F313397

General Info

Members Datasets Scaffolds Average Seq Length
205 127 410 114

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100562152|Ga0070690_1005621522
Length 134
Sequence LDFLLIGRYSGRPIDERAKLCFMKTSTREAWEKEYARLREPLGKVGWISEGYVQDRGPGAGGPCYQWTRKVRGKTVSVALSREQYEWLREAIGQWRNLQTTLRQMQRLSRQVLFTTVPHPPRRKKLGKKTLGLI

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
76 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
77 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
78 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
79 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
80 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
81 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
82 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
83 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
84 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
85 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
86 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
87 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
88 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
89 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
90 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
91 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
92 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
93 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
94 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
95 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
96 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
97 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
98 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
99 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
100 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
101 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
102 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
103 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
104 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
105 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
106 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
107 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
108 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
109 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
110 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
111 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
112 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
113 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
114 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
115 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
116 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
117 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
118 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
119 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
120 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
121 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
122 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
123 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
124 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
125 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
126 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
127 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.49
Rhizosphere 98.54
Stem 0
Stem Tuber 0
Unclassified 50.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100562152 3300005330 Unclassified 861
2 Ga0065707_10130719 3300005295 Unclassified 1925
3 Ga0065707_10159571 3300005295 Bacteria 1576
4 Ga0070690_100103397 3300005330 Bacteria 1891
5 Ga0070690_100244790 3300005330 Bacteria 1266
6 Ga0070680_101172176 3300005336 Unclassified 664
7 Ga0068868_101071364 3300005338 Unclassified 740
8 Ga0070660_100303229 3300005339 Unclassified 1310
9 Ga0070689_100105028 3300005340 Bacteria 2240
10 Ga0070689_100131045 3300005340 Unclassified 2011
11 Ga0070689_100648469 3300005340 Bacteria 918
12 Ga0070671_100238913 3300005355 Bacteria 1542
13 Ga0070673_100183328 3300005364 Bacteria 1793
14 Ga0070673_101868516 3300005364 Unclassified 569
15 Ga0070688_100037894 3300005365 Bacteria 2940
16 Ga0070688_100100541 3300005365 Bacteria 1906
17 Ga0070688_100135610 3300005365 Bacteria 1666
18 Ga0070667_100586561 3300005367 Unclassified 1026
19 Ga0070713_101846656 3300005436 Unclassified 586
20 Ga0070701_10062598 3300005438 Bacteria 1966
21 Ga0070694_100658668 3300005444 Unclassified 848
22 Ga0070663_101924992 3300005455 Unclassified 531
23 Ga0070678_100106133 3300005456 Bacteria 2188
24 Ga0070681_10117700 3300005458 Bacteria 2593
25 Ga0070681_10263430 3300005458 Unclassified 1636
26 Ga0070685_10041201 3300005466 Bacteria 2630
27 Ga0070685_10070346 3300005466 Bacteria 2071
28 Ga0070685_10142732 3300005466 Bacteria 1509
29 Ga0070706_100627679 3300005467 Unclassified 998
30 Ga0070707_100358175 3300005468 Bacteria 1417
31 Ga0070707_101375650 3300005468 Unclassified 672
32 Ga0070707_101955433 3300005468 Bacteria 554
33 Ga0070698_100145152 3300005471 Bacteria 2323
34 Ga0070698_101122091 3300005471 Bacteria 735
35 Ga0070679_100782138 3300005530 Unclassified 897
36 Ga0070679_101306769 3300005530 Unclassified 671
37 Ga0070672_100143819 3300005543 Bacteria 1969
38 Ga0070686_100064265 3300005544 Bacteria 2380
39 Ga0070686_100085340 3300005544 Bacteria 2100
40 Ga0070686_100128994 3300005544 Unclassified 1746
41 Ga0070686_100133464 3300005544 Bacteria 1720
42 Ga0070693_101030182 3300005547 Unclassified 624
43 Ga0070704_100105864 3300005549 Bacteria 2130
44 Ga0068855_101601543 3300005563 Unclassified 666
45 Ga0070702_100065845 3300005615 Unclassified 2123
46 Ga0070702_100114852 3300005615 Bacteria 1676
47 Ga0068859_100075179 3300005617 Bacteria 3418
48 Ga0068859_100685525 3300005617 Unclassified 1116
49 Ga0068864_100351745 3300005618 Unclassified 1390
50 Ga0068864_100598880 3300005618 Unclassified 1069
51 Ga0068866_11429011 3300005718 Unclassified 506
52 Ga0068861_101476679 3300005719 Unclassified 666
53 Ga0068863_100081474 3300005841 Bacteria 3066
54 Ga0068858_101185007 3300005842 Bacteria 751
55 Ga0068860_100529066 3300005843 Unclassified 1179
56 Ga0068860_101035223 3300005843 Unclassified 839
57 Ga0097621_100116662 3300006237 Bacteria 2261
58 Ga0097621_100773401 3300006237 Bacteria 888
59 Ga0075428_100212193 3300006844 Unclassified 2092
60 Ga0075431_101386213 3300006847 Bacteria 663
61 Ga0075433_10135396 3300006852 Bacteria 2190
62 Ga0075434_100183390 3300006871 Unclassified 2114
63 Ga0075429_100125261 3300006880 Bacteria 2247
64 Ga0097620_100075179 3300006931 Bacteria 3418
65 Ga0097620_100685572 3300006931 Bacteria 1116
66 Ga0099794_10204633 3300007265 Bacteria 1011
67 Ga0111539_10203011 3300009094 Bacteria 2311
68 Ga0114129_10277818 3300009147 Bacteria 2239
69 Ga0114129_10519460 3300009147 Bacteria 1552
70 Ga0114129_11557571 3300009147 Unclassified 810
71 Ga0105248_10268092 3300009177 Bacteria 1922
72 Ga0105248_10977917 3300009177 Unclassified 956
73 Ga0105249_10150587 3300009553 Bacteria 2239
74 Ga0105249_11028996 3300009553 Unclassified 893
75 Ga0105249_11321753 3300009553 Unclassified 793
76 Ga0157371_10089066 3300013102 Unclassified 2186
77 Ga0157370_10233511 3300013104 Unclassified 1702
78 Ga0157374_10219127 3300013296 Unclassified 1867
79 Ga0157372_10617651 3300013307 Unclassified 1263
80 Ga0157375_10000494 3300013308 Bacteria 35751
81 Ga0157375_10215071 3300013308 Bacteria 2080
82 Ga0157375_10676642 3300013308 Bacteria 1187
83 Ga0163163_10174531 3300014325 Bacteria 2196
84 Ga0163163_11084437 3300014325 Unclassified 864
85 Ga0157379_10467359 3300014968 Unclassified 1166
86 Ga0157379_10607102 3300014968 Unclassified 1022
87 Ga0157376_10122884 3300014969 Bacteria 2304
88 Ga0157376_12422071 3300014969 Unclassified 564
89 Ga0163161_10473817 3300017792 Bacteria 1015
90 Ga0207663_10585430 3300025916 Unclassified 876
91 Ga0207660_11724858 3300025917 Unclassified 503
92 Ga0207657_10350023 3300025919 Unclassified 1165
93 Ga0207652_10384362 3300025921 Unclassified 1267
94 Ga0207646_10350875 3300025922 Bacteria 1333
95 Ga0207646_10624162 3300025922 Unclassified 967
96 Ga0207670_10079394 3300025936 Bacteria 2291
97 Ga0207670_10106290 3300025936 Bacteria 2013
98 Ga0207670_10218902 3300025936 Unclassified 1456
99 Ga0207670_10230434 3300025936 Unclassified 1422
100 Ga0207670_10238425 3300025936 Unclassified 1400
101 Ga0207670_10371749 3300025936 Bacteria 1137
102 Ga0207691_10127575 3300025940 Bacteria 2249
103 Ga0207711_10163724 3300025941 Bacteria 2015
104 Ga0207667_10736705 3300025949 Unclassified 986
105 Ga0207667_11483292 3300025949 Unclassified 650
106 Ga0207651_10130120 3300025960 Bacteria 1925
107 Ga0207703_10487420 3300026035 Unclassified 1156
108 Ga0207703_11236288 3300026035 Unclassified 718
109 Ga0207702_11083772 3300026078 Unclassified 795
110 Ga0207641_10065223 3300026088 Bacteria 3114
111 Ga0207676_10399967 3300026095 Unclassified 1283
112 Ga0207675_100852622 3300026118 Unclassified 926
113 Ga0207683_10172153 3300026121 Bacteria 1961
114 Ga0268266_10096228 3300028379 Bacteria 2601
115 Ga0268265_11887912 3300028380 Unclassified 604
116 Ga0268264_10420992 3300028381 Unclassified 1288
117 Ga0265337_1016222 3300028556 Unclassified 2414
118 Ga0265337_1017738 3300028556 Unclassified 2275
119 Ga0265326_10020231 3300028558 Bacteria 1908
120 Ga0265319_1104865 3300028563 Unclassified 886
121 Ga0265319_1220846 3300028563 Unclassified 579
122 Ga0265334_10025188 3300028573 Unclassified 2409
123 Ga0265334_10028828 3300028573 Bacteria 2226
124 Ga0265334_10173523 3300028573 Bacteria 754
125 Ga0265336_10065108 3300028666 Bacteria 1091
126 Ga0307517_10108611 3300028786 Unclassified 2128
127 Ga0265338_10012041 3300028800 Bacteria 9896
128 Ga0265338_10062001 3300028800 Bacteria 3272
129 Ga0265338_10112888 3300028800 Bacteria 2184
130 Ga0265338_10116234 3300028800 Bacteria 2143
131 Ga0265338_10128568 3300028800 Unclassified 2005
132 Ga0265338_10291611 3300028800 Unclassified 1189
133 Ga0265338_10510501 3300028800 Unclassified 845
134 Ga0265338_10510705 3300028800 Bacteria 845
135 Ga0265338_10591504 3300028800 Bacteria 773
136 Ga0265338_10694902 3300028800 Bacteria 702
137 Ga0265324_10020254 3300029957 Bacteria 2390
138 Ga0265324_10033907 3300029957 Unclassified 1779
139 Ga0265324_10185136 3300029957 Bacteria 707
140 Ga0265332_10042133 3300031238 Unclassified 1974
141 Ga0265328_10063534 3300031239 Bacteria 1356
142 Ga0265320_10000231 3300031240 Bacteria 45775
143 Ga0265320_10067890 3300031240 Unclassified 1686
144 Ga0265320_10248099 3300031240 Bacteria 790
145 Ga0265340_10048089 3300031247 Unclassified 2074
146 Ga0265340_10051291 3300031247 Bacteria 1998
147 Ga0265340_10053317 3300031247 Bacteria 1953
148 Ga0265331_10328579 3300031250 Bacteria 685
149 Ga0265316_10099656 3300031344 Bacteria 2209
150 Ga0265316_10109420 3300031344 Unclassified 2094
151 Ga0265316_10110205 3300031344 Unclassified 2085
152 Ga0265316_10289834 3300031344 Bacteria 1194
153 Ga0265316_10389399 3300031344 Unclassified 1005
154 Ga0265316_11064651 3300031344 Unclassified 561
155 Ga0265313_10043784 3300031595 Unclassified 2189
156 Ga0265314_10036981 3300031711 Bacteria 3541
157 Ga0265314_10138462 3300031711 Unclassified 1508
158 Ga0265342_10055376 3300031712 Bacteria 2354
159 Ga0307516_10153203 3300031730 Bacteria 2063
160 Ga0373961_0159167 3300035241 Unclassified 774
161 Ga0373927_0134472 3300035695 Unclassified 1616
162 Ga0373927_0391434 3300035695 Unclassified 917
163 Ga0373933_0357667 3300035724 Unclassified 949
164 Ga0373933_0539506 3300035724 Unclassified 765
165 Ga0316582_0335172 3300036647 Bacteria 1040
166 Ga0373925_0124434 3300037068 Bacteria 2005
167 Ga0373925_1393325 3300037068 Unclassified 574
168 Ga0451577_0063344 3300042876 Bacteria 3297
169 Ga0451577_0332689 3300042876 Unclassified 1377
170 Ga0451577_0862541 3300042876 Bacteria 816
171 Ga0453684_0003288 3300044712 Bacteria 36835
172 Ga0453684_0042181 3300044712 Bacteria 6155
173 Ga0453684_0792537 3300044712 Bacteria 1022
174 Ga0451576_0505773 3300045051 Bacteria 1269
175 Ga0495629_0182822 3300046459 Unclassified 1453
176 Ga0495653_0303981 3300046463 Unclassified 1039
177 Ga0495582_0915513 3300046473 Bacteria 507
178 Ga0495662_0381824 3300046476 Unclassified 692
179 Ga0495608_0840231 3300046511 Unclassified 540
180 Ga0495630_0215785 3300046517 Unclassified 1464
181 Ga0495640_0311554 3300046533 Unclassified 976
182 Ga0495586_0061879 3300046535 Bacteria 2037
183 Ga0495586_0778180 3300046535 Unclassified 552
184 Ga0495621_0268114 3300046539 Unclassified 701
185 Ga0495667_0389712 3300046559 Unclassified 878
186 Ga0495659_0025992 3300046664 Bacteria 2008
187 Ga0495658_0324672 3300046683 Unclassified 976
188 Ga0495613_0278966 3300046689 Bacteria 1161
189 Ga0495636_0063815 3300047318 Bacteria 1562
190 Ga0495674_0986439 3300047319 Unclassified 646
191 Ga0495684_0067341 3300047471 Unclassified 2723
192 Ga0495614_0369952 3300048089 Unclassified 670
193 Ga0496110_0284540 3300048913 Bacteria 1506
194 Ga0501073_0233915 3300049589 Bacteria 1269
195 Ga0501080_0035280 3300049742 Bacteria 4668
196 nmdc:mga05p37_1498887_c1 3300050507 Unclassified 672
197 nmdc:mga05p37_701256_c1 3300050507 Bacteria 1124
198 nmdc:mga09592_138726_c1 3300050508 Bacteria 2095
199 nmdc:mga09592_1482887_c1 3300050508 Unclassified 552
200 nmdc:mga06r32_1329317_c1 3300050510 Bacteria 662
201 nmdc:mga08y16_1719893_c1 3300050511 Unclassified 582
202 nmdc:mga08y16_798946_c1 3300050511 Bacteria 936
203 nmdc:mga0n895_217422_c1 3300050512 Unclassified 1940
204 nmdc:mga0rr50_1114098_c1 3300050513 Unclassified 671
205 Ga0495619_0653963 3300053085 Unclassified 717
206 Ga0070690_100562152
207 Ga0065707_10130719
208 Ga0065707_10159571
209 Ga0070690_100103397
210 Ga0070690_100244790
211 Ga0070680_101172176
212 Ga0068868_101071364
213 Ga0070660_100303229
214 Ga0070689_100105028
215 Ga0070689_100131045
216 Ga0070689_100648469
217 Ga0070671_100238913
218 Ga0070673_100183328
219 Ga0070673_101868516
220 Ga0070688_100037894
221 Ga0070688_100100541
222 Ga0070688_100135610
223 Ga0070667_100586561
224 Ga0070713_101846656
225 Ga0070701_10062598
226 Ga0070694_100658668
227 Ga0070663_101924992
228 Ga0070678_100106133
229 Ga0070681_10117700
230 Ga0070681_10263430
231 Ga0070685_10041201
232 Ga0070685_10070346
233 Ga0070685_10142732
234 Ga0070706_100627679
235 Ga0070707_100358175
236 Ga0070707_101375650
237 Ga0070707_101955433
238 Ga0070698_100145152
239 Ga0070698_101122091
240 Ga0070679_100782138
241 Ga0070679_101306769
242 Ga0070672_100143819
243 Ga0070686_100064265
244 Ga0070686_100085340
245 Ga0070686_100128994
246 Ga0070686_100133464
247 Ga0070693_101030182
248 Ga0070704_100105864
249 Ga0068855_101601543
250 Ga0070702_100065845
251 Ga0070702_100114852
252 Ga0068859_100075179
253 Ga0068859_100685525
254 Ga0068864_100351745
255 Ga0068864_100598880
256 Ga0068866_11429011
257 Ga0068861_101476679
258 Ga0068863_100081474
259 Ga0068858_101185007
260 Ga0068860_100529066
261 Ga0068860_101035223
262 Ga0097621_100116662
263 Ga0097621_100773401
264 Ga0075428_100212193
265 Ga0075431_101386213
266 Ga0075433_10135396
267 Ga0075434_100183390
268 Ga0075429_100125261
269 Ga0097620_100075179
270 Ga0097620_100685572
271 Ga0099794_10204633
272 Ga0111539_10203011
273 Ga0114129_10277818
274 Ga0114129_10519460
275 Ga0114129_11557571
276 Ga0105248_10268092
277 Ga0105248_10977917
278 Ga0105249_10150587
279 Ga0105249_11028996
280 Ga0105249_11321753
281 Ga0157371_10089066
282 Ga0157370_10233511
283 Ga0157374_10219127
284 Ga0157372_10617651
285 Ga0157375_10000494
286 Ga0157375_10215071
287 Ga0157375_10676642
288 Ga0163163_10174531
289 Ga0163163_11084437
290 Ga0157379_10467359
291 Ga0157379_10607102
292 Ga0157376_10122884
293 Ga0157376_12422071
294 Ga0163161_10473817
295 Ga0207663_10585430
296 Ga0207660_11724858
297 Ga0207657_10350023
298 Ga0207652_10384362
299 Ga0207646_10350875
300 Ga0207646_10624162
301 Ga0207670_10079394
302 Ga0207670_10106290
303 Ga0207670_10218902
304 Ga0207670_10230434
305 Ga0207670_10238425
306 Ga0207670_10371749
307 Ga0207691_10127575
308 Ga0207711_10163724
309 Ga0207667_10736705
310 Ga0207667_11483292
311 Ga0207651_10130120
312 Ga0207703_10487420
313 Ga0207703_11236288
314 Ga0207702_11083772
315 Ga0207641_10065223
316 Ga0207676_10399967
317 Ga0207675_100852622
318 Ga0207683_10172153
319 Ga0268266_10096228
320 Ga0268265_11887912
321 Ga0268264_10420992
322 Ga0265337_1016222
323 Ga0265337_1017738
324 Ga0265326_10020231
325 Ga0265319_1104865
326 Ga0265319_1220846
327 Ga0265334_10025188
328 Ga0265334_10028828
329 Ga0265334_10173523
330 Ga0265336_10065108
331 Ga0307517_10108611
332 Ga0265338_10012041
333 Ga0265338_10062001
334 Ga0265338_10112888
335 Ga0265338_10116234
336 Ga0265338_10128568
337 Ga0265338_10291611
338 Ga0265338_10510501
339 Ga0265338_10510705
340 Ga0265338_10591504
341 Ga0265338_10694902
342 Ga0265324_10020254
343 Ga0265324_10033907
344 Ga0265324_10185136
345 Ga0265332_10042133
346 Ga0265328_10063534
347 Ga0265320_10000231
348 Ga0265320_10067890
349 Ga0265320_10248099
350 Ga0265340_10048089
351 Ga0265340_10051291
352 Ga0265340_10053317
353 Ga0265331_10328579
354 Ga0265316_10099656
355 Ga0265316_10109420
356 Ga0265316_10110205
357 Ga0265316_10289834
358 Ga0265316_10389399
359 Ga0265316_11064651
360 Ga0265313_10043784
361 Ga0265314_10036981
362 Ga0265314_10138462
363 Ga0265342_10055376
364 Ga0307516_10153203
365 Ga0373961_0159167
366 Ga0373927_0134472
367 Ga0373927_0391434
368 Ga0373933_0357667
369 Ga0373933_0539506
370 Ga0316582_0335172
371 Ga0373925_0124434
372 Ga0373925_1393325
373 Ga0451577_0063344
374 Ga0451577_0332689
375 Ga0451577_0862541
376 Ga0453684_0003288
377 Ga0453684_0042181
378 Ga0453684_0792537
379 Ga0451576_0505773
380 Ga0495629_0182822
381 Ga0495653_0303981
382 Ga0495582_0915513
383 Ga0495662_0381824
384 Ga0495608_0840231
385 Ga0495630_0215785
386 Ga0495640_0311554
387 Ga0495586_0061879
388 Ga0495586_0778180
389 Ga0495621_0268114
390 Ga0495667_0389712
391 Ga0495659_0025992
392 Ga0495658_0324672
393 Ga0495613_0278966
394 Ga0495636_0063815
395 Ga0495674_0986439
396 Ga0495684_0067341
397 Ga0495614_0369952
398 Ga0496110_0284540
399 Ga0501073_0233915
400 Ga0501080_0035280
401 nmdc:mga05p37_1498887_c1
402 nmdc:mga05p37_701256_c1
403 nmdc:mga09592_138726_c1
404 nmdc:mga09592_1482887_c1
405 nmdc:mga06r32_1329317_c1
406 nmdc:mga08y16_1719893_c1
407 nmdc:mga08y16_798946_c1
408 nmdc:mga0n895_217422_c1
409 nmdc:mga0rr50_1114098_c1
410 Ga0495619_0653963

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20586

DUF6788

Family of unknown function (DUF6788)

54

116

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lnb-assembly1.cif.gz_A crystal structure analysis of arylamine n-acetyltransferase c from bacillus anthracis 0.7496 47 68
5ldp-assembly2.cif.gz_B crystal structure of e.coli ligt complexed with atp 0.5923 46 62
6hhf-assembly1.cif.gz_A crystal structure of akt1 in complex with covalent-allosteric akt inhibitor borussertib 0.5741 30 81
3q6c-assembly9.cif.gz_I x-ray crystal structure of duf2500 (pf10694) from klebsiella pneumoniae, northeast structural genomics consortium target kpr96 0.5342 28 69
4bwi-assembly1.cif.gz_B structure of the phytochrome cph2 from synechocystis sp. pcc6803 0.5286 44 105
ID Description Score Start End Superfamily
af_F1QR50_564_648_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8273 46 62 2.60.40.10
5vi4B02 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6634 46 59 2.60.40.10
af_Q96AC6_398_715_3.40.850.10 Alpha Beta;3-Layer(aba) Sandwich;Kinesin;Kinesin motor domain 0.6579 29 61 3.40.850.10
af_P64599_56_138_3.30.1050.10 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.6533 46 63 3.30.1050.10
af_Q4CK86_27_78_3.30.30.30 Alpha Beta;2-Layer Sandwich;Defensin A-like; 0.6032 30 60 3.30.30.30
ID Description Score Start End GO Terms
AF-A0A6N6PY36-F1-model_v4 Uncharacterized protein 0.9041 7 115
AF-A0A1V6JJM0-F1-model_v4 deleted 0.8982 1 113
AF-A0A0F9HGK6-F1-model_v4 Uncharacterized protein 0.8948 9 96
AF-A0A7V1H7L1-F1-model_v4 Uncharacterized protein 0.8906 10 94
AF-A0A1Q2MHA6-F1-model_v4 Phage protein 0.8861 16 93

Map