F313802

General Info

Members Datasets Scaffolds Average Seq Length
205 140 201 155

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10005064|Ga0105237_100050649
Length 169
Sequence LSVFIINVSLTLTNPIFVKENPPLKLTTMKTNIGITEKNTKAVSVELSKLLADEYILYTKTRNAHWNVEGPDFHSMHIFFEGQYGQLEDMLDGVAERIRTLGHYAPATLKSFLELTHLTEYSERKNDSLGFIKELLEDHESIVEFLRGNINTFANEYHDLGTSDYHFKN

Samples

Sample ID Description Type Environment
1 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
2 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
3 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
4 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
54 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
55 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
56 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
57 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
58 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
59 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
61 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
62 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
91 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
92 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
93 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
94 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
95 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
96 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
97 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
107 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
108 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
109 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
110 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
111 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
112 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
113 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
114 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
115 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
116 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
117 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
118 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
119 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
120 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
121 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
122 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
123 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
124 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
125 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
126 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
127 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
128 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
129 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
130 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
131 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
132 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
133 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
134 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
135 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
136 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
137 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
138 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
139 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
140 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.05
Metatranscriptomes 0
Isolates 1.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.17
Nodule 0
Rhizoplane 1.95
Rhizosphere 77.07
Stem 0
Stem Tuber 0
Unclassified 7.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000005 3300002737 Bacteria 435925
2 JGI25152J39213_1000044 3300002773 Bacteria 87213
3 JGI25150J39212_1000006 3300002774 Bacteria 257228
4 JGI25151J46595_10000024 3300003187 Bacteria 217596
5 JGI25153J46596_10000026 3300003215 Bacteria 217245
6 rootH2_10026787 3300003320 Unclassified 4247
7 rootH2_10071794 3300003320 Bacteria 1297
8 rootH2_10071795 3300003320 Bacteria 1297
9 rootL2_10010023 3300003322 Bacteria 7643
10 rootL2_10062250 3300003322 Bacteria 2630
11 rootL2_10062251 3300003322 Bacteria 3700
12 rootH1_10107410 3300003323 Bacteria 6818
13 rootH1_10116303 3300003323 Bacteria 3157
14 Ga0055536_1000002 3300003781 Bacteria 605605
15 Ga0055530_10001950 3300003791 Bacteria 14086
16 Ga0065704_10079609 3300005289 Bacteria 4118
17 Ga0070670_100165317 3300005331 Bacteria 1918
18 Ga0070666_10164319 3300005335 Bacteria 1552
19 Ga0070682_100003510 3300005337 Bacteria 8674
20 Ga0070660_100244907 3300005339 Unclassified 1461
21 Ga0070660_100434104 3300005339 Unclassified 1088
22 Ga0070689_100335628 3300005340 Bacteria 1265
23 Ga0070691_10006944 3300005341 Bacteria 5183
24 Ga0070659_101105293 3300005366 Bacteria 699
25 Ga0070662_100153866 3300005457 Unclassified 1793
26 Ga0070698_100070190 3300005471 Bacteria 3516
27 Ga0070698_100295396 3300005471 Bacteria 1551
28 Ga0068853_100024307 3300005539 Bacteria 5078
29 Ga0068853_100307660 3300005539 Bacteria 1466
30 Ga0070693_100037295 3300005547 Bacteria 2709
31 Ga0070665_100000001 3300005548 Bacteria 1083363
32 Ga0068855_100000206 3300005563 Bacteria 75521
33 Ga0068855_100171234 3300005563 Bacteria 2459
34 Ga0068855_100841142 3300005563 Bacteria 973
35 Ga0068855_102241224 3300005563 Unclassified 548
36 Ga0068857_100000416 3300005577 Bacteria 30150
37 Ga0068857_100059209 3300005577 Bacteria 3402
38 Ga0068856_100001369 3300005614 Bacteria 25648
39 Ga0068856_100033066 3300005614 Bacteria 5064
40 Ga0068856_100142820 3300005614 Bacteria 2401
41 Ga0068852_100037777 3300005616 Bacteria 4052
42 Ga0068859_100169349 3300005617 Bacteria 2265
43 Ga0068864_100272036 3300005618 Unclassified 1579
44 Ga0068858_100951778 3300005842 Unclassified 841
45 Ga0068860_100000111 3300005843 Bacteria 131004
46 Ga0068860_100135230 3300005843 Bacteria 2367
47 Ga0097621_100543297 3300006237 Bacteria 1057
48 Ga0075428_100944755 3300006844 Bacteria 914
49 Ga0097620_100169354 3300006931 Bacteria 2265
50 Ga0105251_10218084 3300009011 Bacteria 859
51 Ga0105240_10013673 3300009093 Bacteria 11131
52 Ga0105240_10033871 3300009093 Bacteria 6595
53 Ga0105240_10358278 3300009093 Unclassified 1653
54 Ga0105240_11343170 3300009093 Bacteria 753
55 Ga0105240_11703702 3300009093 Bacteria 658
56 Ga0105241_10000319 3300009174 Bacteria 36268
57 Ga0105241_10815503 3300009174 Bacteria 861
58 Ga0105237_10005064 3300009545 Bacteria 14970
59 Ga0105237_10069915 3300009545 Bacteria 3506
60 Ga0105237_10170753 3300009545 Bacteria 2174
61 Ga0105237_10383540 3300009545 Bacteria 1410
62 Ga0105249_10022037 3300009553 Bacteria 5706
63 Ga0105249_10192528 3300009553 Bacteria 1991
64 Ga0105239_10001973 3300010375 Bacteria 26693
65 Ga0105239_10022723 3300010375 Bacteria 6914
66 Ga0105239_10138602 3300010375 Unclassified 2710
67 Ga0105239_11086850 3300010375 Bacteria 920
68 Ga0157373_11244393 3300013100 Bacteria 562
69 Ga0157371_10305774 3300013102 Bacteria 1152
70 Ga0157370_10000479 3300013104 Bacteria 49878
71 Ga0157370_10010061 3300013104 Bacteria 10000
72 Ga0157370_10174756 3300013104 Bacteria 1996
73 Ga0157378_10044390 3300013297 Bacteria 3947
74 Ga0157378_10106367 3300013297 Bacteria 2566
75 Ga0157378_11294102 3300013297 Unclassified 770
76 Ga0163162_10000101 3300013306 Bacteria 77114
77 Ga0163162_10138772 3300013306 Bacteria 2543
78 Ga0163162_10949091 3300013306 Bacteria 971
79 Ga0157372_10049421 3300013307 Bacteria 4676
80 Ga0157372_10364300 3300013307 Unclassified 1684
81 Ga0157375_10252187 3300013308 Bacteria 1926
82 Ga0157380_10880561 3300014326 Bacteria 920
83 Ga0182008_10000023 3300014497 Bacteria 201526
84 Ga0182006_1091958 3300015261 Bacteria 1090
85 Ga0183373_1002 3300015682 Bacteria 990153
86 Ga0209437_100043 3300025233 Bacteria 440454
87 Ga0207425_1000003 3300025245 Bacteria 1145342
88 Ga0209129_1000022 3300025258 Bacteria 440876
89 Ga0209676_1000022 3300025292 Bacteria 605659
90 Ga0209025_1000007 3300025294 Bacteria 1145109
91 Ga0209758_1000012 3300025297 Bacteria 949866
92 Ga0209050_1000020 3300025298 Bacteria 605671
93 Ga0209257_1000001 3300025304 Bacteria 2274655
94 Ga0207680_10386936 3300025903 Bacteria 987
95 Ga0207647_10012780 3300025904 Bacteria 5834
96 Ga0207654_10005271 3300025911 Bacteria 6530
97 Ga0207654_10317891 3300025911 Bacteria 1063
98 Ga0207707_10000721 3300025912 Bacteria 32676
99 Ga0207695_10000084 3300025913 Bacteria 282392
100 Ga0207695_10000323 3300025913 Bacteria 114265
101 Ga0207695_10017176 3300025913 Bacteria 8433
102 Ga0207695_10340539 3300025913 Bacteria 1387
103 Ga0207695_10632909 3300025913 Bacteria 951
104 Ga0207671_10003626 3300025914 Bacteria 15252
105 Ga0207671_10007035 3300025914 Bacteria 9856
106 Ga0207671_10153665 3300025914 Bacteria 1779
107 Ga0207660_10001254 3300025917 Bacteria 17002
108 Ga0207662_10369298 3300025918 Bacteria 967
109 Ga0207652_10002045 3300025921 Bacteria 17358
110 Ga0207694_10190291 3300025924 Bacteria 1667
111 Ga0207650_10024604 3300025925 Bacteria 4283
112 Ga0207690_10482928 3300025932 Bacteria 1000
113 Ga0207706_10561472 3300025933 Unclassified 982
114 Ga0207670_10933513 3300025936 Bacteria 728
115 Ga0207689_10998889 3300025942 Bacteria 706
116 Ga0207667_10000009 3300025949 Bacteria 603135
117 Ga0207667_10000135 3300025949 Bacteria 111565
118 Ga0207667_12034044 3300025949 Unclassified 534
119 Ga0207712_10023060 3300025961 Bacteria 4103
120 Ga0207712_10128121 3300025961 Bacteria 1930
121 Ga0207712_10143263 3300025961 Bacteria 1836
122 Ga0207712_10203640 3300025961 Unclassified 1571
123 Ga0207712_11124226 3300025961 Bacteria 700
124 Ga0207658_11321312 3300025986 Bacteria 659
125 Ga0207677_10256559 3300026023 Bacteria 1423
126 Ga0207639_10007875 3300026041 Bacteria 7277
127 Ga0207702_10252016 3300026078 Bacteria 1658
128 Ga0207702_10640368 3300026078 Bacteria 1045
129 Ga0207676_10169315 3300026095 Unclassified 1901
130 Ga0207674_10004100 3300026116 Bacteria 17648
131 Ga0207698_10122263 3300026142 Bacteria 2206
132 Ga0268266_10000049 3300028379 Bacteria 307763
133 Ga0268264_10000313 3300028381 Bacteria 77820
134 Ga0268264_10001221 3300028381 Bacteria 24720
135 Ga0307517_10002048 3300028786 Bacteria 32795
136 Ga0307517_10088138 3300028786 Bacteria 2569
137 Ga0265340_10130525 3300031247 Bacteria 1153
138 Ga0265327_10038135 3300031251 Bacteria 2625
139 Ga0307513_10083325 3300031456 Bacteria 3289
140 Ga0307513_10503089 3300031456 Unclassified 929
141 Ga0307509_10067402 3300031507 Bacteria 3750
142 Ga0265313_10021797 3300031595 Unclassified 3494
143 Ga0307405_10000008 3300031731 Bacteria 264953
144 Ga0307407_10000037 3300031903 Bacteria 71023
145 Ga0307407_10016078 3300031903 Bacteria 3717
146 Ga0307416_100000001 3300032002 Bacteria 515017
147 Ga0307416_100000048 3300032002 Bacteria 120194
148 Ga0307414_10006098 3300032004 Bacteria 6690
149 Ga0307411_10515570 3300032005 Bacteria 1014
150 Ga0307411_11735985 3300032005 Bacteria 578
151 Ga0395899_0210146 3300037312 Bacteria 1353
152 Ga0395900_0000330 3300037418 Bacteria 69819
153 Ga0395900_0029340 3300037418 Bacteria 5644
154 Ga0395900_0053199 3300037418 Unclassified 4167
155 Ga0395898_0032848 3300037466 Bacteria 5181
156 Ga0395905_0000769 3300037471 Bacteria 42306
157 Ga0395905_0001627 3300037471 Bacteria 26707
158 Ga0395901_0002005 3300038443 Bacteria 20948
159 Ga0451807_2733501 3300041486 Bacteria 1831
160 Ga0466972_0019301 3300044658 Bacteria 3409
161 Ga0466968_0374332 3300044735 Bacteria 695
162 Ga0495638_0168032 3300046460 Bacteria 1260
163 Ga0495650_0054044 3300046471 Unclassified 1641
164 Ga0495650_0106423 3300046471 Bacteria 1047
165 Ga0495605_0084612 3300046474 Bacteria 1479
166 Ga0495606_0009459 3300046507 Bacteria 8247
167 Ga0495606_0021447 3300046507 Bacteria 4732
168 Ga0495616_0004631 3300046513 Bacteria 8633
169 Ga0495642_0103405 3300046528 Bacteria 1214
170 Ga0495597_0142704 3300046542 Bacteria 987
171 Ga0495633_0286487 3300046558 Bacteria 749
172 Ga0495668_0000050 3300046616 Bacteria 214716
173 Ga0495672_0009625 3300047320 Bacteria 6975
174 Ga0495672_0067124 3300047320 Bacteria 2044
175 Ga0495687_000001 3300047443 Bacteria 1215582
176 Ga0495685_041661 3300047447 Bacteria 1569
177 Ga0495686_0000249 3300047472 Bacteria 96604
178 Ga0495686_0293121 3300047472 Bacteria 900
179 Ga0495686_0368449 3300047472 Bacteria 777
180 Ga0495614_0023524 3300048089 Bacteria 2659
181 Ga0496101_0181280 3300048904 Bacteria 1622
182 Ga0496115_0360832 3300048918 Unclassified 1184
183 Ga0496115_0500563 3300048918 Bacteria 976
184 Ga0496126_0007733 3300048929 Bacteria 11722
185 Ga0495678_008377 3300049459 Bacteria 5222
186 Ga0501238_025790 3300049671 Bacteria 842
187 Ga0501241_000045 3300049758 Bacteria 36457
188 Ga0501044_0192461 3300049823 Unclassified 2002
189 nmdc:mga09592_1710090_c1 3300050508 Bacteria 507
190 Ga0500635_0061749 3300053080 Unclassified 1309
191 Ga0500583_0000538 3300053092 Bacteria 11507
192 Ga0500650_0097217 3300053098 Bacteria 1379
193 Ga0500557_020178 3300053105 Bacteria 1891
194 Ga0500568_0032194 3300053139 Unclassified 2157
195 Ga0500589_077611 3300053147 Bacteria 1488
196 Ga0500604_0026386 3300053151 Bacteria 1675
197 Ga0500622_0000012 3300053156 Bacteria 383183
198 Ga0500622_0000183 3300053156 Bacteria 67413
199 Ga0500622_0000610 3300053156 Bacteria 32495
200 Ga0500637_0253774 3300053178 Unclassified 980
201 Ga0500611_000083 3300053727 Bacteria 29347

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053156 Ga0500622_0000183 Ga0500622_0000183_19849_20325 135
2 3300009174 Ga0105241_10815503 Ga0105241_108155031 136
3 3300031507 Ga0307509_10067402 Ga0307509_100674022 136
4 3300013297 Ga0157378_11294102 Ga0157378_112941021 137
5 3300046460 Ga0495638_0168032 Ga0495638_0168032_402_875 137
6 3300053727 Ga0500611_000083 Ga0500611_000083_198_671 137
7 3300003322 rootL2_10010023 rootL2_100100233 138
8 3300005563 Ga0068855_100000206 Ga0068855_10000020625 138
9 3300005614 Ga0068856_100142820 Ga0068856_1001428203 138
10 3300025949 Ga0207667_10000009 Ga0207667_1000000998 138
11 3300026078 Ga0207702_10640368 Ga0207702_106403682 138
12 3300046471 Ga0495650_0106423 Ga0495650_0106423_412_885 138
13 3300046507 Ga0495606_0009459 Ga0495606_0009459_4690_5163 138
14 3300025961 Ga0207712_10023060 Ga0207712_100230604 139
15 3300047320 Ga0495672_0009625 Ga0495672_0009625_467_937 139
16 3300005842 Ga0068858_100951778 Ga0068858_1009517781 140
17 3300009545 Ga0105237_10005064 Ga0105237_100050649 140
18 3300013297 Ga0157378_10044390 Ga0157378_100443905 140
19 3300013308 Ga0157375_10252187 Ga0157375_102521872 140
20 3300025914 Ga0207671_10007035 Ga0207671_100070354 141
21 3300037418 Ga0395900_0000330 Ga0395900_0000330_19886_20359 141
22 3300044658 Ga0466972_0019301 Ga0466972_0019301_1435_1908 141
23 3300044735 Ga0466968_0374332 Ga0466968_0374332_211_684 141
24 3300003320 rootH2_10071795 rootH2_100717952 144
25 3300003322 rootL2_10062250 rootL2_100622503 144
26 3300003323 rootH1_10116303 rootH1_101163032 144
27 3300009553 Ga0105249_10192528 Ga0105249_101925282 145
28 3300025961 Ga0207712_10128121 Ga0207712_101281212 145
29 3300005614 Ga0068856_100001369 Ga0068856_1000013697 147
30 3300003320 rootH2_10071794 rootH2_100717942 150
31 3300003322 rootL2_10062251 rootL2_100622517 150
32 3300026078 Ga0207702_10252016 Ga0207702_102520162 150
33 3300037312 Ga0395899_0210146 Ga0395899_0210146_154_627 150
34 3300037418 Ga0395900_0029340 Ga0395900_0029340_3116_3589 150
35 3300037466 Ga0395898_0032848 Ga0395898_0032848_2643_3116 150
36 3300037471 Ga0395905_0000769 Ga0395905_0000769_27914_28387 150
37 3300038443 Ga0395901_0002005 Ga0395901_0002005_4531_5004 150
38 iso_pu_bacteria 2919692658 2919693107 151
39 3300046528 Ga0495642_0103405 Ga0495642_0103405_138_611 152
40 3300046558 Ga0495633_0286487 Ga0495633_0286487_138_611 152
41 3300047447 Ga0495685_041661 Ga0495685_041661_1046_1519 152
42 3300025961 Ga0207712_11124226 Ga0207712_111242262 153
43 iso_pu_bacteria 2919437846 2919441597 153
44 iso_pu_bacteria 2928078545 2928081440 153
45 iso_pu_bacteria 2977232053 2977233290 153
46 3300005289 Ga0065704_10079609 Ga0065704_100796094 154
47 3300005563 Ga0068855_100841142 Ga0068855_1008411422 156
48 3300005843 Ga0068860_100135230 Ga0068860_1001352302 156
49 3300006237 Ga0097621_100543297 Ga0097621_1005432972 156
50 3300010375 Ga0105239_10001973 Ga0105239_1000197314 156
51 3300013306 Ga0163162_10138772 Ga0163162_101387722 156
52 3300014326 Ga0157380_10880561 Ga0157380_108805611 156
53 3300025914 Ga0207671_10003626 Ga0207671_1000362611 156
54 3300025986 Ga0207658_11321312 Ga0207658_113213121 156
55 3300026023 Ga0207677_10256559 Ga0207677_102565591 156
56 3300028381 Ga0268264_10001221 Ga0268264_1000122123 156
57 3300047320 Ga0495672_0067124 Ga0495672_0067124_1414_1884 156
58 3300002737 JGI25162J39368_1000005 JGI25162J39368_1000005121 157
59 3300002773 JGI25152J39213_1000044 JGI25152J39213_100004480 157
60 3300002774 JGI25150J39212_1000006 JGI25150J39212_10000063 157
61 3300003187 JGI25151J46595_10000024 JGI25151J46595_10000024186 157
62 3300003215 JGI25153J46596_10000026 JGI25153J46596_100000264 157
63 3300003320 rootH2_10026787 rootH2_100267874 157
64 3300003323 rootH1_10107410 rootH1_101074108 157
65 3300003781 Ga0055536_1000002 Ga0055536_100000269 157
66 3300003791 Ga0055530_10001950 Ga0055530_1000195014 157
67 3300005331 Ga0070670_100165317 Ga0070670_1001653173 157
68 3300005335 Ga0070666_10164319 Ga0070666_101643192 157
69 3300005337 Ga0070682_100003510 Ga0070682_1000035105 157
70 3300005339 Ga0070660_100244907 Ga0070660_1002449073 157
71 3300005339 Ga0070660_100434104 Ga0070660_1004341041 157
72 3300005340 Ga0070689_100335628 Ga0070689_1003356282 157
73 3300005341 Ga0070691_10006944 Ga0070691_100069446 157
74 3300005366 Ga0070659_101105293 Ga0070659_1011052931 157
75 3300005457 Ga0070662_100153866 Ga0070662_1001538662 157
76 3300005471 Ga0070698_100070190 Ga0070698_1000701902 157
77 3300005471 Ga0070698_100295396 Ga0070698_1002953963 157
78 3300005539 Ga0068853_100024307 Ga0068853_1000243078 157
79 3300005539 Ga0068853_100307660 Ga0068853_1003076602 157
80 3300005547 Ga0070693_100037295 Ga0070693_1000372951 157
81 3300005548 Ga0070665_100000001 Ga0070665_100000001683 157
82 3300005563 Ga0068855_100171234 Ga0068855_1001712342 157
83 3300005563 Ga0068855_102241224 Ga0068855_1022412241 157
84 3300005577 Ga0068857_100000416 Ga0068857_10000041616 157
85 3300005577 Ga0068857_100059209 Ga0068857_1000592092 157
86 3300005614 Ga0068856_100033066 Ga0068856_1000330663 157
87 3300005616 Ga0068852_100037777 Ga0068852_1000377772 157
88 3300005617 Ga0068859_100169349 Ga0068859_1001693492 157
89 3300005618 Ga0068864_100272036 Ga0068864_1002720363 157
90 3300005843 Ga0068860_100000111 Ga0068860_10000011198 157
91 3300006844 Ga0075428_100944755 Ga0075428_1009447551 157
92 3300006931 Ga0097620_100169354 Ga0097620_1001693542 157
93 3300009011 Ga0105251_10218084 Ga0105251_102180842 157
94 3300009093 Ga0105240_10013673 Ga0105240_100136733 157
95 3300009093 Ga0105240_10033871 Ga0105240_100338711 157
96 3300009093 Ga0105240_10358278 Ga0105240_103582783 157
97 3300009093 Ga0105240_11343170 Ga0105240_113431701 157
98 3300009093 Ga0105240_11703702 Ga0105240_117037021 157
99 3300009174 Ga0105241_10000319 Ga0105241_1000031926 157
100 3300009545 Ga0105237_10069915 Ga0105237_100699156 157
101 3300009545 Ga0105237_10170753 Ga0105237_101707533 157
102 3300009545 Ga0105237_10383540 Ga0105237_103835402 157
103 3300009553 Ga0105249_10022037 Ga0105249_100220378 157
104 3300010375 Ga0105239_10022723 Ga0105239_100227232 157
105 3300010375 Ga0105239_10138602 Ga0105239_101386024 157
106 3300010375 Ga0105239_11086850 Ga0105239_110868502 157
107 3300013100 Ga0157373_11244393 Ga0157373_112443931 157
108 3300013102 Ga0157371_10305774 Ga0157371_103057742 157
109 3300013104 Ga0157370_10000479 Ga0157370_1000047919 157
110 3300013104 Ga0157370_10010061 Ga0157370_1001006111 157
111 3300013104 Ga0157370_10174756 Ga0157370_101747562 157
112 3300013297 Ga0157378_10106367 Ga0157378_101063672 157
113 3300013306 Ga0163162_10000101 Ga0163162_1000010159 157
114 3300013306 Ga0163162_10949091 Ga0163162_109490912 157
115 3300013307 Ga0157372_10049421 Ga0157372_100494216 157
116 3300013307 Ga0157372_10364300 Ga0157372_103643002 157
117 3300014497 Ga0182008_10000023 Ga0182008_1000002334 157
118 3300015261 Ga0182006_1091958 Ga0182006_10919582 157
119 3300015682 Ga0183373_1002 Ga0183373_1002483 157
120 3300025233 Ga0209437_100043 Ga0209437_100043277 157
121 3300025245 Ga0207425_1000003 Ga0207425_10000033 157
122 3300025258 Ga0209129_1000022 Ga0209129_10000223 157
123 3300025292 Ga0209676_1000022 Ga0209676_1000022471 157
124 3300025294 Ga0209025_1000007 Ga0209025_10000072 157
125 3300025297 Ga0209758_1000012 Ga0209758_10000123 157
126 3300025298 Ga0209050_1000020 Ga0209050_100002068 157
127 3300025304 Ga0209257_1000001 Ga0209257_10000011123 157
128 3300025903 Ga0207680_10386936 Ga0207680_103869361 157
129 3300025904 Ga0207647_10012780 Ga0207647_100127803 157
130 3300025911 Ga0207654_10005271 Ga0207654_100052717 157
131 3300025911 Ga0207654_10317891 Ga0207654_103178911 157
132 3300025912 Ga0207707_10000721 Ga0207707_1000072117 157
133 3300025913 Ga0207695_10000084 Ga0207695_10000084190 157
134 3300025913 Ga0207695_10000323 Ga0207695_1000032340 157
135 3300025913 Ga0207695_10017176 Ga0207695_100171768 157
136 3300025913 Ga0207695_10340539 Ga0207695_103405393 157
137 3300025913 Ga0207695_10632909 Ga0207695_106329091 157
138 3300025914 Ga0207671_10153665 Ga0207671_101536652 157
139 3300025917 Ga0207660_10001254 Ga0207660_1000125416 157
140 3300025918 Ga0207662_10369298 Ga0207662_103692982 157
141 3300025921 Ga0207652_10002045 Ga0207652_100020451 157
142 3300025924 Ga0207694_10190291 Ga0207694_101902912 157
143 3300025925 Ga0207650_10024604 Ga0207650_100246044 157
144 3300025932 Ga0207690_10482928 Ga0207690_104829281 157
145 3300025933 Ga0207706_10561472 Ga0207706_105614721 157
146 3300025936 Ga0207670_10933513 Ga0207670_109335131 157
147 3300025942 Ga0207689_10998889 Ga0207689_109988891 157
148 3300025949 Ga0207667_10000135 Ga0207667_1000013524 157
149 3300025949 Ga0207667_12034044 Ga0207667_120340441 157
150 3300025961 Ga0207712_10143263 Ga0207712_101432632 157
151 3300025961 Ga0207712_10203640 Ga0207712_102036402 157
152 3300026041 Ga0207639_10007875 Ga0207639_100078754 157
153 3300026095 Ga0207676_10169315 Ga0207676_101693151 157
154 3300026116 Ga0207674_10004100 Ga0207674_100041009 157
155 3300026142 Ga0207698_10122263 Ga0207698_101222632 157
156 3300028379 Ga0268266_10000049 Ga0268266_1000004944 157
157 3300028381 Ga0268264_10000313 Ga0268264_100003132 157
158 3300028786 Ga0307517_10002048 Ga0307517_1000204825 157
159 3300028786 Ga0307517_10088138 Ga0307517_100881382 157
160 3300031247 Ga0265340_10130525 Ga0265340_101305252 157
161 3300031251 Ga0265327_10038135 Ga0265327_100381352 157
162 3300031456 Ga0307513_10083325 Ga0307513_100833254 157
163 3300031456 Ga0307513_10503089 Ga0307513_105030891 157
164 3300031595 Ga0265313_10021797 Ga0265313_100217972 157
165 3300031731 Ga0307405_10000008 Ga0307405_1000000863 157
166 3300031903 Ga0307407_10000037 Ga0307407_1000003750 157
167 3300031903 Ga0307407_10016078 Ga0307407_100160784 157
168 3300032002 Ga0307416_100000001 Ga0307416_100000001127 157
169 3300032002 Ga0307416_100000048 Ga0307416_10000004818 157
170 3300032004 Ga0307414_10006098 Ga0307414_100060983 157
171 3300032005 Ga0307411_10515570 Ga0307411_105155701 157
172 3300032005 Ga0307411_11735985 Ga0307411_117359852 157
173 3300037418 Ga0395900_0053199 Ga0395900_0053199_2192_2665 157
174 3300037471 Ga0395905_0001627 Ga0395905_0001627_4676_5149 157
175 3300041486 Ga0451807_2733501 Ga0451807_2733501_762_1235 157
176 3300046471 Ga0495650_0054044 Ga0495650_0054044_189_668 157
177 3300046474 Ga0495605_0084612 Ga0495605_0084612_117_590 157
178 3300046507 Ga0495606_0021447 Ga0495606_0021447_3301_3777 157
179 3300046513 Ga0495616_0004631 Ga0495616_0004631_5736_6209 157
180 3300046542 Ga0495597_0142704 Ga0495597_0142704_317_790 157
181 3300046616 Ga0495668_0000050 Ga0495668_0000050_28998_29474 157
182 3300047443 Ga0495687_000001 Ga0495687_000001_382675_383148 157
183 3300047472 Ga0495686_0000249 Ga0495686_0000249_47369_47848 157
184 3300047472 Ga0495686_0293121 Ga0495686_0293121_76_549 157
185 3300047472 Ga0495686_0368449 Ga0495686_0368449_214_687 157
186 3300048089 Ga0495614_0023524 Ga0495614_0023524_442_918 157
187 3300048904 Ga0496101_0181280 Ga0496101_0181280_65_541 157
188 3300048918 Ga0496115_0360832 Ga0496115_0360832_294_767 157
189 3300048918 Ga0496115_0500563 Ga0496115_0500563_179_652 157
190 3300048929 Ga0496126_0007733 Ga0496126_0007733_6862_7338 157
191 3300049459 Ga0495678_008377 Ga0495678_008377_101_574 157
192 3300049671 Ga0501238_025790 Ga0501238_025790_350_826 157
193 3300049758 Ga0501241_000045 Ga0501241_000045_4250_4726 157
194 3300049823 Ga0501044_0192461 Ga0501044_0192461_1311_1814 157
195 3300050508 nmdc:mga09592_1710090_c1 nmdc:mga09592_1710090_c1_23_496 157
196 3300053080 Ga0500635_0061749 Ga0500635_0061749_777_1253 157
197 3300053092 Ga0500583_0000538 Ga0500583_0000538_2201_2674 157
198 3300053098 Ga0500650_0097217 Ga0500650_0097217_148_621 157
199 3300053105 Ga0500557_020178 Ga0500557_020178_275_748 157
200 3300053139 Ga0500568_0032194 Ga0500568_0032194_851_1324 157
201 3300053147 Ga0500589_077611 Ga0500589_077611_968_1441 157
202 3300053151 Ga0500604_0026386 Ga0500604_0026386_1177_1650 157
203 3300053156 Ga0500622_0000012 Ga0500622_0000012_375388_375861 157
204 3300053156 Ga0500622_0000610 Ga0500622_0000610_24558_25031 157
205 3300053178 Ga0500637_0253774 Ga0500637_0253774_27_503 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00210

Ferritin

Ferritin-like domain

45

166

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6sev-assembly1.cif.gz_C-2 structure of dps from listeria innocua soaked with 10 mm zinc for 120 minutes 0.9218 16 156
5h46-assembly1.cif.gz_A mycobacterium smegmatis dps1 mutant - f47e 0.9204 7 157
2yw7-assembly1.cif.gz_G crystal structure of c-terminal deletion mutant of mycobacterium smegmatis dps 0.9181 13 156
1ji5-assembly1.cif.gz_A dlp-1 from bacillus anthracis 0.9174 15 157
5h46-assembly1.cif.gz_A mycobacterium smegmatis dps1 mutant - f47e 0.9147 7 157
ID Description Score Start End Superfamily
2yw7F00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9184 10 156 1.20.1260.10
1ji5D00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9181 15 157 1.20.1260.10
1velA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9141 6 157 1.20.1260.10
2yw7H00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9138 12 157 1.20.1260.10
2yw7A00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9133 10 156 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A5N7Z669-F1-model_v4 deleted 0.977 24 157
AF-A0A519VX28-F1-model_v4 DNA starvation/stationary phase protection protein 0.9651 30 157 GO:0008199
GO:0016722
AF-A0A519VX28-F1-model_v4 DNA starvation/stationary phase protection protein 0.9506 30 157 GO:0008199
GO:0016722
AF-A0A4R1M2E3-F1-model_v4 Starvation-inducible DNA-binding protein 0.9481 1 157 GO:0003677
GO:0008199
GO:0016722
AF-A0A536WE18-F1-model_v4 DNA starvation/stationary phase protection protein 0.9468 16 157 GO:0008199
GO:0016722

Feature Viewer

pLDDT pTM Quality
93.37 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map