F313698

General Info

Members Datasets Scaffolds Average Seq Length
205 132 205 242

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10340911|Ga0075433_103409112
Length 275
Sequence VPAPEISVVIPVYNEEENLPVLAAEVQGALHAIGRPYEAIYVDDGSTDDSPGILQRLAQEDPAVRVIRQRRNSGQSAALDAGFRFARGAVVVTLDADLQNDPADIPRLLERLGSYDVVCGVRANRQDPWVRKVSSRIANAVRNRVTHDAVTDVGCTLRAVRAEYLRRVPMFTGMHRFLPTLLKMEGARVTEVPVHHRPRLHGQPKYNIRNRIWRALADLFAVRWMQKRWLDRRLSEEIDAWNTTPSGSPSDSPVKPCSSAVSSSSGSPPSGAARA

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
68 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
69 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
102 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
103 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
106 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
107 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
108 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
109 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
110 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
111 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
112 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
115 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
116 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
117 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
118 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
119 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
120 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
121 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
123 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
124 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
125 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
126 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
127 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
128 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
129 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
130 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
131 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
132 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 93.66
Stem 0
Stem Tuber 0
Unclassified 6.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10113789 3300005295 Bacteria 2316
2 Ga0070683_100000057 3300005329 Bacteria 82440
3 Ga0070683_100215389 3300005329 Bacteria 1825
4 Ga0070690_100069284 3300005330 Bacteria 2289
5 Ga0070670_100000131 3300005331 Bacteria 70778
6 Ga0068869_100019694 3300005334 Bacteria 4616
7 Ga0070666_10064834 3300005335 Bacteria 2478
8 Ga0070666_10233970 3300005335 Bacteria 1298
9 Ga0070682_100000003 3300005337 Bacteria 469319
10 Ga0068868_100013476 3300005338 Bacteria 5994
11 Ga0068868_100023563 3300005338 Bacteria 4660
12 Ga0070689_100002826 3300005340 Bacteria 11420
13 Ga0070689_100621016 3300005340 Bacteria 938
14 Ga0070661_100637379 3300005344 Bacteria 864
15 Ga0070669_100000122 3300005353 Bacteria 71837
16 Ga0070675_100000038 3300005354 Bacteria 84939
17 Ga0070675_100180956 3300005354 Bacteria 1823
18 Ga0070675_100183474 3300005354 Bacteria 1810
19 Ga0070671_100570243 3300005355 Bacteria 977
20 Ga0070673_100049734 3300005364 Bacteria 3274
21 Ga0070688_100137222 3300005365 Bacteria 1657
22 Ga0070703_10126333 3300005406 Bacteria 934
23 Ga0070713_100002302 3300005436 Bacteria 12427
24 Ga0070701_10133680 3300005438 Bacteria 1412
25 Ga0070700_100000076 3300005441 Bacteria 67387
26 Ga0070708_100001180 3300005445 Bacteria 20116
27 Ga0070708_100323027 3300005445 Bacteria 1454
28 Ga0070678_100616475 3300005456 Bacteria 970
29 Ga0070662_100037549 3300005457 Bacteria 3435
30 Ga0070706_100712567 3300005467 Bacteria 930
31 Ga0070707_100106685 3300005468 Bacteria 2717
32 Ga0070707_100167153 3300005468 Bacteria 2144
33 Ga0070707_100356029 3300005468 Bacteria 1422
34 Ga0070698_100136240 3300005471 Bacteria 2409
35 Ga0070698_100160768 3300005471 Bacteria 2190
36 Ga0070699_100445659 3300005518 Bacteria 1173
37 Ga0070684_100059922 3300005535 Bacteria 3328
38 Ga0068853_100201073 3300005539 Bacteria 1813
39 Ga0070672_100000802 3300005543 Bacteria 18741
40 Ga0070686_100006583 3300005544 Bacteria 6469
41 Ga0070695_100000138 3300005545 Bacteria 33654
42 Ga0070696_100403162 3300005546 Bacteria 1070
43 Ga0070665_100000379 3300005548 Bacteria 65890
44 Ga0070704_100194654 3300005549 Bacteria 1632
45 Ga0068857_100037040 3300005577 Bacteria 4321
46 Ga0068854_100008762 3300005578 Bacteria 6513
47 Ga0068854_100089564 3300005578 Bacteria 2287
48 Ga0068854_100495288 3300005578 Bacteria 1028
49 Ga0070702_100036519 3300005615 Bacteria 2722
50 Ga0068852_100598901 3300005616 Bacteria 1106
51 Ga0068859_100147072 3300005617 Bacteria 2431
52 Ga0068864_100000059 3300005618 Bacteria 125184
53 Ga0068864_100279684 3300005618 Bacteria 1557
54 Ga0068861_100051191 3300005719 Bacteria 3134
55 Ga0068861_100285195 3300005719 Bacteria 1424
56 Ga0068870_10026782 3300005840 Bacteria 2877
57 Ga0068858_100000400 3300005842 Bacteria 45147
58 Ga0075428_100097666 3300006844 Bacteria 3202
59 Ga0075428_100502617 3300006844 Bacteria 1297
60 Ga0075431_100007146 3300006847 Bacteria 11097
61 Ga0075431_100136410 3300006847 Bacteria 2530
62 Ga0075433_10340911 3300006852 Bacteria 1325
63 Ga0075434_100012269 3300006871 Bacteria 8121
64 Ga0075434_100129233 3300006871 Bacteria 2544
65 Ga0075429_100003964 3300006880 Bacteria 12660
66 Ga0075429_100440155 3300006880 Bacteria 1142
67 Ga0068865_100139130 3300006881 Bacteria 1829
68 Ga0075436_100050893 3300006914 Bacteria 2859
69 Ga0075436_100296708 3300006914 Bacteria 1158
70 Ga0097620_100147071 3300006931 Bacteria 2431
71 Ga0075435_100000130 3300007076 Bacteria 42659
72 Ga0075435_100040466 3300007076 Bacteria 3721
73 Ga0075435_100062258 3300007076 Bacteria 3028
74 Ga0111539_10000006 3300009094 Bacteria 463720
75 Ga0111539_10053858 3300009094 Unclassified 4789
76 Ga0105245_10000003 3300009098 Bacteria 488207
77 Ga0105245_10006765 3300009098 Bacteria 10054
78 Ga0105245_10076550 3300009098 Bacteria 3048
79 Ga0114129_10058390 3300009147 Bacteria 5396
80 Ga0114129_10545327 3300009147 Bacteria 1509
81 Ga0114129_10605646 3300009147 Bacteria 1419
82 Ga0114129_11559458 3300009147 Bacteria 810
83 Ga0105238_10000001 3300009551 Bacteria 2036163
84 Ga0105239_10125323 3300010375 Bacteria 2854
85 Ga0105246_10270298 3300011119 Bacteria 1359
86 Ga0157369_10000166 3300013105 Bacteria 93696
87 Ga0157374_10000037 3300013296 Bacteria 170359
88 Ga0157378_10000863 3300013297 Bacteria 28088
89 Ga0157378_10002207 3300013297 Bacteria 17279
90 Ga0157378_10012304 3300013297 Bacteria 7492
91 Ga0157378_11125255 3300013297 Bacteria 823
92 Ga0163162_10012658 3300013306 Bacteria 8238
93 Ga0157375_10000011 3300013308 Bacteria 334557
94 Ga0157375_10000031 3300013308 Bacteria 195209
95 Ga0157375_10001289 3300013308 Bacteria 21639
96 Ga0157380_10121102 3300014326 Bacteria 2216
97 Ga0157377_10000008 3300014745 Bacteria 394748
98 Ga0157377_10000081 3300014745 Bacteria 74282
99 Ga0157377_10146303 3300014745 Bacteria 1457
100 Ga0157376_10000011 3300014969 Bacteria 307434
101 Ga0213873_10000003 3300021358 Bacteria 973849
102 Ga0213873_10000449 3300021358 Bacteria 6654
103 Ga0213876_10000003 3300021384 Bacteria 973849
104 Ga0213876_10000073 3300021384 Bacteria 120468
105 Ga0213876_10001076 3300021384 Bacteria 17550
106 Ga0207653_10143032 3300025885 Bacteria 876
107 Ga0207684_10227227 3300025910 Bacteria 1610
108 Ga0207646_10043246 3300025922 Bacteria 4046
109 Ga0207681_10000028 3300025923 Bacteria 189881
110 Ga0207681_10310672 3300025923 Bacteria 1250
111 Ga0207694_10000001 3300025924 Bacteria 4078485
112 Ga0207650_10000021 3300025925 Bacteria 322394
113 Ga0207650_10108320 3300025925 Bacteria 2147
114 Ga0207659_10000009 3300025926 Bacteria 308304
115 Ga0207659_10132787 3300025926 Bacteria 1924
116 Ga0207659_10396505 3300025926 Bacteria 1153
117 Ga0207687_10000002 3300025927 Bacteria 975489
118 Ga0207687_10000384 3300025927 Bacteria 29806
119 Ga0207700_10003892 3300025928 Bacteria 8715
120 Ga0207644_10570748 3300025931 Bacteria 938
121 Ga0207706_10081106 3300025933 Bacteria 2851
122 Ga0207686_10099396 3300025934 Bacteria 1939
123 Ga0207670_10001169 3300025936 Bacteria 13839
124 Ga0207704_10226495 3300025938 Bacteria 1387
125 Ga0207665_10084964 3300025939 Bacteria 2184
126 Ga0207665_10126470 3300025939 Bacteria 1810
127 Ga0207691_10000132 3300025940 Bacteria 68694
128 Ga0207689_10008381 3300025942 Bacteria 9002
129 Ga0207689_10027133 3300025942 Bacteria 4794
130 Ga0207689_10334971 3300025942 Unclassified 1257
131 Ga0207661_10000006 3300025944 Bacteria 537727
132 Ga0207661_10554352 3300025944 Bacteria 1053
133 Ga0207651_10069706 3300025960 Bacteria 2484
134 Ga0207651_10348395 3300025960 Bacteria 1246
135 Ga0207640_10000852 3300025981 Bacteria 17300
136 Ga0207677_10000006 3300026023 Bacteria 283855
137 Ga0207677_10000126 3300026023 Bacteria 63024
138 Ga0207703_10000004 3300026035 Bacteria 526312
139 Ga0207639_10000015 3300026041 Bacteria 265362
140 Ga0207708_10000010 3300026075 Bacteria 227178
141 Ga0207648_10196730 3300026089 Bacteria 1787
142 Ga0207648_10242021 3300026089 Bacteria 1606
143 Ga0207676_10000007 3300026095 Bacteria 591074
144 Ga0207676_10341425 3300026095 Bacteria 1382
145 Ga0207674_10261176 3300026116 Bacteria 1679
146 Ga0207675_100051326 3300026118 Bacteria 3848
147 Ga0207675_100278207 3300026118 Bacteria 1625
148 Ga0207675_100460238 3300026118 Bacteria 1262
149 Ga0207683_10754294 3300026121 Bacteria 903
150 Ga0207428_10000007 3300027907 Bacteria 463715
151 Ga0268266_10001813 3300028379 Bacteria 24169
152 Ga0268264_10006668 3300028381 Bacteria 9712
153 Ga0316579_10120030 3300031691 Bacteria 1263
154 Ga0316576_10087515 3300031727 Unclassified 2318
155 Ga0316576_10279194 3300031727 Bacteria 1251
156 Ga0316578_10152188 3300031728 Bacteria 1394
157 Ga0307416_100957297 3300032002 Bacteria 958
158 Ga0373929_0012602 3300035085 Bacteria 1609
159 Ga0373932_0000195 3300035112 Bacteria 17704
160 Ga0373941_0002322 3300035115 Bacteria 4170
161 Ga0316574_0279390 3300035398 Bacteria 1064
162 Ga0316574_0302662 3300035398 Bacteria 1017
163 Ga0316582_0358875 3300036647 Bacteria 1003
164 Ga0400490_08794 3300038726 Bacteria 10026
165 Ga0400491_18336 3300038727 Bacteria 8316
166 Ga0400488_52898 3300038741 Bacteria 5489
167 Ga0436365_0087243 3300039437 Bacteria 2200
168 Ga0436365_0537254 3300039437 Bacteria 270734
169 Ga0436365_0745905 3300039437 Bacteria 18051
170 Ga0436365_1177885 3300039437 Bacteria 1708
171 Ga0436365_1453293 3300039437 Bacteria 17555
172 Ga0436365_1695462 3300039437 Bacteria 3456
173 Ga0436362_0514030 3300039453 Bacteria 14797
174 Ga0436362_1234996 3300039453 Bacteria 292548
175 Ga0451839_0174987 3300041496 Bacteria 2010
176 Ga0451577_0000134 3300042876 Bacteria 165856
177 Ga0451577_0005636 3300042876 Bacteria 12724
178 Ga0451577_0045393 3300042876 Bacteria 3934
179 Ga0451577_0119937 3300042876 Bacteria 2356
180 Ga0453683_0008797 3300044673 Bacteria 6764
181 Ga0453684_0000426 3300044712 Bacteria 172005
182 Ga0453684_0036138 3300044712 Bacteria 6813
183 Ga0495620_0009482 3300046515 Bacteria 5174
184 Ga0495679_062358 3300047446 Bacteria 1090
185 Ga0501048_0319677 3300049582 Bacteria 1106
186 Ga0501073_0006187 3300049589 Bacteria 8933
187 Ga0501080_0153624 3300049742 Bacteria 2126
188 Ga0501083_0005167 3300049744 Bacteria 9234
189 nmdc:mga05p37_522878_c1 3300050507 Bacteria 1357
190 nmdc:mga05p37_639903_c1 3300050507 Bacteria 1193
191 nmdc:mga09592_19029_c1 3300050508 Bacteria 5635
192 nmdc:mga06r32_107839_c1 3300050510 Bacteria 2737
193 nmdc:mga06r32_7387_c1 3300050510 Bacteria 9889
194 nmdc:mga08y16_11_c1 3300050511 Bacteria 463712
195 nmdc:mga08y16_48014_c1 3300050511 Unclassified 4468
196 nmdc:mga0n895_200300_c1 3300050512 Bacteria 2028
197 nmdc:mga0n895_20209_c1 3300050512 Bacteria 6205
198 nmdc:mga0n895_574063_c1 3300050512 Bacteria 1132
199 nmdc:mga0n895_929983_c1 3300050512 Bacteria 854
200 nmdc:mga0rr50_36303_c1 3300050513 Bacteria 3548
201 nmdc:mga0rr50_3974_c2 3300050513 Bacteria 5131
202 nmdc:mga0rr50_80_c1 3300050513 Bacteria 53811
203 nmdc:mga08x19_17263_c1 3300050514 Bacteria 4414
204 Ga0495655_0000391 3300053083 Bacteria 7440
205 Ga0495655_0074402 3300053083 Bacteria 957

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005353 Ga0070669_100000122 Ga0070669_10000012258 223
2 3300025923 Ga0207681_10000028 Ga0207681_100000284 223
3 3300005335 Ga0070666_10064834 Ga0070666_100648342 228
4 3300044673 Ga0453683_0008797 Ga0453683_0008797_692_1381 228
5 3300006844 Ga0075428_100502617 Ga0075428_1005026172 230
6 3300006847 Ga0075431_100136410 Ga0075431_1001364103 230
7 3300006880 Ga0075429_100003964 Ga0075429_1000039647 230
8 3300026118 Ga0207675_100460238 Ga0207675_1004602381 235
9 3300005329 Ga0070683_100000057 Ga0070683_10000005736 236
10 3300005331 Ga0070670_100000131 Ga0070670_10000013156 236
11 3300005338 Ga0068868_100013476 Ga0068868_1000134762 236
12 3300005344 Ga0070661_100637379 Ga0070661_1006373791 236
13 3300005535 Ga0070684_100059922 Ga0070684_1000599224 236
14 3300005578 Ga0068854_100008762 Ga0068854_1000087624 236
15 3300005578 Ga0068854_100089564 Ga0068854_1000895642 236
16 3300013105 Ga0157369_10000166 Ga0157369_1000016677 236
17 3300013296 Ga0157374_10000037 Ga0157374_1000003757 236
18 3300013308 Ga0157375_10001289 Ga0157375_1000128923 236
19 3300014745 Ga0157377_10000008 Ga0157377_1000000856 236
20 3300025925 Ga0207650_10000021 Ga0207650_10000021126 236
21 3300025944 Ga0207661_10000006 Ga0207661_10000006255 236
22 3300025981 Ga0207640_10000852 Ga0207640_100008524 236
23 3300026023 Ga0207677_10000126 Ga0207677_1000012653 236
24 3300031728 Ga0316578_10152188 Ga0316578_101521882 236
25 3300042876 Ga0451577_0000134 Ga0451577_0000134_93642_94376 236
26 3300044712 Ga0453684_0000426 Ga0453684_0000426_77607_78341 236
27 3300005334 Ga0068869_100019694 Ga0068869_1000196947 237
28 3300005354 Ga0070675_100180956 Ga0070675_1001809563 237
29 3300005438 Ga0070701_10133680 Ga0070701_101336802 237
30 3300005457 Ga0070662_100037549 Ga0070662_1000375493 237
31 3300005471 Ga0070698_100160768 Ga0070698_1001607683 237
32 3300005545 Ga0070695_100000138 Ga0070695_10000013814 237
33 3300005546 Ga0070696_100403162 Ga0070696_1004031622 237
34 3300005549 Ga0070704_100194654 Ga0070704_1001946542 237
35 3300005577 Ga0068857_100037040 Ga0068857_1000370404 237
36 3300006871 Ga0075434_100012269 Ga0075434_1000122698 237
37 3300006914 Ga0075436_100050893 Ga0075436_1000508932 237
38 3300006914 Ga0075436_100296708 Ga0075436_1002967081 237
39 3300007076 Ga0075435_100000130 Ga0075435_10000013026 237
40 3300007076 Ga0075435_100040466 Ga0075435_1000404663 237
41 3300009094 Ga0111539_10000006 Ga0111539_10000006370 237
42 3300009147 Ga0114129_11559458 Ga0114129_115594581 237
43 3300009551 Ga0105238_10000001 Ga0105238_100000011736 237
44 3300014745 Ga0157377_10000081 Ga0157377_1000008169 237
45 3300014969 Ga0157376_10000011 Ga0157376_10000011203 237
46 3300021358 Ga0213873_10000449 Ga0213873_100004495 237
47 3300021384 Ga0213876_10000073 Ga0213876_10000073108 237
48 3300025923 Ga0207681_10310672 Ga0207681_103106721 237
49 3300025924 Ga0207694_10000001 Ga0207694_100000012768 237
50 3300025926 Ga0207659_10132787 Ga0207659_101327872 237
51 3300025933 Ga0207706_10081106 Ga0207706_100811063 237
52 3300025942 Ga0207689_10027133 Ga0207689_100271337 237
53 3300026116 Ga0207674_10261176 Ga0207674_102611762 237
54 3300027907 Ga0207428_10000007 Ga0207428_10000007369 237
55 3300031691 Ga0316579_10120030 Ga0316579_101200301 237
56 3300035112 Ga0373932_0000195 Ga0373932_0000195_13907_14620 237
57 3300036647 Ga0316582_0358875 Ga0316582_0358875_258_974 237
58 3300039437 Ga0436365_0745905 Ga0436365_0745905_9470_10183 237
59 3300039453 Ga0436362_0514030 Ga0436362_0514030_6496_7209 237
60 3300042876 Ga0451577_0045393 Ga0451577_0045393_1130_1849 237
61 3300050511 nmdc:mga08y16_11_c1 nmdc:mga08y16_11_c1_28812_29525 237
62 3300050512 nmdc:mga0n895_200300_c1 nmdc:mga0n895_200300_c1_424_1251 237
63 3300050513 nmdc:mga0rr50_36303_c1 nmdc:mga0rr50_36303_c1_2259_3086 237
64 3300050513 nmdc:mga0rr50_80_c1 nmdc:mga0rr50_80_c1_37694_38407 237
65 3300050514 nmdc:mga08x19_17263_c1 nmdc:mga08x19_17263_c1_3304_4131 237
66 3300005335 Ga0070666_10233970 Ga0070666_102339702 238
67 3300006847 Ga0075431_100007146 Ga0075431_1000071464 238
68 3300006852 Ga0075433_10340911 Ga0075433_103409112 238
69 3300006871 Ga0075434_100129233 Ga0075434_1001292332 238
70 3300007076 Ga0075435_100062258 Ga0075435_1000622584 238
71 3300009147 Ga0114129_10058390 Ga0114129_100583903 238
72 3300009147 Ga0114129_10605646 Ga0114129_106056463 238
73 3300021384 Ga0213876_10001076 Ga0213876_1000107610 238
74 3300025931 Ga0207644_10570748 Ga0207644_105707481 238
75 3300031727 Ga0316576_10087515 Ga0316576_100875152 238
76 3300035115 Ga0373941_0002322 Ga0373941_0002322_2861_3577 238
77 3300035398 Ga0316574_0279390 Ga0316574_0279390_275_997 238
78 3300035398 Ga0316574_0302662 Ga0316574_0302662_162_884 238
79 3300039437 Ga0436365_1453293 Ga0436365_1453293_10802_11521 238
80 3300042876 Ga0451577_0005636 Ga0451577_0005636_607_1326 238
81 3300044712 Ga0453684_0036138 Ga0453684_0036138_2934_3653 238
82 3300049744 Ga0501083_0005167 Ga0501083_0005167_858_1730 238
83 3300050507 nmdc:mga05p37_522878_c1 nmdc:mga05p37_522878_c1_288_1004 238
84 3300050510 nmdc:mga06r32_7387_c1 nmdc:mga06r32_7387_c1_4049_4771 238
85 3300050512 nmdc:mga0n895_20209_c1 nmdc:mga0n895_20209_c1_1237_2064 238
86 3300050513 nmdc:mga0rr50_3974_c2 nmdc:mga0rr50_3974_c2_643_1359 238
87 3300005330 Ga0070690_100069284 Ga0070690_1000692843 239
88 3300005354 Ga0070675_100183474 Ga0070675_1001834743 239
89 3300005355 Ga0070671_100570243 Ga0070671_1005702432 239
90 3300005365 Ga0070688_100137222 Ga0070688_1001372223 239
91 3300005456 Ga0070678_100616475 Ga0070678_1006164751 239
92 3300005544 Ga0070686_100006583 Ga0070686_1000065832 239
93 3300005548 Ga0070665_100000379 Ga0070665_10000037940 239
94 3300005578 Ga0068854_100495288 Ga0068854_1004952882 239
95 3300005615 Ga0070702_100036519 Ga0070702_1000365193 239
96 3300005616 Ga0068852_100598901 Ga0068852_1005989012 239
97 3300005617 Ga0068859_100147072 Ga0068859_1001470722 239
98 3300005618 Ga0068864_100279684 Ga0068864_1002796843 239
99 3300005719 Ga0068861_100051191 Ga0068861_1000511914 239
100 3300006880 Ga0075429_100440155 Ga0075429_1004401552 239
101 3300006881 Ga0068865_100139130 Ga0068865_1001391303 239
102 3300006931 Ga0097620_100147071 Ga0097620_1001470712 239
103 3300009094 Ga0111539_10053858 Ga0111539_100538584 239
104 3300009098 Ga0105245_10000003 Ga0105245_10000003152 239
105 3300010375 Ga0105239_10125323 Ga0105239_101253232 239
106 3300025925 Ga0207650_10108320 Ga0207650_101083201 239
107 3300025926 Ga0207659_10396505 Ga0207659_103965052 239
108 3300025927 Ga0207687_10000002 Ga0207687_10000002150 239
109 3300025938 Ga0207704_10226495 Ga0207704_102264952 239
110 3300025939 Ga0207665_10084964 Ga0207665_100849642 239
111 3300025939 Ga0207665_10126470 Ga0207665_101264702 239
112 3300025942 Ga0207689_10008381 Ga0207689_1000838110 239
113 3300025942 Ga0207689_10334971 Ga0207689_103349711 239
114 3300025960 Ga0207651_10069706 Ga0207651_100697063 239
115 3300026089 Ga0207648_10196730 Ga0207648_101967302 239
116 3300026095 Ga0207676_10341425 Ga0207676_103414253 239
117 3300026118 Ga0207675_100051326 Ga0207675_1000513262 239
118 3300026121 Ga0207683_10754294 Ga0207683_107542941 239
119 3300028379 Ga0268266_10001813 Ga0268266_1000181319 239
120 3300028381 Ga0268264_10006668 Ga0268264_100066683 239
121 3300035085 Ga0373929_0012602 Ga0373929_0012602_81_956 239
122 3300041496 Ga0451839_0174987 Ga0451839_0174987_1057_1776 239
123 3300049582 Ga0501048_0319677 Ga0501048_0319677_258_1010 239
124 3300050508 nmdc:mga09592_19029_c1 nmdc:mga09592_19029_c1_3700_4419 239
125 3300050510 nmdc:mga06r32_107839_c1 nmdc:mga06r32_107839_c1_1322_2041 239
126 3300050511 nmdc:mga08y16_48014_c1 nmdc:mga08y16_48014_c1_262_984 239
127 3300050512 nmdc:mga0n895_574063_c1 nmdc:mga0n895_574063_c1_88_807 239
128 3300005329 Ga0070683_100215389 Ga0070683_1002153892 240
129 3300005338 Ga0068868_100023563 Ga0068868_1000235632 240
130 3300005340 Ga0070689_100002826 Ga0070689_1000028268 240
131 3300005340 Ga0070689_100621016 Ga0070689_1006210162 240
132 3300005354 Ga0070675_100000038 Ga0070675_10000003852 240
133 3300005364 Ga0070673_100049734 Ga0070673_1000497343 240
134 3300005406 Ga0070703_10126333 Ga0070703_101263331 240
135 3300005436 Ga0070713_100002302 Ga0070713_10000230212 240
136 3300005468 Ga0070707_100106685 Ga0070707_1001066852 240
137 3300005471 Ga0070698_100136240 Ga0070698_1001362403 240
138 3300005543 Ga0070672_100000802 Ga0070672_10000080215 240
139 3300005618 Ga0068864_100000059 Ga0068864_10000005944 240
140 3300005719 Ga0068861_100285195 Ga0068861_1002851952 240
141 3300005840 Ga0068870_10026782 Ga0068870_100267822 240
142 3300005842 Ga0068858_100000400 Ga0068858_1000004002 240
143 3300006844 Ga0075428_100097666 Ga0075428_1000976665 240
144 3300009098 Ga0105245_10076550 Ga0105245_100765504 240
145 3300009147 Ga0114129_10545327 Ga0114129_105453272 240
146 3300011119 Ga0105246_10270298 Ga0105246_102702982 240
147 3300013297 Ga0157378_10000863 Ga0157378_100008633 240
148 3300013297 Ga0157378_10002207 Ga0157378_100022074 240
149 3300013297 Ga0157378_11125255 Ga0157378_111252551 240
150 3300013308 Ga0157375_10000011 Ga0157375_1000001130 240
151 3300013308 Ga0157375_10000031 Ga0157375_10000031144 240
152 3300014326 Ga0157380_10121102 Ga0157380_101211022 240
153 3300014745 Ga0157377_10146303 Ga0157377_101463032 240
154 3300025885 Ga0207653_10143032 Ga0207653_101430322 240
155 3300025926 Ga0207659_10000009 Ga0207659_10000009176 240
156 3300025928 Ga0207700_10003892 Ga0207700_100038926 240
157 3300025936 Ga0207670_10001169 Ga0207670_1000116912 240
158 3300025940 Ga0207691_10000132 Ga0207691_1000013246 240
159 3300025944 Ga0207661_10554352 Ga0207661_105543521 240
160 3300025960 Ga0207651_10348395 Ga0207651_103483951 240
161 3300026023 Ga0207677_10000006 Ga0207677_1000000678 240
162 3300026035 Ga0207703_10000004 Ga0207703_1000000464 240
163 3300026089 Ga0207648_10242021 Ga0207648_102420212 240
164 3300026095 Ga0207676_10000007 Ga0207676_10000007317 240
165 3300026118 Ga0207675_100278207 Ga0207675_1002782072 240
166 3300031727 Ga0316576_10279194 Ga0316576_102791942 240
167 3300032002 Ga0307416_100957297 Ga0307416_1009572972 240
168 3300039437 Ga0436365_0087243 Ga0436365_0087243_36_773 240
169 3300039437 Ga0436365_1177885 Ga0436365_1177885_901_1623 240
170 3300039437 Ga0436365_1695462 Ga0436365_1695462_398_1120 240
171 3300042876 Ga0451577_0119937 Ga0451577_0119937_841_1569 240
172 3300047446 Ga0495679_062358 Ga0495679_062358_57_779 240
173 3300050507 nmdc:mga05p37_639903_c1 nmdc:mga05p37_639903_c1_79_801 240
174 3300050512 nmdc:mga0n895_929983_c1 nmdc:mga0n895_929983_c1_84_806 240
175 3300053083 Ga0495655_0000391 Ga0495655_0000391_880_1602 240
176 3300053083 Ga0495655_0074402 Ga0495655_0074402_25_747 240
177 3300005295 Ga0065707_10113789 Ga0065707_101137892 241
178 3300005337 Ga0070682_100000003 Ga0070682_100000003390 241
179 3300005441 Ga0070700_100000076 Ga0070700_10000007644 241
180 3300005445 Ga0070708_100001180 Ga0070708_1000011805 241
181 3300005445 Ga0070708_100323027 Ga0070708_1003230271 241
182 3300005467 Ga0070706_100712567 Ga0070706_1007125671 241
183 3300005468 Ga0070707_100167153 Ga0070707_1001671532 241
184 3300005468 Ga0070707_100356029 Ga0070707_1003560291 241
185 3300005518 Ga0070699_100445659 Ga0070699_1004456592 241
186 3300005539 Ga0068853_100201073 Ga0068853_1002010733 241
187 3300009098 Ga0105245_10006765 Ga0105245_100067656 241
188 3300013297 Ga0157378_10012304 Ga0157378_1001230410 241
189 3300013306 Ga0163162_10012658 Ga0163162_100126585 241
190 3300021358 Ga0213873_10000003 Ga0213873_10000003331 241
191 3300021384 Ga0213876_10000003 Ga0213876_10000003537 241
192 3300025910 Ga0207684_10227227 Ga0207684_102272272 241
193 3300025922 Ga0207646_10043246 Ga0207646_100432464 241
194 3300025927 Ga0207687_10000384 Ga0207687_1000038417 241
195 3300025934 Ga0207686_10099396 Ga0207686_100993962 241
196 3300026041 Ga0207639_10000015 Ga0207639_10000015188 241
197 3300026075 Ga0207708_10000010 Ga0207708_10000010103 241
198 3300038726 Ga0400490_08794 Ga0400490_08794_8907_9719 241
199 3300038727 Ga0400491_18336 Ga0400491_18336_6657_7469 241
200 3300038741 Ga0400488_52898 Ga0400488_52898_3991_4803 241
201 3300039437 Ga0436365_0537254 Ga0436365_0537254_171025_171750 241
202 3300039453 Ga0436362_1234996 Ga0436362_1234996_290953_291678 241
203 3300046515 Ga0495620_0009482 Ga0495620_0009482_4225_4956 241
204 3300049589 Ga0501073_0006187 Ga0501073_0006187_4428_5183 241
205 3300049742 Ga0501080_0153624 Ga0501080_0153624_64_819 241

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

7

168

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ekp-assembly1.cif.gz_A structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (wt) 0.8679 1 200
5eke-assembly1.cif.gz_A structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (f215a mutant) 0.8664 1 200
5mm0-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) 0.8507 5 229
5eke-assembly1.cif.gz_D structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (f215a mutant) 0.8039 1 224
5ekp-assembly1.cif.gz_D structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (wt) 0.8026 1 224
ID Description Score Start End Superfamily
af_Q9VLQ1_42_326_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8739 6 231 3.90.550.10
af_A4ICW5_2_228_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8597 6 222 3.90.550.10
af_P40350_49_327_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8588 4 231 3.90.550.10
af_Q57964_2_229_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8553 9 232 3.90.550.10
af_P77757_4_230_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.848 4 222 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A4V1ZS11-F1-model_v4 Glycosyltransferase family 2 protein 0.9776 3 107 GO:0005886
GO:0099621
AF-A0A523V6E2-F1-model_v4 Glycosyltransferase 0.9769 1 117 GO:0005886
GO:0016757
AF-A0A7C4KIH1-F1-model_v4 Glycosyltransferase 0.9672 4 116 GO:0005886
GO:0016757
AF-A0A7C5FNM4-F1-model_v4 Glycosyltransferase 0.9635 3 112 GO:0005886
GO:0016757
AF-A0A7C1WWC8-F1-model_v4 Glycosyltransferase 0.9595 1 233 GO:0005886
GO:0099621

Feature Viewer

pLDDT pTM Quality
86.63 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map