F313664

General Info

Members Datasets Scaffolds Average Seq Length
205 116 410 130

Family's Representative Sequence

Representative Sequence 3300006173|Ga0070716_100665696|Ga0070716_1006656962
Length 144
Sequence MHRIAFKTGKKREVVDITDRLEKLLGKVSPDGSGVCHVFVLHTTAALTTADLDPGTDLDMLDAFEAMIPKLHYRHPHNPKHVPDHILSALIGTSVTLPFEKGEFVLGTWQRVVLIELDGPREREVVVSIAPTGHEGRPHNMAGV

Samples

Sample ID Description Type Environment
1 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
32 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
40 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
52 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
70 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
71 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
72 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
73 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
74 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
75 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
76 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
77 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
78 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
79 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
80 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
81 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
82 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
83 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
84 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
89 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
90 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
91 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
92 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
93 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
94 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
95 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
96 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
97 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
98 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
99 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
100 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
101 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
102 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
103 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
104 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
105 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
106 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
107 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
108 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
109 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
110 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
111 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
112 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
113 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
114 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
115 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
116 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.56
Metatranscriptomes 2.44
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.98
Nodule 0
Rhizoplane 0.49
Rhizosphere 96.59
Stem 0
Stem Tuber 0
Unclassified 21.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070716_100665696 3300006173 Bacteria 791
2 JGI25406J46586_10025199 3300003203 Bacteria 2313
3 rootH2_10006847 3300003320 Bacteria 155484
4 Ga0070680_101098846 3300005336 Bacteria 687
5 Ga0070709_10147889 3300005434 Bacteria 1621
6 Ga0070709_10216307 3300005434 Bacteria 1364
7 Ga0070709_10331134 3300005434 Bacteria 1120
8 Ga0070709_10600346 3300005434 Unclassified 847
9 Ga0070714_100011197 3300005435 Bacteria 7111
10 Ga0070713_100011561 3300005436 Bacteria 6434
11 Ga0070713_100093809 3300005436 Bacteria 2587
12 Ga0070713_100365729 3300005436 Bacteria 1341
13 Ga0070710_10037195 3300005437 Bacteria 2666
14 Ga0070710_10484026 3300005437 Bacteria 844
15 Ga0070711_100113107 3300005439 Bacteria 1996
16 Ga0070694_100170477 3300005444 Unclassified 1603
17 Ga0070708_100036030 3300005445 Unclassified 4313
18 Ga0070708_100108535 3300005445 Bacteria 2549
19 Ga0070681_10326651 3300005458 Bacteria 1444
20 Ga0070706_100011884 3300005467 Bacteria 8081
21 Ga0070706_100032186 3300005467 Bacteria 4837
22 Ga0070706_100044094 3300005467 Unclassified 4120
23 Ga0070706_101609659 3300005467 Bacteria 592
24 Ga0070706_101712798 3300005467 Unclassified 572
25 Ga0070707_100018743 3300005468 Bacteria 6516
26 Ga0070707_100078201 3300005468 Bacteria 3191
27 Ga0070707_100579457 3300005468 Unclassified 1084
28 Ga0070707_101057571 3300005468 Bacteria 777
29 Ga0070698_100273576 3300005471 Bacteria 1620
30 Ga0070698_101177992 3300005471 Unclassified 715
31 Ga0070698_101262448 3300005471 Unclassified 688
32 Ga0070699_100428763 3300005518 Unclassified 1197
33 Ga0070699_100429523 3300005518 Bacteria 1196
34 Ga0070699_101019682 3300005518 Bacteria 759
35 Ga0070679_100049205 3300005530 Bacteria 4198
36 Ga0070679_100184283 3300005530 Bacteria 2059
37 Ga0070684_100408054 3300005535 Bacteria 1253
38 Ga0070697_100203546 3300005536 Bacteria 1683
39 Ga0070697_100466257 3300005536 Bacteria 1101
40 Ga0070696_100172677 3300005546 Unclassified 1599
41 Ga0070704_100283775 3300005549 Unclassified 1373
42 Ga0070704_100449382 3300005549 Unclassified 1109
43 Ga0068855_100107751 3300005563 Bacteria 3201
44 Ga0068857_100027247 3300005577 Bacteria 5040
45 Ga0068857_100308695 3300005577 Bacteria 1459
46 Ga0068857_100376840 3300005577 Bacteria 1317
47 Ga0068856_100019496 3300005614 Bacteria 6584
48 Ga0068856_100041634 3300005614 Bacteria 4515
49 Ga0068856_100746896 3300005614 Bacteria 998
50 Ga0068864_101663686 3300005618 Unclassified 643
51 Ga0081539_10003242 3300005985 Bacteria 20471
52 Ga0070717_10001290 3300006028 Bacteria 17132
53 Ga0070717_10048572 3300006028 Bacteria 3481
54 Ga0070717_11566253 3300006028 Unclassified 597
55 Ga0070716_100044121 3300006173 Bacteria 2497
56 Ga0070716_100311335 3300006173 Bacteria 1099
57 Ga0070712_100070297 3300006175 Bacteria 2500
58 Ga0075433_10036147 3300006852 Bacteria 4253
59 Ga0075433_10097556 3300006852 Unclassified 2601
60 Ga0075433_10377347 3300006852 Bacteria 1252
61 Ga0075434_100028475 3300006871 Bacteria 5488
62 Ga0075434_100046912 3300006871 Bacteria 4287
63 Ga0075434_100115729 3300006871 Bacteria 2694
64 Ga0075436_100001442 3300006914 Bacteria 16166
65 Ga0075436_100347535 3300006914 Unclassified 1068
66 Ga0075435_100023126 3300007076 Bacteria 4801
67 Ga0105240_10415388 3300009093 Unclassified 1513
68 Ga0114129_10007623 3300009147 Bacteria 15396
69 Ga0114129_10038909 3300009147 Bacteria 6704
70 Ga0105241_10030318 3300009174 Unclassified 4041
71 Ga0105241_10659380 3300009174 Unclassified 951
72 Ga0105237_10156490 3300009545 Bacteria 2276
73 Ga0105237_10206486 3300009545 Bacteria 1965
74 Ga0105238_11121397 3300009551 Bacteria 810
75 Ga0105238_11738217 3300009551 Unclassified 655
76 Ga0105249_11083473 3300009553 Bacteria 871
77 Ga0105032_100005 3300009979 Bacteria 119893
78 Ga0105033_101698 3300009986 Bacteria 1810
79 Ga0105239_10177307 3300010375 Bacteria 2384
80 Ga0157371_10105363 3300013102 Bacteria 2001
81 Ga0157370_11006615 3300013104 Bacteria 754
82 Ga0157374_10292454 3300013296 Bacteria 1610
83 Ga0157374_10437862 3300013296 Bacteria 1307
84 Ga0157378_10429933 3300013297 Unclassified 1307
85 Ga0157372_10012505 3300013307 Bacteria 9045
86 Ga0157372_10039375 3300013307 Bacteria 5216
87 Ga0206356_10556052 3300020070 Bacteria 1743
88 Ga0206349_1729033 3300020075 Bacteria 4102
89 Ga0206351_10752503 3300020077 Bacteria 1509
90 Ga0206354_10420770 3300020081 Bacteria 1712
91 Ga0213873_10007532 3300021358 Unclassified 2185
92 Ga0224712_10001744 3300022467 Bacteria 5178
93 Ga0207692_10055515 3300025898 Bacteria 2028
94 Ga0207647_10123193 3300025904 Unclassified 1528
95 Ga0207685_10091549 3300025905 Bacteria 1281
96 Ga0207699_10048893 3300025906 Bacteria 2486
97 Ga0207699_10190764 3300025906 Bacteria 1383
98 Ga0207684_10013189 3300025910 Bacteria 7154
99 Ga0207684_10213565 3300025910 Unclassified 1664
100 Ga0207684_10475116 3300025910 Bacteria 1072
101 Ga0207684_11178493 3300025910 Unclassified 635
102 Ga0207707_10200052 3300025912 Bacteria 1742
103 Ga0207707_10213214 3300025912 Unclassified 1682
104 Ga0207695_10033235 3300025913 Bacteria 5630
105 Ga0207695_10081799 3300025913 Bacteria 3267
106 Ga0207695_10827341 3300025913 Unclassified 806
107 Ga0207663_11395203 3300025916 Unclassified 564
108 Ga0207652_10365765 3300025921 Bacteria 1302
109 Ga0207652_10550214 3300025921 Unclassified 1037
110 Ga0207646_10003330 3300025922 Bacteria 18262
111 Ga0207646_10022400 3300025922 Bacteria 5821
112 Ga0207646_10099356 3300025922 Unclassified 2608
113 Ga0207700_10045198 3300025928 Bacteria 3247
114 Ga0207700_10080276 3300025928 Bacteria 2543
115 Ga0207700_10256308 3300025928 Unclassified 1496
116 Ga0207700_10287550 3300025928 Bacteria 1416
117 Ga0207664_10050646 3300025929 Bacteria 3276
118 Ga0207664_11146920 3300025929 Bacteria 694
119 Ga0207665_10034675 3300025939 Bacteria 3348
120 Ga0207665_10375178 3300025939 Bacteria 1078
121 Ga0207667_10219928 3300025949 Bacteria 1946
122 Ga0207667_10341680 3300025949 Bacteria 1528
123 Ga0207702_10143955 3300026078 Bacteria 2160
124 Ga0207702_10760119 3300026078 Bacteria 957
125 Ga0207674_10012306 3300026116 Bacteria 9566
126 Ga0207674_10814192 3300026116 Bacteria 901
127 Ga0265334_10032385 3300028573 Bacteria 2085
128 Ga0265323_10050565 3300028653 Bacteria 1477
129 Ga0265338_10000359 3300028800 Bacteria 82359
130 Ga0265338_10002558 3300028800 Bacteria 26922
131 Ga0265332_10014809 3300031238 Bacteria 3447
132 Ga0265332_10086265 3300031238 Bacteria 1330
133 Ga0265320_10149306 3300031240 Bacteria 1056
134 Ga0265340_10000011 3300031247 Bacteria 111180
135 Ga0265340_10422865 3300031247 Bacteria 587
136 Ga0265339_10006842 3300031249 Bacteria 7432
137 Ga0265339_10010292 3300031249 Bacteria 5818
138 Ga0265339_10267399 3300031249 Bacteria 823
139 Ga0265313_10073662 3300031595 Bacteria 1567
140 Ga0265313_10162970 3300031595 Bacteria 946
141 Ga0265342_10002490 3300031712 Bacteria 15855
142 Ga0373936_0017428 3300035113 Bacteria 2765
143 Ga0373954_0203595 3300035118 Unclassified 972
144 Ga0373956_0006903 3300035119 Bacteria 4560
145 Ga0373943_0208197 3300035170 Bacteria 1085
146 Ga0373935_0067518 3300035692 Bacteria 2299
147 Ga0373933_0032001 3300035724 Bacteria 3055
148 Ga0373933_0064529 3300035724 Bacteria 2216
149 Ga0373933_0196124 3300035724 Bacteria 1291
150 Ga0373937_0390558 3300036401 Bacteria 1320
151 Ga0373937_0502411 3300036401 Bacteria 1152
152 Ga0395899_0002238 3300037312 Bacteria 15842
153 Ga0395900_0264052 3300037418 Bacteria 1718
154 Ga0395900_1804409 3300037418 Unclassified 522
155 Ga0395898_0006930 3300037466 Bacteria 12044
156 Ga0395905_0000943 3300037471 Bacteria 37400
157 Ga0395901_0737046 3300038443 Unclassified 979
158 Ga0436365_1662486 3300039437 Bacteria 3247
159 Ga0436361_0620293 3300039447 Bacteria 1518
160 Ga0436363_0501770 3300039450 Unclassified 709
161 Ga0436363_0527322 3300039450 Unclassified 2189
162 Ga0436362_0453620 3300039453 Unclassified 2275
163 Ga0436362_0951708 3300039453 Bacteria 1601
164 Ga0466969_0000049 3300044656 Bacteria 63388
165 Ga0466969_0031599 3300044656 Bacteria 2694
166 Ga0466969_0111877 3300044656 Bacteria 1277
167 Ga0466972_0000975 3300044658 Bacteria 13777
168 Ga0466972_0115031 3300044658 Bacteria 1270
169 Ga0466966_0006082 3300044684 Bacteria 7973
170 Ga0466966_0009587 3300044684 Bacteria 6409
171 Ga0466966_0490153 3300044684 Unclassified 739
172 Ga0466966_0898691 3300044684 Bacteria 534
173 Ga0466961_0018836 3300044693 Bacteria 4442
174 Ga0466961_0062588 3300044693 Bacteria 2365
175 Ga0466961_0424506 3300044693 Unclassified 806
176 Ga0466961_0435398 3300044693 Bacteria 794
177 Ga0466964_0021266 3300044706 Bacteria 2508
178 Ga0466968_0000027 3300044735 Bacteria 42011
179 Ga0466968_0630901 3300044735 Unclassified 543
180 Ga0466970_0000047 3300044765 Bacteria 45053
181 Ga0466970_0058869 3300044765 Bacteria 2057
182 Ga0466970_0285339 3300044765 Bacteria 929
183 Ga0466959_0001977 3300045049 Bacteria 12912
184 Ga0466959_0053042 3300045049 Bacteria 2966
185 Ga0466959_0056800 3300045049 Bacteria 2855
186 Ga0466959_0110211 3300045049 Bacteria 1965
187 Ga0466959_0466039 3300045049 Bacteria 856
188 Ga0466959_0815934 3300045049 Bacteria 623
189 Ga0451576_0999655 3300045051 Bacteria 877
190 Ga0466958_0397016 3300045836 Unclassified 890
191 Ga0466967_0145659 3300045976 Bacteria 2209
192 Ga0495602_0205146 3300048088 Bacteria 1501
193 Ga0496113_0972709 3300048916 Unclassified 669
194 Ga0501067_0240827 3300049583 Unclassified 1007
195 Ga0501068_0142512 3300049584 Bacteria 1503
196 Ga0501069_0657314 3300049585 Bacteria 631
197 Ga0501044_0481406 3300049823 Bacteria 1144
198 nmdc:mga05p37_12835_c1 3300050507 Bacteria 10018
199 nmdc:mga05p37_19133_c1 3300050507 Bacteria 8283
200 nmdc:mga0n895_412331_c1 3300050512 Bacteria 1366
201 nmdc:mga0n895_79400_c1 3300050512 Bacteria 3268
202 nmdc:mga08x19_326925_c1 3300050514 Unclassified 1068
203 nmdc:mga0a205_156537_c1 3300050515 Bacteria 2177
204 Ga0500650_0137779 3300053098 Bacteria 1132
205 Ga0500607_305067 3300053121 Bacteria 585
206 Ga0070716_100665696
207 JGI25406J46586_10025199
208 rootH2_10006847
209 Ga0070680_101098846
210 Ga0070709_10147889
211 Ga0070709_10216307
212 Ga0070709_10331134
213 Ga0070709_10600346
214 Ga0070714_100011197
215 Ga0070713_100011561
216 Ga0070713_100093809
217 Ga0070713_100365729
218 Ga0070710_10037195
219 Ga0070710_10484026
220 Ga0070711_100113107
221 Ga0070694_100170477
222 Ga0070708_100036030
223 Ga0070708_100108535
224 Ga0070681_10326651
225 Ga0070706_100011884
226 Ga0070706_100032186
227 Ga0070706_100044094
228 Ga0070706_101609659
229 Ga0070706_101712798
230 Ga0070707_100018743
231 Ga0070707_100078201
232 Ga0070707_100579457
233 Ga0070707_101057571
234 Ga0070698_100273576
235 Ga0070698_101177992
236 Ga0070698_101262448
237 Ga0070699_100428763
238 Ga0070699_100429523
239 Ga0070699_101019682
240 Ga0070679_100049205
241 Ga0070679_100184283
242 Ga0070684_100408054
243 Ga0070697_100203546
244 Ga0070697_100466257
245 Ga0070696_100172677
246 Ga0070704_100283775
247 Ga0070704_100449382
248 Ga0068855_100107751
249 Ga0068857_100027247
250 Ga0068857_100308695
251 Ga0068857_100376840
252 Ga0068856_100019496
253 Ga0068856_100041634
254 Ga0068856_100746896
255 Ga0068864_101663686
256 Ga0081539_10003242
257 Ga0070717_10001290
258 Ga0070717_10048572
259 Ga0070717_11566253
260 Ga0070716_100044121
261 Ga0070716_100311335
262 Ga0070712_100070297
263 Ga0075433_10036147
264 Ga0075433_10097556
265 Ga0075433_10377347
266 Ga0075434_100028475
267 Ga0075434_100046912
268 Ga0075434_100115729
269 Ga0075436_100001442
270 Ga0075436_100347535
271 Ga0075435_100023126
272 Ga0105240_10415388
273 Ga0114129_10007623
274 Ga0114129_10038909
275 Ga0105241_10030318
276 Ga0105241_10659380
277 Ga0105237_10156490
278 Ga0105237_10206486
279 Ga0105238_11121397
280 Ga0105238_11738217
281 Ga0105249_11083473
282 Ga0105032_100005
283 Ga0105033_101698
284 Ga0105239_10177307
285 Ga0157371_10105363
286 Ga0157370_11006615
287 Ga0157374_10292454
288 Ga0157374_10437862
289 Ga0157378_10429933
290 Ga0157372_10012505
291 Ga0157372_10039375
292 Ga0206356_10556052
293 Ga0206349_1729033
294 Ga0206351_10752503
295 Ga0206354_10420770
296 Ga0213873_10007532
297 Ga0224712_10001744
298 Ga0207692_10055515
299 Ga0207647_10123193
300 Ga0207685_10091549
301 Ga0207699_10048893
302 Ga0207699_10190764
303 Ga0207684_10013189
304 Ga0207684_10213565
305 Ga0207684_10475116
306 Ga0207684_11178493
307 Ga0207707_10200052
308 Ga0207707_10213214
309 Ga0207695_10033235
310 Ga0207695_10081799
311 Ga0207695_10827341
312 Ga0207663_11395203
313 Ga0207652_10365765
314 Ga0207652_10550214
315 Ga0207646_10003330
316 Ga0207646_10022400
317 Ga0207646_10099356
318 Ga0207700_10045198
319 Ga0207700_10080276
320 Ga0207700_10256308
321 Ga0207700_10287550
322 Ga0207664_10050646
323 Ga0207664_11146920
324 Ga0207665_10034675
325 Ga0207665_10375178
326 Ga0207667_10219928
327 Ga0207667_10341680
328 Ga0207702_10143955
329 Ga0207702_10760119
330 Ga0207674_10012306
331 Ga0207674_10814192
332 Ga0265334_10032385
333 Ga0265323_10050565
334 Ga0265338_10000359
335 Ga0265338_10002558
336 Ga0265332_10014809
337 Ga0265332_10086265
338 Ga0265320_10149306
339 Ga0265340_10000011
340 Ga0265340_10422865
341 Ga0265339_10006842
342 Ga0265339_10010292
343 Ga0265339_10267399
344 Ga0265313_10073662
345 Ga0265313_10162970
346 Ga0265342_10002490
347 Ga0373936_0017428
348 Ga0373954_0203595
349 Ga0373956_0006903
350 Ga0373943_0208197
351 Ga0373935_0067518
352 Ga0373933_0032001
353 Ga0373933_0064529
354 Ga0373933_0196124
355 Ga0373937_0390558
356 Ga0373937_0502411
357 Ga0395899_0002238
358 Ga0395900_0264052
359 Ga0395900_1804409
360 Ga0395898_0006930
361 Ga0395905_0000943
362 Ga0395901_0737046
363 Ga0436365_1662486
364 Ga0436361_0620293
365 Ga0436363_0501770
366 Ga0436363_0527322
367 Ga0436362_0453620
368 Ga0436362_0951708
369 Ga0466969_0000049
370 Ga0466969_0031599
371 Ga0466969_0111877
372 Ga0466972_0000975
373 Ga0466972_0115031
374 Ga0466966_0006082
375 Ga0466966_0009587
376 Ga0466966_0490153
377 Ga0466966_0898691
378 Ga0466961_0018836
379 Ga0466961_0062588
380 Ga0466961_0424506
381 Ga0466961_0435398
382 Ga0466964_0021266
383 Ga0466968_0000027
384 Ga0466968_0630901
385 Ga0466970_0000047
386 Ga0466970_0058869
387 Ga0466970_0285339
388 Ga0466959_0001977
389 Ga0466959_0053042
390 Ga0466959_0056800
391 Ga0466959_0110211
392 Ga0466959_0466039
393 Ga0466959_0815934
394 Ga0451576_0999655
395 Ga0466958_0397016
396 Ga0466967_0145659
397 Ga0495602_0205146
398 Ga0496113_0972709
399 Ga0501067_0240827
400 Ga0501068_0142512
401 Ga0501069_0657314
402 Ga0501044_0481406
403 nmdc:mga05p37_12835_c1
404 nmdc:mga05p37_19133_c1
405 nmdc:mga0n895_412331_c1
406 nmdc:mga0n895_79400_c1
407 nmdc:mga08x19_326925_c1
408 nmdc:mga0a205_156537_c1
409 Ga0500650_0137779
410 Ga0500607_305067

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01894

UPF0047

Uncharacterised protein family UPF0047

16

129

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ve0-assembly1.cif.gz_A crystal structure of uncharacterized protein st2072 from sulfolobus tokodaii 0.8208 1 119
1vmh-assembly1.cif.gz_A crystal structure of an uncharacterized conserved protein yjbq/upf0047 family, ortholog yugu b.subtilis (ca_c0907) from clostridium acetobutylicum at 1.31 a resolution 0.8195 1 119
1ve0-assembly1.cif.gz_A crystal structure of uncharacterized protein st2072 from sulfolobus tokodaii 0.8143 1 119
1vmh-assembly1.cif.gz_A crystal structure of an uncharacterized conserved protein yjbq/upf0047 family, ortholog yugu b.subtilis (ca_c0907) from clostridium acetobutylicum at 1.31 a resolution 0.8131 1 119
1vph-assembly2.cif.gz_E crystal structure of a ybjq-like protein of unknown function (sso2532) from sulfolobus solfataricus p2 at 1.76 a resolution 0.8109 1 118
ID Description Score Start End Superfamily
1xbfB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.8218 1 119 2.60.120.460
1xbfB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.8154 1 119 2.60.120.460
1vphC00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.8148 1 118 2.60.120.460
1ve0A00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.8109 1 118 2.60.120.460
1vphC00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.802 1 118 2.60.120.460
ID Description Score Start End GO Terms
AF-A0A538TN52-F1-model_v4 YjbQ family protein 0.8656 4 119
AF-A0A7W1UBS2-F1-model_v4 YjbQ family protein 0.8408 1 119
AF-A0A2H0P403-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.8389 1 119
AF-A0A1L8CVR5-F1-model_v4 YjbQ family protein 0.8385 1 119
AF-A0A534R7U3-F1-model_v4 YjbQ family protein 0.838 1 119

Map