F313807

General Info

Members Datasets Scaffolds Average Seq Length
205 144 410 294

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10625856|Ga0105238_106258561
Length 311
Sequence MHDLHALLDPMKNPVTYAVPFFLITIAIELAALKWLDHDDNVLGAARTGYYGRDARTSMSMGLVSLAFSLALKVGSFLVYNAVFVYVTPDAIKMPTDTWWYWVLLILGVDFAFYCSHRFVHRVNIGWAAHQAHHSSEYMNFATALRQKWNPWFEFFFWLPLPFLGFAPWTIYVAFGFNLIYQFFTHTEMIGKLPRPIELVMNTPSHHRVHHGSDPEYLDKNYAGILIVWDRMLGTFVEEKQKPTYGLTKPVETFNLIKLQYGDYAQIVHNVRAADTVRDKLGYLFGPPGWQPPGHQGDPEFEPIRPPTPVG

Samples

Sample ID Description Type Environment
1 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
21 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
24 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
25 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
26 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
29 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
30 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
31 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
32 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
58 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
59 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
60 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
61 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
62 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
63 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
64 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
65 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
66 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
67 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
68 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
69 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
70 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
71 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
72 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
73 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
74 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
75 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
76 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
77 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
79 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
80 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
81 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
82 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
83 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
84 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
85 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
86 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
87 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
88 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
89 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
90 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
91 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
92 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
93 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
94 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
97 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
98 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
99 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
100 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
101 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
102 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
103 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
104 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
105 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
106 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
107 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
108 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
109 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
110 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
111 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
125 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
126 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
128 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
129 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
130 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
131 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
132 2643221604 Nocardioides sp. Root190 Isolate Unclassified
133 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
134 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
135 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
136 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
137 2738541305 Nocardioides sp. CF167 Isolate Unclassified
138 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
139 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
140 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
141 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
142 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
143 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
144 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 90.73
Metatranscriptomes 2.93
Isolates 6.34

Biome Distribution

Category Percentage (%)
Aerial Root 1.46
Bulb 0
Endosphere 2.44
Nodule 0
Rhizoplane 2.93
Rhizosphere 83.9
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105238_10625856 3300009551 Bacteria 1085
2 rootH2_10036913 3300003320 Bacteria 3062
3 Ga0070658_10020079 3300005327 Bacteria 5352
4 Ga0070658_10155839 3300005327 Bacteria 1915
5 Ga0070658_10354045 3300005327 Bacteria 1257
6 Ga0070683_100195079 3300005329 Bacteria 1923
7 Ga0070680_100043880 3300005336 Bacteria 3633
8 Ga0070660_100022429 3300005339 Bacteria 4668
9 Ga0070660_100064033 3300005339 Bacteria 2860
10 Ga0070659_100092423 3300005366 Bacteria 2426
11 Ga0070709_10009139 3300005434 Bacteria 5454
12 Ga0070714_100226438 3300005435 Bacteria 1721
13 Ga0070713_100018847 3300005436 Bacteria 5254
14 Ga0070713_100362141 3300005436 Bacteria 1348
15 Ga0070663_100325153 3300005455 Bacteria 1238
16 Ga0070679_100038446 3300005530 Bacteria 4757
17 Ga0070679_100185001 3300005530 Bacteria 2055
18 Ga0070684_100011781 3300005535 Bacteria 6976
19 Ga0070684_100036624 3300005535 Bacteria 4205
20 Ga0068853_100358937 3300005539 Bacteria 1357
21 Ga0070665_100014962 3300005548 Bacteria 7788
22 Ga0070665_100157147 3300005548 Bacteria 2276
23 Ga0070665_100196584 3300005548 Bacteria 2018
24 Ga0068857_100146767 3300005577 Bacteria 2135
25 Ga0068852_100048189 3300005616 Bacteria 3640
26 Ga0068852_100274623 3300005616 Bacteria 1623
27 Ga0068851_10178452 3300005834 Bacteria 1175
28 Ga0070717_10165141 3300006028 Bacteria 1923
29 Ga0070717_10426928 3300006028 Bacteria 1193
30 Ga0075363_100164571 3300006048 Bacteria 1257
31 Ga0075370_10066674 3300006353 Bacteria 2054
32 Ga0105240_10492171 3300009093 Bacteria 1365
33 Ga0105241_10000927 3300009174 Bacteria 22225
34 Ga0105237_10154729 3300009545 Bacteria 2289
35 Ga0105237_10169078 3300009545 Bacteria 2186
36 Ga0105238_10385714 3300009551 Bacteria 1393
37 Ga0105249_10427829 3300009553 Bacteria 1359
38 Ga0157370_10064824 3300013104 Bacteria 3457
39 Ga0157369_10059290 3300013105 Bacteria 4127
40 Ga0157374_10284780 3300013296 Bacteria 1632
41 Ga0197907_10002056 3300020069 Bacteria 1053
42 Ga0206356_10933879 3300020070 Bacteria 2445
43 Ga0206352_10690978 3300020078 Bacteria 2861
44 Ga0206350_11350715 3300020080 Bacteria 955
45 Ga0224712_10002410 3300022467 Bacteria 4608
46 Ga0224712_10120899 3300022467 Bacteria 1134
47 Ga0207647_10010403 3300025904 Bacteria 6570
48 Ga0207647_10116230 3300025904 Bacteria 1579
49 Ga0207647_10150497 3300025904 Bacteria 1360
50 Ga0207647_10165074 3300025904 Bacteria 1291
51 Ga0207699_10021892 3300025906 Bacteria 3455
52 Ga0207654_10057382 3300025911 Bacteria 2262
53 Ga0207707_10005160 3300025912 Bacteria 11447
54 Ga0207695_10003308 3300025913 Bacteria 22844
55 Ga0207671_10002955 3300025914 Bacteria 17494
56 Ga0207671_10182586 3300025914 Bacteria 1633
57 Ga0207657_10033323 3300025919 Bacteria 4645
58 Ga0207657_10169737 3300025919 Bacteria 1768
59 Ga0207652_10006396 3300025921 Bacteria 9511
60 Ga0207694_10021955 3300025924 Bacteria 4840
61 Ga0207700_10015501 3300025928 Bacteria 5030
62 Ga0207700_10201558 3300025928 Bacteria 1677
63 Ga0207664_10038412 3300025929 Bacteria 3712
64 Ga0207664_10051820 3300025929 Bacteria 3243
65 Ga0207664_10148197 3300025929 Bacteria 1991
66 Ga0207664_10290725 3300025929 Bacteria 1436
67 Ga0207690_10320609 3300025932 Bacteria 1218
68 Ga0207665_10277911 3300025939 Bacteria 1245
69 Ga0207661_10042903 3300025944 Bacteria 3568
70 Ga0207667_10025745 3300025949 Bacteria 6436
71 Ga0207667_10463089 3300025949 Bacteria 1287
72 Ga0207640_10019026 3300025981 Bacteria 4049
73 Ga0207658_10531278 3300025986 Bacteria 1051
74 Ga0207678_10007349 3300026067 Bacteria 9754
75 Ga0207678_10191141 3300026067 Bacteria 1749
76 Ga0207678_10233339 3300026067 Bacteria 1575
77 Ga0207702_10056192 3300026078 Bacteria 3341
78 Ga0207702_10348443 3300026078 Bacteria 1416
79 Ga0207641_10555811 3300026088 Bacteria 1120
80 Ga0207674_10022016 3300026116 Bacteria 6855
81 Ga0207698_10387335 3300026142 Bacteria 1332
82 Ga0268266_10072587 3300028379 Bacteria 2985
83 Ga0268266_10119504 3300028379 Bacteria 2344
84 Ga0265337_1002616 3300028556 Bacteria 8127
85 Ga0265326_10001970 3300028558 Bacteria 7031
86 Ga0265319_1003879 3300028563 Bacteria 7630
87 Ga0265334_10002664 3300028573 Bacteria 8259
88 Ga0265323_10005483 3300028653 Bacteria 5390
89 Ga0265336_10003180 3300028666 Bacteria 6526
90 Ga0265338_10014471 3300028800 Bacteria 8780
91 Ga0265338_10152761 3300028800 Bacteria 1792
92 Ga0265324_10003957 3300029957 Bacteria 6856
93 Ga0316182_1098355 3300030745 Bacteria 6360
94 Ga0265332_10003038 3300031238 Bacteria 8221
95 Ga0265320_10004715 3300031240 Bacteria 8883
96 Ga0265325_10003596 3300031241 Bacteria 10062
97 Ga0307513_10002699 3300031456 Bacteria 24420
98 Ga0307513_10006040 3300031456 Bacteria 15886
99 Ga0265313_10102636 3300031595 Bacteria 1267
100 Ga0307508_10006889 3300031616 Bacteria 10622
101 Ga0265314_10027458 3300031711 Bacteria 4261
102 Ga0265342_10015726 3300031712 Bacteria 4968
103 Ga0307405_10055585 3300031731 Bacteria 2478
104 Ga0307409_100627349 3300031995 Bacteria 1066
105 Ga0373937_0379890 3300036401 Bacteria 1340
106 Ga0373925_0000017 3300037068 Bacteria 174289
107 Ga0395900_0015491 3300037418 Bacteria 7773
108 Ga0395900_0021579 3300037418 Bacteria 6584
109 Ga0395900_0033834 3300037418 Bacteria 5259
110 Ga0395898_0177890 3300037466 Bacteria 2033
111 Ga0395898_0286384 3300037466 Bacteria 1572
112 Ga0395901_0232705 3300038443 Bacteria 1923
113 Ga0451791_1867573 3300041451 Bacteria 1070
114 Ga0451833_1216210 3300041491 Bacteria 4519
115 Ga0439445_0026193 3300042004 Bacteria 1491
116 Ga0466972_0018595 3300044658 Bacteria 3476
117 Ga0466972_0077333 3300044658 Bacteria 1585
118 Ga0466965_0017028 3300044683 Bacteria 3468
119 Ga0466965_0034536 3300044683 Bacteria 2474
120 Ga0466965_0143540 3300044683 Bacteria 1245
121 Ga0466965_0162459 3300044683 Bacteria 1172
122 Ga0466961_0033124 3300044693 Bacteria 3321
123 Ga0466961_0060876 3300044693 Bacteria 2400
124 Ga0466961_0101319 3300044693 Bacteria 1814
125 Ga0466963_0134551 3300044694 Bacteria 1710
126 Ga0466964_0081273 3300044706 Bacteria 1392
127 Ga0466971_0072340 3300044719 Bacteria 1566
128 Ga0466971_0230698 3300044719 Bacteria 879
129 Ga0466968_0034306 3300044735 Bacteria 2117
130 Ga0466970_0018506 3300044765 Bacteria 3607
131 Ga0466970_0029443 3300044765 Bacteria 2890
132 Ga0466970_0035165 3300044765 Bacteria 2654
133 Ga0466970_0058308 3300044765 Bacteria 2066
134 Ga0466970_0195572 3300044765 Bacteria 1124
135 Ga0466957_0082743 3300044842 Bacteria 2001
136 Ga0466960_0007043 3300044901 Bacteria 4544
137 Ga0466958_0051990 3300045836 Bacteria 2482
138 Ga0466967_0008616 3300045976 Bacteria 7496
139 Ga0466967_0021585 3300045976 Bacteria 5235
140 Ga0466967_0039773 3300045976 Bacteria 4045
141 Ga0466967_0095674 3300045976 Bacteria 2708
142 Ga0466967_0153323 3300045976 Bacteria 2156
143 Ga0495651_0016588 3300046462 Bacteria 5704
144 Ga0495628_0003892 3300046516 Bacteria 13307
145 Ga0495628_0015977 3300046516 Bacteria 6263
146 Ga0495652_0000639 3300046529 Bacteria 40668
147 Ga0495652_0002425 3300046529 Bacteria 19225
148 Ga0495635_0030413 3300046663 Bacteria 3752
149 Ga0495646_0014709 3300046680 Bacteria 4973
150 Ga0495600_0006117 3300046809 Bacteria 7290
151 Ga0495604_0003562 3300047317 Bacteria 12426
152 Ga0496104_0109033 3300048907 Bacteria 2654
153 Ga0496105_0189591 3300048908 Bacteria 1682
154 Ga0496109_0611439 3300048912 Bacteria 1026
155 Ga0496111_0146650 3300048914 Bacteria 1750
156 Ga0496112_0073263 3300048915 Bacteria 3386
157 Ga0496122_0037609 3300048925 Bacteria 3893
158 Ga0496123_0016670 3300048926 Bacteria 5951
159 Ga0496126_0013313 3300048929 Bacteria 8377
160 Ga0496126_0159082 3300048929 Bacteria 1931
161 Ga0501031_0025308 3300049568 Bacteria 3872
162 Ga0501032_0009862 3300049569 Bacteria 6904
163 Ga0501033_0004006 3300049570 Bacteria 11918
164 Ga0501034_0026605 3300049571 Bacteria 5890
165 Ga0501034_0050066 3300049571 Bacteria 4214
166 Ga0501036_0004929 3300049572 Bacteria 10787
167 Ga0501036_0086703 3300049572 Bacteria 2646
168 Ga0501037_0029214 3300049573 Bacteria 4072
169 Ga0501038_0025690 3300049574 Bacteria 5247
170 Ga0501038_0060830 3300049574 Bacteria 3232
171 Ga0501039_0007779 3300049575 Bacteria 8175
172 Ga0501042_0007051 3300049578 Bacteria 7342
173 Ga0501043_0084069 3300049579 Bacteria 2501
174 Ga0501043_0137563 3300049579 Bacteria 1913
175 Ga0501046_0000546 3300049580 Bacteria 37423
176 Ga0501046_0008485 3300049580 Bacteria 8948
177 Ga0501046_0163797 3300049580 Bacteria 1671
178 Ga0501047_0131719 3300049581 Bacteria 2380
179 Ga0501048_0019279 3300049582 Bacteria 5008
180 Ga0501070_0005640 3300049586 Bacteria 10678
181 Ga0501070_0074064 3300049586 Bacteria 2818
182 Ga0501073_0199168 3300049589 Bacteria 1385
183 Ga0501073_0243735 3300049589 Bacteria 1241
184 Ga0501035_0078858 3300049822 Bacteria 2908
185 Ga0501044_0104814 3300049823 Bacteria 2841
186 Ga0501044_0151171 3300049823 Bacteria 2303
187 nmdc:mga07m45_118940_c1 3300050496 Bacteria 1525
188 nmdc:mga07m45_17785_c1 3300050496 Bacteria 3824
189 Ga0495601_0003314 3300053077 Bacteria 9212
190 Ga0495601_0007169 3300053077 Bacteria 6539
191 Ga0495619_0082230 3300053085 Bacteria 2170
192 Ga0500641_0013274 3300053096 Bacteria 3024
193 2644035204 2643221604 Bacteria 5014917
194 2644454769 2643221681 Bacteria 3707866
195 2644536283 2643221697 Bacteria 3575694
196 2645722132 2643221961 Bacteria 3919167
197 2645724973 2643221962 Bacteria 3874254
198 2738867618 2738541305 Bacteria 4910150
199 2774395243 2773857762 Bacteria 5971770
200 2809193923 2808606439 Bacteria 5952208
201 2812348663 2811994878 Bacteria 5992952
202 2891973602 2891968417 Bacteria 5821697
203 2984577417 2984576629 Bacteria 4248407
204 2984593659 2984592036 Bacteria 3670284
205 2990259578 2990256926 Bacteria 4252839
206 Ga0105238_10625856
207 rootH2_10036913
208 Ga0070658_10020079
209 Ga0070658_10155839
210 Ga0070658_10354045
211 Ga0070683_100195079
212 Ga0070680_100043880
213 Ga0070660_100022429
214 Ga0070660_100064033
215 Ga0070659_100092423
216 Ga0070709_10009139
217 Ga0070714_100226438
218 Ga0070713_100018847
219 Ga0070713_100362141
220 Ga0070663_100325153
221 Ga0070679_100038446
222 Ga0070679_100185001
223 Ga0070684_100011781
224 Ga0070684_100036624
225 Ga0068853_100358937
226 Ga0070665_100014962
227 Ga0070665_100157147
228 Ga0070665_100196584
229 Ga0068857_100146767
230 Ga0068852_100048189
231 Ga0068852_100274623
232 Ga0068851_10178452
233 Ga0070717_10165141
234 Ga0070717_10426928
235 Ga0075363_100164571
236 Ga0075370_10066674
237 Ga0105240_10492171
238 Ga0105241_10000927
239 Ga0105237_10154729
240 Ga0105237_10169078
241 Ga0105238_10385714
242 Ga0105249_10427829
243 Ga0157370_10064824
244 Ga0157369_10059290
245 Ga0157374_10284780
246 Ga0197907_10002056
247 Ga0206356_10933879
248 Ga0206352_10690978
249 Ga0206350_11350715
250 Ga0224712_10002410
251 Ga0224712_10120899
252 Ga0207647_10010403
253 Ga0207647_10116230
254 Ga0207647_10150497
255 Ga0207647_10165074
256 Ga0207699_10021892
257 Ga0207654_10057382
258 Ga0207707_10005160
259 Ga0207695_10003308
260 Ga0207671_10002955
261 Ga0207671_10182586
262 Ga0207657_10033323
263 Ga0207657_10169737
264 Ga0207652_10006396
265 Ga0207694_10021955
266 Ga0207700_10015501
267 Ga0207700_10201558
268 Ga0207664_10038412
269 Ga0207664_10051820
270 Ga0207664_10148197
271 Ga0207664_10290725
272 Ga0207690_10320609
273 Ga0207665_10277911
274 Ga0207661_10042903
275 Ga0207667_10025745
276 Ga0207667_10463089
277 Ga0207640_10019026
278 Ga0207658_10531278
279 Ga0207678_10007349
280 Ga0207678_10191141
281 Ga0207678_10233339
282 Ga0207702_10056192
283 Ga0207702_10348443
284 Ga0207641_10555811
285 Ga0207674_10022016
286 Ga0207698_10387335
287 Ga0268266_10072587
288 Ga0268266_10119504
289 Ga0265337_1002616
290 Ga0265326_10001970
291 Ga0265319_1003879
292 Ga0265334_10002664
293 Ga0265323_10005483
294 Ga0265336_10003180
295 Ga0265338_10014471
296 Ga0265338_10152761
297 Ga0265324_10003957
298 Ga0316182_1098355
299 Ga0265332_10003038
300 Ga0265320_10004715
301 Ga0265325_10003596
302 Ga0307513_10002699
303 Ga0307513_10006040
304 Ga0265313_10102636
305 Ga0307508_10006889
306 Ga0265314_10027458
307 Ga0265342_10015726
308 Ga0307405_10055585
309 Ga0307409_100627349
310 Ga0373937_0379890
311 Ga0373925_0000017
312 Ga0395900_0015491
313 Ga0395900_0021579
314 Ga0395900_0033834
315 Ga0395898_0177890
316 Ga0395898_0286384
317 Ga0395901_0232705
318 Ga0451791_1867573
319 Ga0451833_1216210
320 Ga0439445_0026193
321 Ga0466972_0018595
322 Ga0466972_0077333
323 Ga0466965_0017028
324 Ga0466965_0034536
325 Ga0466965_0143540
326 Ga0466965_0162459
327 Ga0466961_0033124
328 Ga0466961_0060876
329 Ga0466961_0101319
330 Ga0466963_0134551
331 Ga0466964_0081273
332 Ga0466971_0072340
333 Ga0466971_0230698
334 Ga0466968_0034306
335 Ga0466970_0018506
336 Ga0466970_0029443
337 Ga0466970_0035165
338 Ga0466970_0058308
339 Ga0466970_0195572
340 Ga0466957_0082743
341 Ga0466960_0007043
342 Ga0466958_0051990
343 Ga0466967_0008616
344 Ga0466967_0021585
345 Ga0466967_0039773
346 Ga0466967_0095674
347 Ga0466967_0153323
348 Ga0495651_0016588
349 Ga0495628_0003892
350 Ga0495628_0015977
351 Ga0495652_0000639
352 Ga0495652_0002425
353 Ga0495635_0030413
354 Ga0495646_0014709
355 Ga0495600_0006117
356 Ga0495604_0003562
357 Ga0496104_0109033
358 Ga0496105_0189591
359 Ga0496109_0611439
360 Ga0496111_0146650
361 Ga0496112_0073263
362 Ga0496122_0037609
363 Ga0496123_0016670
364 Ga0496126_0013313
365 Ga0496126_0159082
366 Ga0501031_0025308
367 Ga0501032_0009862
368 Ga0501033_0004006
369 Ga0501034_0026605
370 Ga0501034_0050066
371 Ga0501036_0004929
372 Ga0501036_0086703
373 Ga0501037_0029214
374 Ga0501038_0025690
375 Ga0501038_0060830
376 Ga0501039_0007779
377 Ga0501042_0007051
378 Ga0501043_0084069
379 Ga0501043_0137563
380 Ga0501046_0000546
381 Ga0501046_0008485
382 Ga0501046_0163797
383 Ga0501047_0131719
384 Ga0501048_0019279
385 Ga0501070_0005640
386 Ga0501070_0074064
387 Ga0501073_0199168
388 Ga0501073_0243735
389 Ga0501035_0078858
390 Ga0501044_0104814
391 Ga0501044_0151171
392 nmdc:mga07m45_118940_c1
393 nmdc:mga07m45_17785_c1
394 Ga0495601_0003314
395 Ga0495601_0007169
396 Ga0495619_0082230
397 Ga0500641_0013274
398 2644035204
399 2644454769
400 2644536283
401 2645722132
402 2645724973
403 2738867618
404 2774395243
405 2809193923
406 2812348663
407 2891973602
408 2984577417
409 2984593659
410 2990259578

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04116

FA_hydroxylase

Fatty acid hydroxylase

102

235

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cpt-assembly1.cif.gz_A solution structure of mit domain from human skd1 0.3535 235 292
4d2b-assembly1.cif.gz_A structure of a ligand free pot family peptide transporter 0.2665 37 174
2ht3-assembly1.cif.gz_B structure of the escherichia coli clc chloride channel y445l mutant and fab complex 0.1959 17 248
2cpt-assembly1.cif.gz_A solution structure of mit domain from human skd1 0.1954 235 292
7n9w-assembly1.cif.gz_A clc-ec1 ph 4.5 100mm cl twist1 0.1683 21 248
ID Description Score Start End Superfamily
af_Q550E0_234_487_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.7384 215 262 1.20.1070.10
af_A4I0V3_1103_1179_1.10.287.280 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.4067 234 284 1.10.287.280
af_Q4DX44_2_222_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.2985 70 163 1.20.1080.10
af_A4I0V3_1103_1179_1.10.287.280 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.2846 234 284 1.10.287.280
af_Q4DWN2_110_302_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2483 2 280 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A7K2KVT3-F1-model_v4 Sterol desaturase family protein 0.9562 38 249 GO:0005506
GO:0006643
GO:0008610
GO:0012505
GO:0016020
GO:0050479
AF-A0A1H7N6K4-F1-model_v4 Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily 0.9551 1 282 GO:0005506
GO:0006643
GO:0008610
GO:0012505
GO:0016020
GO:0050479
AF-A0A6A0BVW3-F1-model_v4 deleted 0.9543 31 268
AF-A0A7K3QN55-F1-model_v4 Sterol desaturase family protein 0.9527 1 268 GO:0005506
GO:0006643
GO:0008610
GO:0012505
GO:0016020
GO:0050479
AF-A0A4Q3R191-F1-model_v4 deleted 0.9521 32 268

Map