0466967_0025464 3300045976 Bacteria 4880
115 Ga0466967_0100754 3300045976 Bacteria 2639
116 Ga0466967_0104029 3300045976 Bacteria 2598
117 Ga0495592_0098922 3300046454 Bacteria 2082
118 Ga0495641_0008726 3300046461 Bacteria 6126
119 Ga0495662_0007830 3300046476 Bacteria 5259
120 Ga0495594_0008605 3300046499 Bacteria 5260
121 Ga0495608_0173565 3300046511 Bacteria 1366
122 Ga0495628_0003282 3300046516 Bacteria 14470
123 Ga0495630_0080143 3300046517 Bacteria 2463
124 Ga0495652_0010528 3300046529 Bacteria 8379
125 Ga0495645_0050318 3300046543 Bacteria 3034
126 Ga0495613_0000083 3300046689 Bacteria 90138
127 Ga0495613_0075641 3300046689 Bacteria 2451
128 Ga0495624_0000024 3300046690 Bacteria 98577
129 Ga0495600_0052010 3300046809 Bacteria 2674
130 Ga0495604_0017461 3300047317 Bacteria 5745
131 Ga0495674_0000019 3300047319 Bacteria 185107
132 Ga0495674_0026866 3300047319 Bacteria 5265
133 Ga0495674_0065294 3300047319 Bacteria 3162
134 Ga0495680_0035984 3300047322 Bacteria 3981
135 Ga0496101_0000025 3300048904 Bacteria 205204
136 Ga0496101_0003534 3300048904 Bacteria 9750
137 Ga0496102_0048449 3300048905 Bacteria 3863
138 Ga0496103_0002822 3300048906 Bacteria 10804
139 Ga0496104_0000062 3300048907 Bacteria 117255
140 Ga0496104_0089278 3300048907 Bacteria 2945
141 Ga0496104_0301125 3300048907 Bacteria 1515
142 Ga0496105_0000069 3300048908 Bacteria 80917
143 Ga0496105_0018531 3300048908 Bacteria 5599
144 Ga0496105_0035362 3300048908 Bacteria 4111
145 Ga0496105_0055580 3300048908 Bacteria 3268
146 Ga0496106_0000012 3300048909 Bacteria 205158
147 Ga0496106_0012570 3300048909 Bacteria 6251
148 Ga0496107_0000010 3300048910 Bacteria 205188
149 Ga0496107_0001742 3300048910 Bacteria 13690
150 Ga0496108_0001524 3300048911 Bacteria 18334
151 Ga0496108_0010280 3300048911 Bacteria 7596
152 Ga0496108_0046258 3300048911 Bacteria 3636
153 Ga0496109_0000004 3300048912 Bacteria 404818
154 Ga0496109_0000172 3300048912 Bacteria 64023
155 Ga0496109_0031997 3300048912 Bacteria 4725
156 Ga0496110_0038829 3300048913 Bacteria 4144
157 Ga0496112_0000013 3300048915 Bacteria 237194
158 Ga0496112_0101792 3300048915 Bacteria 2842
159 Ga0496113_0007837 3300048916 Bacteria 6902
160 Ga0496113_0051854 3300048916 Bacteria 3062
161 Ga0496114_0000133 3300048917 Bacteria 53994
162 Ga0496114_0007170 3300048917 Bacteria 8795
163 Ga0496114_0013671 3300048917 Bacteria 6508
164 Ga0496115_0000506 3300048918 Bacteria 30541
165 Ga0496115_0001513 3300048918 Bacteria 16703
166 Ga0496115_0018960 3300048918 Bacteria 5292
167 Ga0496115_0127297 3300048918 Bacteria 2098
168 Ga0496119_0004007 3300048922 Bacteria 14900
169 Ga0501031_0061237 3300049568 Bacteria 2453
170 Ga0501034_0160018 3300049571 Bacteria 2223
171 Ga0501040_0057825 3300049576 Bacteria 2663
172 Ga0501068_0067802 3300049584 Bacteria 2175
173 Ga0501070_0063752 3300049586 Bacteria 3052
174 Ga0501072_0015204 3300049588 Bacteria 5900
175 Ga0501075_0029770 3300049591 Bacteria 4039
176 Ga0501075_0107522 3300049591 Bacteria 2120
177 Ga0501076_0087582 3300049592 Bacteria 2503
178 Ga0501076_0190971 3300049592 Bacteria 1671
179 Ga0501077_0034850 3300049593 Bacteria 3204
180 Ga0501079_0007202 3300049741 Bacteria 8398
181 Ga0501081_0038319 3300049743 Bacteria 3274
182 Ga0501045_0009157 3300049824 Bacteria 6918
183 Ga0501045_0010585 3300049824 Bacteria 6461
184 nmdc:mga0yw44_15550_c1 3300050492 Bacteria 4080
185 nmdc:mga06z11_26247_c1 3300050494 Bacteria 2770
186 nmdc:mga05p37_21224_c1 3300050507 Bacteria 7861
187 nmdc:mga0qj67_55852_c1 3300050509 Bacteria 3129
188 nmdc:mga06r32_1573_c1 3300050510 Bacteria 20560
189 nmdc:mga08y16_6839_c1 3300050511 Bacteria 11957
190 nmdc:mga0a205_204327_c1 3300050515 Bacteria 1865
191 nmdc:mga0a205_27021_c1 3300050515 Bacteria 5479
192 Ga0495601_0000703 3300053077 Bacteria 17935
193 Ga0495612_0000022 3300053078 Bacteria 119126
194 Ga0495619_0008854 3300053085 Bacteria 6363
195 Ga0495619_0009968 3300053085 Bacteria 5984
196 Ga0495619_0109287 3300053085 Bacteria 1888
197 Ga0500641_0005373 3300053096 Bacteria 4539
198 Ga0500614_000781 3300053123 Bacteria 8078
199 Ga0501084_0005497 3300054114 Bacteria 10403
200 Ga0501084_0034396 3300054114 Bacteria 4238
201 Ga0501082_0014463 3300060353 Bacteria 6793
202 Ga0466962_0097890 3300061719 Bacteria 1407
203 Ga0530510_0012715 3300061734 Bacteria 5917
204 Ga0530510_0014727 3300061734 Bacteria 5522

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047319 Ga0495674_0026866 Ga0495674_0026866_2057_3253 278
2 3300053078 Ga0495612_0000022 Ga0495612_0000022_109586_110782 278
3 3300031251 Ga0265327_10000231 Ga0265327_10000231100 281
4 3300045976 Ga0466967_0010118 Ga0466967_0010118_2883_3938 281
5 3300046511 Ga0495608_0173565 Ga0495608_0173565_400_1341 297
6 3300048911 Ga0496108_0010280 Ga0496108_0010280_5832_6929 300
7 3300044694 Ga0466963_0004174 Ga0466963_0004174_2241_3296 302
8 3300044694 Ga0466963_0052028 Ga0466963_0052028_1352_2407 302
9 3300044735 Ga0466968_0028233 Ga0466968_0028233_784_1839 302
10 3300044842 Ga0466957_0004062 Ga0466957_0004062_2249_3304 302
11 3300044901 Ga0466960_0042300 Ga0466960_0042300_241_1296 302
12 3300045976 Ga0466967_0003691 Ga0466967_0003691_4033_5088 302
13 3300045976 Ga0466967_0104029 Ga0466967_0104029_1480_2535 302
14 3300061719 Ga0466962_0097890 Ga0466962_0097890_306_1361 302
15 3300035695 Ga0373927_0023552 Ga0373927_0023552_2459_3562 304
16 3300005981 Ga0081538_10012482 Ga0081538_100124822 305
17 3300006846 Ga0075430_100032765 Ga0075430_1000327652 308
18 3300050509 nmdc:mga0qj67_55852_c1 nmdc:mga0qj67_55852_c1_346_1377 308
19 3300037312 Ga0395899_0151049 Ga0395899_0151049_327_1451 311
20 3300037418 Ga0395900_0038172 Ga0395900_0038172_423_1547 311
21 3300037466 Ga0395898_0001837 Ga0395898_0001837_25252_26376 311
22 3300037471 Ga0395905_0012629 Ga0395905_0012629_6619_7743 311
23 3300038443 Ga0395901_0037321 Ga0395901_0037321_1977_3101 311
24 3300005333 Ga0070677_10000344 Ga0070677_1000034410 312
25 3300005535 Ga0070684_100038698 Ga0070684_1000386984 312
26 3300025893 Ga0207682_10000013 Ga0207682_1000001372 312
27 3300048904 Ga0496101_0000025 Ga0496101_0000025_93064_94071 312
28 3300048909 Ga0496106_0000012 Ga0496106_0000012_111106_112113 312
29 3300048910 Ga0496107_0000010 Ga0496107_0000010_111118_112125 312
30 3300053123 Ga0500614_000781 Ga0500614_000781_2339_3382 312
31 3300049571 Ga0501034_0160018 Ga0501034_0160018_226_1428 314
32 3300053096 Ga0500641_0005373 Ga0500641_0005373_565_1671 315
33 3300035691 Ga0373931_0102527 Ga0373931_0102527_204_1292 316
34 3300048913 Ga0496110_0038829 Ga0496110_0038829_272_1396 316
35 3300044683 Ga0466965_0008933 Ga0466965_0008933_697_1818 317
36 3300044735 Ga0466968_0006030 Ga0466968_0006030_2184_3305 317
37 3300006852 Ga0075433_10043090 Ga0075433_100430903 318
38 3300048915 Ga0496112_0000013 Ga0496112_0000013_203818_204930 318
39 3300050515 nmdc:mga0a205_27021_c1 nmdc:mga0a205_27021_c1_2118_3266 318
40 3300005842 Ga0068858_100157420 Ga0068858_1001574202 319
41 3300006871 Ga0075434_100048551 Ga0075434_1000485512 319
42 3300026035 Ga0207703_10155530 Ga0207703_101555302 319
43 3300048907 Ga0496104_0000062 Ga0496104_0000062_47854_48957 319
44 3300048907 Ga0496104_0089278 Ga0496104_0089278_1220_2323 319
45 3300048908 Ga0496105_0000069 Ga0496105_0000069_11516_12619 319
46 3300048908 Ga0496105_0018531 Ga0496105_0018531_2671_3774 319
47 3300048908 Ga0496105_0055580 Ga0496105_0055580_1231_2334 319
48 3300048911 Ga0496108_0046258 Ga0496108_0046258_1713_2816 319
49 3300048916 Ga0496113_0051854 Ga0496113_0051854_909_2042 319
50 3300048917 Ga0496114_0013671 Ga0496114_0013671_4457_5560 319
51 3300048918 Ga0496115_0018960 Ga0496115_0018960_1150_2253 319
52 3300048918 Ga0496115_0127297 Ga0496115_0127297_356_1459 319
53 3300048922 Ga0496119_0004007 Ga0496119_0004007_718_1821 319
54 3300053085 Ga0495619_0109287 Ga0495619_0109287_412_1515 319
55 3300006028 Ga0070717_10145408 Ga0070717_101454083 320
56 3300006175 Ga0070712_100013249 Ga0070712_1000132494 320
57 3300035170 Ga0373943_0036867 Ga0373943_0036867_871_1989 320
58 3300035725 Ga0373947_0168191 Ga0373947_0168191_379_1395 320
59 3300039447 Ga0436361_0421378 Ga0436361_0421378_1181_2287 320
60 3300046499 Ga0495594_0008605 Ga0495594_0008605_3912_5048 320
61 3300046517 Ga0495630_0080143 Ga0495630_0080143_1151_2269 320
62 3300046689 Ga0495613_0075641 Ga0495613_0075641_508_1626 320
63 3300047319 Ga0495674_0065294 Ga0495674_0065294_125_1243 320
64 3300047322 Ga0495680_0035984 Ga0495680_0035984_850_1956 320
65 3300053077 Ga0495601_0000703 Ga0495601_0000703_15908_17026 320
66 3300053085 Ga0495619_0009968 Ga0495619_0009968_131_1237 320
67 iso_pu_bacteria 2842698319 2842698745 320
68 3300021384 Ga0213876_10005793 Ga0213876_100057935 321
69 3300044694 Ga0466963_0009981 Ga0466963_0009981_4252_5391 322
70 3300005337 Ga0070682_100029384 Ga0070682_1000293843 323
71 3300005338 Ga0068868_100013301 Ga0068868_1000133012 323
72 3300005356 Ga0070674_100052939 Ga0070674_1000529393 323
73 3300005438 Ga0070701_10068809 Ga0070701_100688092 323
74 3300005439 Ga0070711_100007530 Ga0070711_1000075307 323
75 3300005544 Ga0070686_100074671 Ga0070686_1000746712 323
76 3300005549 Ga0070704_100054900 Ga0070704_1000549001 323
77 3300005843 Ga0068860_100301726 Ga0068860_1003017261 323
78 3300006175 Ga0070712_100021728 Ga0070712_1000217282 323
79 3300009098 Ga0105245_10003973 Ga0105245_100039737 323
80 3300025901 Ga0207688_10127249 Ga0207688_101272491 323
81 3300025915 Ga0207693_10032219 Ga0207693_100322193 323
82 3300025916 Ga0207663_10035757 Ga0207663_100357572 323
83 3300025927 Ga0207687_10015802 Ga0207687_100158024 323
84 3300025937 Ga0207669_10018757 Ga0207669_100187572 323
85 3300025939 Ga0207665_10082856 Ga0207665_100828562 323
86 3300026121 Ga0207683_10012735 Ga0207683_100127356 323
87 3300048904 Ga0496101_0003534 Ga0496101_0003534_4865_5899 323
88 3300048905 Ga0496102_0048449 Ga0496102_0048449_431_1465 323
89 3300048906 Ga0496103_0002822 Ga0496103_0002822_6511_7545 323
90 3300048907 Ga0496104_0301125 Ga0496104_0301125_449_1483 323
91 3300048908 Ga0496105_0035362 Ga0496105_0035362_1505_2539 323
92 3300048909 Ga0496106_0012570 Ga0496106_0012570_3219_4253 323
93 3300048910 Ga0496107_0001742 Ga0496107_0001742_7050_8084 323
94 3300048912 Ga0496109_0031997 Ga0496109_0031997_1695_2729 323
95 3300048915 Ga0496112_0101792 Ga0496112_0101792_705_1739 323
96 3300048916 Ga0496113_0007837 Ga0496113_0007837_5139_6173 323
97 3300048917 Ga0496114_0007170 Ga0496114_0007170_7071_8105 323
98 3300048918 Ga0496115_0001513 Ga0496115_0001513_1213_2247 323
99 3300025961 Ga0207712_10000019 Ga0207712_1000001949 324
100 3300046476 Ga0495662_0007830 Ga0495662_0007830_481_1518 324
101 3300047317 Ga0495604_0017461 Ga0495604_0017461_3910_4989 324
102 3300005719 Ga0068861_100054102 Ga0068861_1000541023 326
103 3300006847 Ga0075431_100060355 Ga0075431_1000603552 326
104 3300021384 Ga0213876_10012781 Ga0213876_100127812 326
105 3300037853 Ga0436364_0500128 Ga0436364_0500128_3172_4293 326
106 3300037853 Ga0436364_0885640 Ga0436364_0885640_843_1964 326
107 3300039437 Ga0436365_1132967 Ga0436365_1132967_3978_5099 326
108 3300044694 Ga0466963_0007696 Ga0466963_0007696_2735_3871 326
109 3300044901 Ga0466960_0166580 Ga0466960_0166580_116_1153 326
110 3300045049 Ga0466959_0215536 Ga0466959_0215536_38_1159 326
111 3300045836 Ga0466958_0004963 Ga0466958_0004963_3887_5008 326
112 3300045976 Ga0466967_0025464 Ga0466967_0025464_1152_2276 326
113 3300045976 Ga0466967_0100754 Ga0466967_0100754_333_1457 326
114 3300047319 Ga0495674_0000019 Ga0495674_0000019_33256_34422 326
115 3300048917 Ga0496114_0000133 Ga0496114_0000133_11486_12595 326
116 3300048918 Ga0496115_0000506 Ga0496115_0000506_19333_20442 326
117 3300049592 Ga0501076_0087582 Ga0501076_0087582_1072_2184 326
118 3300005456 Ga0070678_100004389 Ga0070678_1000043898 328
119 3300006038 Ga0075365_10000681 Ga0075365_1000068111 328
120 3300006038 Ga0075365_10000974 Ga0075365_100009748 328
121 3300006051 Ga0075364_10001605 Ga0075364_100016057 328
122 3300006051 Ga0075364_10020821 Ga0075364_100208214 328
123 3300006178 Ga0075367_10029259 Ga0075367_100292593 328
124 3300006847 Ga0075431_100000832 Ga0075431_1000008327 328
125 3300006852 Ga0075433_10188807 Ga0075433_101888072 328
126 3300006871 Ga0075434_100005700 Ga0075434_1000057008 328
127 3300009094 Ga0111539_10002660 Ga0111539_100026605 328
128 3300009147 Ga0114129_10030557 Ga0114129_100305574 328
129 3300014968 Ga0157379_10079226 Ga0157379_100792263 328
130 3300025905 Ga0207685_10065742 Ga0207685_100657422 328
131 3300037418 Ga0395900_0029855 Ga0395900_0029855_1456_2574 328
132 3300037418 Ga0395900_0308279 Ga0395900_0308279_44_1078 328
133 3300037466 Ga0395898_0009591 Ga0395898_0009591_5052_6170 328
134 3300037471 Ga0395905_0019380 Ga0395905_0019380_5084_6202 328
135 3300038443 Ga0395901_0028487 Ga0395901_0028487_1075_2193 328
136 3300038443 Ga0395901_0203232 Ga0395901_0203232_45_1079 328
137 3300046461 Ga0495641_0008726 Ga0495641_0008726_3455_4489 328
138 3300046690 Ga0495624_0000024 Ga0495624_0000024_21014_22132 328
139 3300049586 Ga0501070_0063752 Ga0501070_0063752_1719_2852 328
140 3300050492 nmdc:mga0yw44_15550_c1 nmdc:mga0yw44_15550_c1_2520_3638 328
141 3300050494 nmdc:mga06z11_26247_c1 nmdc:mga06z11_26247_c1_513_1547 328
142 3300050507 nmdc:mga05p37_21224_c1 nmdc:mga05p37_21224_c1_4179_5213 328
143 3300050510 nmdc:mga06r32_1573_c1 nmdc:mga06r32_1573_c1_10571_11605 328
144 3300050511 nmdc:mga08y16_6839_c1 nmdc:mga08y16_6839_c1_8242_9276 328
145 3300050515 nmdc:mga0a205_204327_c1 nmdc:mga0a205_204327_c1_442_1476 328
146 3300005347 Ga0070668_100074881 Ga0070668_1000748813 329
147 3300005444 Ga0070694_100158267 Ga0070694_1001582672 329
148 3300005459 Ga0068867_100000955 Ga0068867_10000095514 329
149 3300005981 Ga0081538_10000103 Ga0081538_1000010353 329
150 3300009094 Ga0111539_10254959 Ga0111539_102549592 329
151 3300009147 Ga0114129_10319154 Ga0114129_103191542 329
152 3300025972 Ga0207668_10065399 Ga0207668_100653993 329
153 3300026089 Ga0207648_10006982 Ga0207648_100069828 329
154 3300031852 Ga0307410_10044418 Ga0307410_100444183 329
155 3300031995 Ga0307409_100011355 Ga0307409_1000113555 329
156 3300049568 Ga0501031_0061237 Ga0501031_0061237_844_1980 329
157 3300049576 Ga0501040_0057825 Ga0501040_0057825_165_1301 329
158 3300049584 Ga0501068_0067802 Ga0501068_0067802_787_1923 329
159 3300049588 Ga0501072_0015204 Ga0501072_0015204_1134_2270 329
160 3300049591 Ga0501075_0107522 Ga0501075_0107522_939_2075 329
161 3300049592 Ga0501076_0190971 Ga0501076_0190971_367_1503 329
162 3300049593 Ga0501077_0034850 Ga0501077_0034850_566_1702 329
163 3300049741 Ga0501079_0007202 Ga0501079_0007202_2856_3992 329
164 3300049743 Ga0501081_0038319 Ga0501081_0038319_1937_3073 329
165 3300049824 Ga0501045_0009157 Ga0501045_0009157_1592_2728 329
166 3300049824 Ga0501045_0010585 Ga0501045_0010585_461_1597 329
167 3300054114 Ga0501084_0005497 Ga0501084_0005497_4592_5728 329
168 3300054114 Ga0501084_0034396 Ga0501084_0034396_1594_2730 329
169 3300060353 Ga0501082_0014463 Ga0501082_0014463_172_1308 329
170 3300061734 Ga0530510_0012715 Ga0530510_0012715_4474_5610 329
171 3300061734 Ga0530510_0014727 Ga0530510_0014727_2474_3610 329
172 3300009098 Ga0105245_10000336 Ga0105245_1000033620 330
173 3300025927 Ga0207687_10000013 Ga0207687_10000013258 330
174 3300046543 Ga0495645_0050318 Ga0495645_0050318_312_1496 330
175 3300005329 Ga0070683_100071437 Ga0070683_1000714373 331
176 3300005535 Ga0070684_100081891 Ga0070684_1000818913 331
177 3300006163 Ga0070715_10000001 Ga0070715_10000001560 331
178 3300025905 Ga0207685_10000005 Ga0207685_10000005172 331
179 3300025933 Ga0207706_10000001 Ga0207706_10000001154 331
180 3300025944 Ga0207661_10049820 Ga0207661_100498203 331
181 3300048912 Ga0496109_0000004 Ga0496109_0000004_130860_131900 334
182 3300005719 Ga0068861_100057287 Ga0068861_1000572873 335
183 3300026118 Ga0207675_100085093 Ga0207675_1000850933 335
184 3300048911 Ga0496108_0001524 Ga0496108_0001524_13651_14808 337
185 3300048912 Ga0496109_0000172 Ga0496109_0000172_10121_11278 337
186 3300005329 Ga0070683_100062390 Ga0070683_1000623903 338
187 3300036401 Ga0373937_0017071 Ga0373937_0017071_940_2109 338
188 3300046809 Ga0495600_0052010 Ga0495600_0052010_1075_2244 338
189 3300053085 Ga0495619_0008854 Ga0495619_0008854_2296_3465 338
190 3300017792 Ga0163161_10088873 Ga0163161_100888732 340
191 3300046454 Ga0495592_0098922 Ga0495592_0098922_250_1401 340
192 3300046529 Ga0495652_0010528 Ga0495652_0010528_4046_5230 340
193 3300046516 Ga0495628_0003282 Ga0495628_0003282_693_1907 348
194 3300046689 Ga0495613_0000083 Ga0495613_0000083_11843_13054 349
195 3300005338 Ga0068868_100000026 Ga0068868_10000002677 351
196 3300006881 Ga0068865_100000278 Ga0068865_10000027824 351
197 3300013102 Ga0157371_10007405 Ga0157371_100074053 351
198 3300025938 Ga0207704_10000224 Ga0207704_100002245 351
199 3300026023 Ga0207677_10000106 Ga0207677_1000010664 351
200 3300005718 Ga0068866_10019865 Ga0068866_100198652 352
201 3300025899 Ga0207642_10011868 Ga0207642_100118683 352
202 3300049591 Ga0501075_0029770 Ga0501075_0029770_2487_3986 353
203 3300013308 Ga0157375_10000236 Ga0157375_1000023645 362
204 3300002074 JGI24748J21848_1000187 JGI24748J21848_10001874 373
205 3300002239 JGI24034J26672_10000176 JGI24034J26672_100001763 373

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

158

356

0.93

PF00383

dCMP_cyt_deam_1

Cytidine and deoxycytidylate deaminase zinc-binding region

6

109

0.9

PF14437

MafB19-deam

MafB19-like deaminase

9

125

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g8q-assembly2.cif.gz_C a cytidine deaminase edits c-to-u in transfer rnas in archaea 0.841 2 102
2w4l-assembly1.cif.gz_F human dcmp deaminase 0.8401 20 102
2hxv-assembly1.cif.gz_A-2 crystal structure of a diaminohydroxyphosphoribosylaminopyrimidine deaminase/ 5-amino-6-(5-phosphoribosylamino)uracil reductase (tm1828) from thermotoga maritima at 1.80 a resolution 0.8368 1 371
3zpc-assembly1.cif.gz_B acinetobacter baumannii ribd, form 1 0.8249 1 371
6p8c-assembly1.cif.gz_B 2,5-diamino-6-(ribosylamino)-4(3h)-pyrimidinone 5'-phosphate reductase (mthred) from methanothermobacter thermautotrophicus 0.8125 122 371
ID Description Score Start End Superfamily
af_Q8GWP5_63_211_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9534 1 115 3.40.140.10
4g3mB01 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9371 2 111 3.40.140.10
af_P9WPH1_1_147_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9289 2 109 3.40.140.10
2hxvA01 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9273 1 119 3.40.140.10
af_P87241_253_395_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8964 1 98 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A259NN56-F1-model_v4 Riboflavin biosynthesis protein RibD 0.993 1 89 GO:0008270
GO:0008835
AF-A0A383F735-F1-model_v4 CMP/dCMP-type deaminase domain-containing protein 0.9641 1 120 GO:0008835
GO:0009231
AF-A0A6G2DF39-F1-model_v4 Riboflavin biosynthesis protein RibD 0.962 9 116 GO:0008270
GO:0016787
AF-A0A1F4HSN3-F1-model_v4 deleted 0.9534 2 111
AF-A0A7W1K6W8-F1-model_v4 Riboflavin biosynthesis protein RibD 0.9512 2 123 GO:0008270
GO:0008835

Feature Viewer

pLDDT pTM Quality
84.47 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map