F313686

General Info

Members Datasets Scaffolds Average Seq Length
205 132 410 167

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100000139|Ga0075430_10000013934
Length 176
Sequence VSQPVPVGQPGPGVCVLVGPPGAGKSTVGQLVADALGVELRDTDADIEAVAGKPIPDIFVGDGEAHFRTLERAAVAAALTSCQGVLALGGGAVLAEETRAALAGHTVVYLSVELADAVRRVGLGQGRPLLTVNPRATLRHLLDQRRPLYEQVATVTVATDGHGPEEVAAEVLAALR

Samples

Sample ID Description Type Environment
1 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
74 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
75 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
76 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
77 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
78 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
79 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
80 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
81 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
82 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
83 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
84 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
85 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
86 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
87 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
93 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
94 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
95 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
96 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
97 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
98 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
99 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
100 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
101 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
102 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
103 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
104 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
105 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
106 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
107 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
108 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
109 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
110 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
111 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
114 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
115 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
116 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
117 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
118 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
119 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
120 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
121 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
122 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
123 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
124 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
125 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
126 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
127 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
128 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
129 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
130 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
131 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
132 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.54
Metatranscriptomes 0
Isolates 1.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.39
Nodule 0
Rhizoplane 0.98
Rhizosphere 82.44
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075430_100000139 3300006846 Bacteria 46337
2 JGI25406J46586_10024498 3300003203 Bacteria 2363
3 rootH1_10023242 3300003316 Bacteria 4463
4 Ga0070683_100012720 3300005329 Bacteria 7319
5 Ga0070670_100598897 3300005331 Bacteria 986
6 Ga0068869_100007529 3300005334 Bacteria 6966
7 Ga0070660_100101575 3300005339 Bacteria 2279
8 Ga0070660_100737191 3300005339 Bacteria 827
9 Ga0070668_100000250 3300005347 Bacteria 35693
10 Ga0070668_100234686 3300005347 Bacteria 1518
11 Ga0070668_100290064 3300005347 Bacteria 1369
12 Ga0070669_100193337 3300005353 Bacteria 1597
13 Ga0070669_100935958 3300005353 Bacteria 741
14 Ga0070675_100000722 3300005354 Bacteria 23008
15 Ga0070659_100086904 3300005366 Bacteria 2503
16 Ga0070667_100073289 3300005367 Bacteria 2919
17 Ga0070667_100675005 3300005367 Bacteria 955
18 Ga0070663_100053258 3300005455 Bacteria 2888
19 Ga0070678_101043152 3300005456 Bacteria 753
20 Ga0070662_100006428 3300005457 Bacteria 7573
21 Ga0070684_100043165 3300005535 Bacteria 3893
22 Ga0070684_100738451 3300005535 Bacteria 919
23 Ga0068853_100526459 3300005539 Bacteria 1118
24 Ga0070664_100009056 3300005564 Bacteria 8076
25 Ga0068857_100096600 3300005577 Bacteria 2648
26 Ga0068852_100164521 3300005616 Bacteria 2074
27 Ga0068859_100502844 3300005617 Bacteria 1307
28 Ga0068859_101040255 3300005617 Bacteria 900
29 Ga0068864_100067610 3300005618 Bacteria 3103
30 Ga0068864_101139745 3300005618 Bacteria 777
31 Ga0068861_100208964 3300005719 Bacteria 1643
32 Ga0068858_100011782 3300005842 Bacteria 8248
33 Ga0068860_100046037 3300005843 Bacteria 4160
34 Ga0068860_100063709 3300005843 Bacteria 3501
35 Ga0068862_100170077 3300005844 Bacteria 1951
36 Ga0081539_10000873 3300005985 Bacteria 57852
37 Ga0081539_10001256 3300005985 Bacteria 45022
38 Ga0081539_10001767 3300005985 Bacteria 34451
39 Ga0075428_100006055 3300006844 Bacteria 13441
40 Ga0075428_100279230 3300006844 Bacteria 1797
41 Ga0075428_101235472 3300006844 Bacteria 787
42 Ga0075431_100005421 3300006847 Bacteria 12601
43 Ga0075431_100730502 3300006847 Bacteria 966
44 Ga0075434_100531149 3300006871 Bacteria 1197
45 Ga0075429_100003119 3300006880 Bacteria 14081
46 Ga0075429_100004899 3300006880 Bacteria 11536
47 Ga0075429_100353016 3300006880 Bacteria 1287
48 Ga0075429_100449937 3300006880 Bacteria 1128
49 Ga0075429_100698121 3300006880 Bacteria 889
50 Ga0075429_101210826 3300006880 Bacteria 659
51 Ga0097620_100502828 3300006931 Bacteria 1307
52 Ga0097620_101040132 3300006931 Bacteria 900
53 Ga0111539_10004901 3300009094 Bacteria 17426
54 Ga0105245_10014846 3300009098 Bacteria 6784
55 Ga0105247_10286175 3300009101 Bacteria 1138
56 Ga0114129_10001693 3300009147 Bacteria 30058
57 Ga0114129_10019339 3300009147 Bacteria 9700
58 Ga0114129_10259393 3300009147 Bacteria 2330
59 Ga0114129_11478510 3300009147 Bacteria 836
60 Ga0105243_10107357 3300009148 Bacteria 2328
61 Ga0105241_10256477 3300009174 Bacteria 1485
62 Ga0105248_10670842 3300009177 Bacteria 1170
63 Ga0105239_10007795 3300010375 Bacteria 12249
64 Ga0157378_10454273 3300013297 Bacteria 1272
65 Ga0163163_10538165 3300014325 Bacteria 1230
66 Ga0157380_11623906 3300014326 Bacteria 702
67 Ga0157377_10049165 3300014745 Bacteria 2369
68 Ga0157379_11324203 3300014968 Bacteria 696
69 Ga0207688_10029787 3300025901 Bacteria 3008
70 Ga0207662_10123105 3300025918 Bacteria 1628
71 Ga0207649_10609783 3300025920 Bacteria 840
72 Ga0207681_10152694 3300025923 Bacteria 1732
73 Ga0207681_10646179 3300025923 Bacteria 877
74 Ga0207650_10609244 3300025925 Bacteria 919
75 Ga0207650_11454660 3300025925 Bacteria 583
76 Ga0207659_10113198 3300025926 Bacteria 2066
77 Ga0207644_10521374 3300025931 Bacteria 982
78 Ga0207690_10034649 3300025932 Bacteria 3254
79 Ga0207706_10003670 3300025933 Bacteria 14655
80 Ga0207691_10775890 3300025940 Bacteria 806
81 Ga0207689_10004048 3300025942 Bacteria 13319
82 Ga0207689_10657426 3300025942 Bacteria 883
83 Ga0207661_10071458 3300025944 Bacteria 2836
84 Ga0207679_10009140 3300025945 Bacteria 6336
85 Ga0207668_10001017 3300025972 Bacteria 16785
86 Ga0207668_10015969 3300025972 Bacteria 4677
87 Ga0207668_10670924 3300025972 Bacteria 909
88 Ga0207658_10766473 3300025986 Bacteria 874
89 Ga0207703_10042408 3300026035 Bacteria 3650
90 Ga0207678_10016920 3300026067 Bacteria 6403
91 Ga0207678_10043675 3300026067 Bacteria 3878
92 Ga0207678_10138795 3300026067 Bacteria 2074
93 Ga0207708_10013017 3300026075 Bacteria 6207
94 Ga0207648_10578608 3300026089 Bacteria 1033
95 Ga0207676_10098653 3300026095 Bacteria 2416
96 Ga0207674_10038247 3300026116 Bacteria 4984
97 Ga0207675_100049925 3300026118 Bacteria 3904
98 Ga0207675_100609468 3300026118 Bacteria 1095
99 Ga0207683_10196922 3300026121 Bacteria 1831
100 Ga0207698_10058835 3300026142 Bacteria 2981
101 Ga0268266_10126364 3300028379 Bacteria 2283
102 Ga0268266_10616085 3300028379 Bacteria 1043
103 Ga0268265_10017284 3300028380 Bacteria 4974
104 Ga0268265_10097944 3300028380 Bacteria 2361
105 Ga0268265_11653343 3300028380 Bacteria 646
106 Ga0268264_10027434 3300028381 Bacteria 4653
107 Ga0268264_10040665 3300028381 Bacteria 3842
108 Ga0307517_10121435 3300028786 Bacteria 1929
109 Ga0307515_10000182 3300028794 Bacteria 154288
110 Ga0307515_10020212 3300028794 Bacteria 11899
111 Ga0307515_10040616 3300028794 Bacteria 7350
112 Ga0307512_10005047 3300030522 Bacteria 14050
113 Ga0307512_10012106 3300030522 Bacteria 8154
114 Ga0307513_10032160 3300031456 Bacteria 5921
115 Ga0307513_10056797 3300031456 Bacteria 4176
116 Ga0307513_10521852 3300031456 Bacteria 903
117 Ga0307509_10049774 3300031507 Bacteria 4490
118 Ga0307509_10104122 3300031507 Bacteria 2864
119 Ga0307508_10013965 3300031616 Bacteria 7327
120 Ga0307508_10478433 3300031616 Bacteria 839
121 Ga0307516_10000395 3300031730 Bacteria 56947
122 Ga0307516_10052239 3300031730 Bacteria 4001
123 Ga0307516_10075356 3300031730 Bacteria 3228
124 Ga0307516_10193485 3300031730 Bacteria 1758
125 Ga0307405_10015363 3300031731 Bacteria 4146
126 Ga0307405_10245162 3300031731 Bacteria 1330
127 Ga0307413_10178367 3300031824 Bacteria 1512
128 Ga0307413_11212011 3300031824 Bacteria 657
129 Ga0307413_11735703 3300031824 Bacteria 557
130 Ga0307410_10055872 3300031852 Bacteria 2682
131 Ga0307410_10104306 3300031852 Bacteria 2038
132 Ga0307410_10122028 3300031852 Bacteria 1902
133 Ga0326468_10000311 3300031889 Bacteria 5159
134 Ga0307406_10054796 3300031901 Bacteria 2546
135 Ga0307406_10206359 3300031901 Bacteria 1451
136 Ga0307406_10419668 3300031901 Bacteria 1065
137 Ga0307407_10198890 3300031903 Bacteria 1342
138 Ga0307407_10290544 3300031903 Bacteria 1136
139 Ga0307407_10405426 3300031903 Bacteria 979
140 Ga0307407_10801160 3300031903 Bacteria 717
141 Ga0307412_10154559 3300031911 Bacteria 1697
142 Ga0307409_100086466 3300031995 Bacteria 2552
143 Ga0307409_100765266 3300031995 Bacteria 970
144 Ga0307416_100725995 3300032002 Bacteria 1084
145 Ga0307416_101142829 3300032002 Bacteria 884
146 Ga0307416_101311341 3300032002 Bacteria 830
147 Ga0307414_10446991 3300032004 Bacteria 1133
148 Ga0307411_10094823 3300032005 Bacteria 2093
149 Ga0307415_100101308 3300032126 Bacteria 2113
150 Ga0307415_100177778 3300032126 Bacteria 1666
151 Ga0307415_100907565 3300032126 Bacteria 812
152 Ga0307415_101081099 3300032126 Bacteria 750
153 Ga0307415_101473680 3300032126 Bacteria 650
154 Ga0307507_10125778 3300033179 Bacteria 2029
155 Ga0307507_10273519 3300033179 Bacteria 1064
156 Ga0307510_10114824 3300033180 Bacteria 2420
157 Ga0307510_10247451 3300033180 Bacteria 1273
158 Ga0373938_0008188 3300034957 Bacteria 1861
159 Ga0373934_0046666 3300035086 Bacteria 1714
160 Ga0373951_0000131 3300035091 Bacteria 28404
161 Ga0373956_0578454 3300035119 Bacteria 536
162 Ga0373955_0029857 3300035172 Bacteria 2840
163 Ga0373962_0013382 3300035242 Bacteria 2077
164 Ga0373925_0598528 3300037068 Bacteria 908
165 Ga0451791_1038662 3300041451 Bacteria 1270
166 Ga0451837_0316624 3300041494 Bacteria 888
167 Ga0439459_0004041 3300042438 Bacteria 2348
168 Ga0466968_0155165 3300044735 Bacteria 1054
169 Ga0466957_0098268 3300044842 Bacteria 1842
170 Ga0495638_0082278 3300046460 Bacteria 1953
171 Ga0495594_0083085 3300046499 Bacteria 1790
172 Ga0495632_0183185 3300046519 Bacteria 959
173 Ga0495632_0270040 3300046519 Bacteria 759
174 Ga0496108_0000115 3300048911 Bacteria 79928
175 Ga0496126_0249657 3300048929 Bacteria 1479
176 Ga0501031_0152893 3300049568 Bacteria 1508
177 Ga0501047_0061498 3300049581 Bacteria 3623
178 Ga0501081_0222176 3300049743 Bacteria 1374
179 Ga0501045_0208112 3300049824 Bacteria 1457
180 nmdc:mga05p37_160025_c1 3300050507 Bacteria 2751
181 nmdc:mga05p37_261524_c1 3300050507 Bacteria 2071
182 nmdc:mga05p37_3030_c1 3300050507 Bacteria 19513
183 nmdc:mga09592_10007_c1 3300050508 Bacteria 7711
184 nmdc:mga09592_1063961_c1 3300050508 Bacteria 674
185 nmdc:mga09592_632635_c1 3300050508 Bacteria 915
186 nmdc:mga09592_8_c2 3300050508 Bacteria 68121
187 nmdc:mga0qj67_157106_c1 3300050509 Bacteria 1846
188 nmdc:mga0qj67_21_c1 3300050509 Bacteria 15327
189 nmdc:mga0qj67_562_c1 3300050509 Bacteria 25304
190 nmdc:mga06r32_14_c1 3300050510 Bacteria 16008
191 nmdc:mga0n895_1514326_c1 3300050512 Bacteria 637
192 Ga0495619_0013602 3300053085 Bacteria 5128
193 Ga0500651_0033571 3300053093 Bacteria 3235
194 Ga0500641_0027811 3300053096 Bacteria 2204
195 Ga0500650_0188605 3300053098 Bacteria 942
196 Ga0500594_0002037 3300053118 Bacteria 4373
197 Ga0500568_0001945 3300053139 Bacteria 12660
198 Ga0500577_0078173 3300053142 Bacteria 1313
199 Ga0500600_0048000 3300053149 Bacteria 2432
200 Ga0500633_0167359 3300053160 Bacteria 825
201 Ga0500633_0235610 3300053160 Bacteria 682
202 Ga0501082_0175246 3300060353 Bacteria 1865
203 2515718868 2515154129 Bacteria 5584369
204 2516083080 2515154202 Bacteria 5471270
205 8003857231 8003856774 Bacteria 7675274
206 Ga0075430_100000139
207 JGI25406J46586_10024498
208 rootH1_10023242
209 Ga0070683_100012720
210 Ga0070670_100598897
211 Ga0068869_100007529
212 Ga0070660_100101575
213 Ga0070660_100737191
214 Ga0070668_100000250
215 Ga0070668_100234686
216 Ga0070668_100290064
217 Ga0070669_100193337
218 Ga0070669_100935958
219 Ga0070675_100000722
220 Ga0070659_100086904
221 Ga0070667_100073289
222 Ga0070667_100675005
223 Ga0070663_100053258
224 Ga0070678_101043152
225 Ga0070662_100006428
226 Ga0070684_100043165
227 Ga0070684_100738451
228 Ga0068853_100526459
229 Ga0070664_100009056
230 Ga0068857_100096600
231 Ga0068852_100164521
232 Ga0068859_100502844
233 Ga0068859_101040255
234 Ga0068864_100067610
235 Ga0068864_101139745
236 Ga0068861_100208964
237 Ga0068858_100011782
238 Ga0068860_100046037
239 Ga0068860_100063709
240 Ga0068862_100170077
241 Ga0081539_10000873
242 Ga0081539_10001256
243 Ga0081539_10001767
244 Ga0075428_100006055
245 Ga0075428_100279230
246 Ga0075428_101235472
247 Ga0075431_100005421
248 Ga0075431_100730502
249 Ga0075434_100531149
250 Ga0075429_100003119
251 Ga0075429_100004899
252 Ga0075429_100353016
253 Ga0075429_100449937
254 Ga0075429_100698121
255 Ga0075429_101210826
256 Ga0097620_100502828
257 Ga0097620_101040132
258 Ga0111539_10004901
259 Ga0105245_10014846
260 Ga0105247_10286175
261 Ga0114129_10001693
262 Ga0114129_10019339
263 Ga0114129_10259393
264 Ga0114129_11478510
265 Ga0105243_10107357
266 Ga0105241_10256477
267 Ga0105248_10670842
268 Ga0105239_10007795
269 Ga0157378_10454273
270 Ga0163163_10538165
271 Ga0157380_11623906
272 Ga0157377_10049165
273 Ga0157379_11324203
274 Ga0207688_10029787
275 Ga0207662_10123105
276 Ga0207649_10609783
277 Ga0207681_10152694
278 Ga0207681_10646179
279 Ga0207650_10609244
280 Ga0207650_11454660
281 Ga0207659_10113198
282 Ga0207644_10521374
283 Ga0207690_10034649
284 Ga0207706_10003670
285 Ga0207691_10775890
286 Ga0207689_10004048
287 Ga0207689_10657426
288 Ga0207661_10071458
289 Ga0207679_10009140
290 Ga0207668_10001017
291 Ga0207668_10015969
292 Ga0207668_10670924
293 Ga0207658_10766473
294 Ga0207703_10042408
295 Ga0207678_10016920
296 Ga0207678_10043675
297 Ga0207678_10138795
298 Ga0207708_10013017
299 Ga0207648_10578608
300 Ga0207676_10098653
301 Ga0207674_10038247
302 Ga0207675_100049925
303 Ga0207675_100609468
304 Ga0207683_10196922
305 Ga0207698_10058835
306 Ga0268266_10126364
307 Ga0268266_10616085
308 Ga0268265_10017284
309 Ga0268265_10097944
310 Ga0268265_11653343
311 Ga0268264_10027434
312 Ga0268264_10040665
313 Ga0307517_10121435
314 Ga0307515_10000182
315 Ga0307515_10020212
316 Ga0307515_10040616
317 Ga0307512_10005047
318 Ga0307512_10012106
319 Ga0307513_10032160
320 Ga0307513_10056797
321 Ga0307513_10521852
322 Ga0307509_10049774
323 Ga0307509_10104122
324 Ga0307508_10013965
325 Ga0307508_10478433
326 Ga0307516_10000395
327 Ga0307516_10052239
328 Ga0307516_10075356
329 Ga0307516_10193485
330 Ga0307405_10015363
331 Ga0307405_10245162
332 Ga0307413_10178367
333 Ga0307413_11212011
334 Ga0307413_11735703
335 Ga0307410_10055872
336 Ga0307410_10104306
337 Ga0307410_10122028
338 Ga0326468_10000311
339 Ga0307406_10054796
340 Ga0307406_10206359
341 Ga0307406_10419668
342 Ga0307407_10198890
343 Ga0307407_10290544
344 Ga0307407_10405426
345 Ga0307407_10801160
346 Ga0307412_10154559
347 Ga0307409_100086466
348 Ga0307409_100765266
349 Ga0307416_100725995
350 Ga0307416_101142829
351 Ga0307416_101311341
352 Ga0307414_10446991
353 Ga0307411_10094823
354 Ga0307415_100101308
355 Ga0307415_100177778
356 Ga0307415_100907565
357 Ga0307415_101081099
358 Ga0307415_101473680
359 Ga0307507_10125778
360 Ga0307507_10273519
361 Ga0307510_10114824
362 Ga0307510_10247451
363 Ga0373938_0008188
364 Ga0373934_0046666
365 Ga0373951_0000131
366 Ga0373956_0578454
367 Ga0373955_0029857
368 Ga0373962_0013382
369 Ga0373925_0598528
370 Ga0451791_1038662
371 Ga0451837_0316624
372 Ga0439459_0004041
373 Ga0466968_0155165
374 Ga0466957_0098268
375 Ga0495638_0082278
376 Ga0495594_0083085
377 Ga0495632_0183185
378 Ga0495632_0270040
379 Ga0496108_0000115
380 Ga0496126_0249657
381 Ga0501031_0152893
382 Ga0501047_0061498
383 Ga0501081_0222176
384 Ga0501045_0208112
385 nmdc:mga05p37_160025_c1
386 nmdc:mga05p37_261524_c1
387 nmdc:mga05p37_3030_c1
388 nmdc:mga09592_10007_c1
389 nmdc:mga09592_1063961_c1
390 nmdc:mga09592_632635_c1
391 nmdc:mga09592_8_c2
392 nmdc:mga0qj67_157106_c1
393 nmdc:mga0qj67_21_c1
394 nmdc:mga0qj67_562_c1
395 nmdc:mga06r32_14_c1
396 nmdc:mga0n895_1514326_c1
397 Ga0495619_0013602
398 Ga0500651_0033571
399 Ga0500641_0027811
400 Ga0500650_0188605
401 Ga0500594_0002037
402 Ga0500568_0001945
403 Ga0500577_0078173
404 Ga0500600_0048000
405 Ga0500633_0167359
406 Ga0500633_0235610
407 Ga0501082_0175246
408 2515718868
409 2516083080
410 8003857231

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01202

SKI

Shikimate kinase

21

176

0.96

PF00004

AAA

ATPase family associated with various cellular activities (AAA)

15

88

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u8a-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis shikimate kinase in complex with shikimate and adp at 2.15 angstrom resolution 0.9619 3 165
2dft-assembly1.cif.gz_A structure of shikimate kinase from mycobacterium tuberculosis complexed with adp and mg at 2.8 angstrons of resolution 0.9571 3 165
1u8a-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis shikimate kinase in complex with shikimate and adp at 2.15 angstrom resolution 0.9504 3 165
2iyz-assembly1.cif.gz_A shikimate kinase from mycobacterium tuberculosis in complex with shikimate-3-phosphate and adp 0.949 3 169
4y0a-assembly1.cif.gz_A shikimate kinase from acinetobacter baumannii in complex with shikimate 0.9462 2 166
ID Description Score Start End Superfamily
4y0aA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9462 2 166 3.40.50.300
2dftC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9253 3 165 3.40.50.300
4y0aA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9192 2 166 3.40.50.300
2shkA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9163 1 166 3.40.50.300
2dftC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9142 3 165 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A538EGU3-F1-model_v4 Shikimate kinase (SK) (EC 2.7.1.71) 0.9977 3 167 GO:0000287
GO:0004765
GO:0005524
GO:0005829
GO:0008652
GO:0009073
GO:0009423
AF-A0A542YSV3-F1-model_v4 Multifunctional fusion protein [Includes: Shikimate kinase (SK) (EC 2.7.1.71); 3-dehydroquinate synthase (DHQS) (EC 4.2.3.4)] 0.9917 1 165 GO:0000287
GO:0003856
GO:0004765
GO:0005524
GO:0005737
GO:0008652
GO:0009073
GO:0009423
AF-A0A7R7DPC1-F1-model_v4 Shikimate kinase (SK) (EC 2.7.1.71) 0.9879 1 166 GO:0000287
GO:0004765
GO:0005524
GO:0005829
GO:0008652
GO:0009073
GO:0009423
AF-A0A538EGU3-F1-model_v4 Shikimate kinase (SK) (EC 2.7.1.71) 0.9858 3 167 GO:0000287
GO:0004765
GO:0005524
GO:0005829
GO:0008652
GO:0009073
GO:0009423
AF-A0A7W3PDX2-F1-model_v4 Shikimate kinase (SK) (EC 2.7.1.71) 0.984 2 166 GO:0000287
GO:0004765
GO:0005524
GO:0005829
GO:0008652
GO:0009073
GO:0009423

Map