F313063

General Info

Members Datasets Scaffolds Average Seq Length
204 155 408 334

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0079102|Ga0501047_0079102_1278_2450
Length 367
Sequence MDSPPGRLGDVHYRRASAGFGHKDCELGKNAARHVPLWDTEEMPMASNYVPQPDRVAWVDYAKGFCIIFVVMMHSTLGVEAAAGQEGWAHAIVAFAKPFRMPDFFMISGLFLSRVIDRDWTTYLDRKVVHFAYFYVLWVTIQFAFKAPLFAQESGWSALPAMYLTAFVQPFGTLWFIYLLPIFFVFTKLARNVSPLAIWVFAAGLEIAHVETGSVVIDEFAARFVYFYTGYILASRIFALAAAAQARPAVALAGLVLWGYGNHLVVAQGWSDLPFVSLGLGFAGACAVVSVSALLALIEGPMMPLRYFGQNSIVIYLAFFLPMAASRAALLKLDLGLDLGTISMIVTAEGVTGAIVWYWILRKTPAE

Samples

Sample ID Description Type Environment
1 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
23 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
24 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
25 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
26 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
51 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
52 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
74 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
75 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
76 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
77 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
78 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
79 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
80 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
81 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
82 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
83 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
84 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
88 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
89 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
90 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
91 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
92 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
93 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
94 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
95 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
96 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
97 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
98 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
99 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
100 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
101 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
102 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
103 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
104 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
105 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
106 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
107 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
108 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
109 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
110 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
111 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
112 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
113 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
114 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
115 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
116 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
127 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
128 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
129 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
130 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
131 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
132 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
133 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
134 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
135 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
137 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
138 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
139 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
140 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
141 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
142 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
143 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
144 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
145 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
146 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
147 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
148 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
149 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
150 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
151 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
152 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
153 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
154 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
155 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.78
Nodule 0
Rhizoplane 11.27
Rhizosphere 75.98
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501047_0079102 3300049581 Bacteria 3162
2 JGI25153J46596_10000558 3300003215 Bacteria 23120
3 JGI25153J46596_10044622 3300003215 Bacteria 1331
4 Ga0070683_100387807 3300005329 Bacteria 1331
5 Ga0070690_100011327 3300005330 Bacteria 5213
6 Ga0070680_100020695 3300005336 Bacteria 5221
7 Ga0070660_100016089 3300005339 Bacteria 5421
8 Ga0070687_100039233 3300005343 Bacteria 2378
9 Ga0070671_100032311 3300005355 Bacteria 4328
10 Ga0070688_100011151 3300005365 Bacteria 4990
11 Ga0070714_100064615 3300005435 Bacteria 3150
12 Ga0070678_100043439 3300005456 Bacteria 3202
13 Ga0070681_10049654 3300005458 Bacteria 4189
14 Ga0070681_10074217 3300005458 Bacteria 3362
15 Ga0070679_100038284 3300005530 Bacteria 4767
16 Ga0070684_100076920 3300005535 Bacteria 2947
17 Ga0070686_100062665 3300005544 Bacteria 2406
18 Ga0070696_100022114 3300005546 Bacteria 4319
19 Ga0070665_100161435 3300005548 Bacteria 2243
20 Ga0068859_100037035 3300005617 Bacteria 4897
21 Ga0068864_100026278 3300005618 Bacteria 4909
22 Ga0068863_100167743 3300005841 Bacteria 2105
23 Ga0081455_10093151 3300005937 Bacteria 2436
24 Ga0081455_10191050 3300005937 Bacteria 1542
25 Ga0081538_10007831 3300005981 Bacteria 9163
26 Ga0081540_1000075 3300005983 Bacteria 106804
27 Ga0081540_1000807 3300005983 Bacteria 28790
28 Ga0081540_1020074 3300005983 Bacteria 4033
29 Ga0081540_1058158 3300005983 Bacteria 1864
30 Ga0075362_10097976 3300006177 Bacteria 1368
31 Ga0075367_10035524 3300006178 Bacteria 2885
32 Ga0075367_10056308 3300006178 Bacteria 2335
33 Ga0075366_10034372 3300006195 Bacteria 2985
34 Ga0075366_10043937 3300006195 Bacteria 2648
35 Ga0075366_10074863 3300006195 Bacteria 2019
36 Ga0068871_100036715 3300006358 Bacteria 3903
37 Ga0075430_100001165 3300006846 Bacteria 21040
38 Ga0075431_100251997 3300006847 Bacteria 1793
39 Ga0075429_100055786 3300006880 Bacteria 3438
40 Ga0097620_100037035 3300006931 Bacteria 4897
41 Ga0099795_10000315 3300007788 Bacteria 8739
42 Ga0105240_10001522 3300009093 Bacteria 39421
43 Ga0105240_10093833 3300009093 Bacteria 3662
44 Ga0105245_10296514 3300009098 Bacteria 1585
45 Ga0105247_10132766 3300009101 Bacteria 1624
46 Ga0114129_10016044 3300009147 Bacteria 10654
47 Ga0105241_10014577 3300009174 Bacteria 5757
48 Ga0105242_10184813 3300009176 Bacteria 1841
49 Ga0105248_10013450 3300009177 Bacteria 9009
50 Ga0105237_10006400 3300009545 Bacteria 13070
51 Ga0105238_10214593 3300009551 Bacteria 1901
52 Ga0105249_10001043 3300009553 Bacteria 24498
53 Ga0105239_10036387 3300010375 Bacteria 5404
54 Ga0105239_10056091 3300010375 Bacteria 4321
55 Ga0157373_10153656 3300013100 Bacteria 1619
56 Ga0157370_10059350 3300013104 Bacteria 3635
57 Ga0157369_10106849 3300013105 Bacteria 2978
58 Ga0163162_10476925 3300013306 Bacteria 1379
59 Ga0157372_10283059 3300013307 Bacteria 1928
60 Ga0163163_10122525 3300014325 Bacteria 2635
61 Ga0209233_1012145 3300025261 Bacteria 2508
62 Ga0209758_1000389 3300025297 Bacteria 75919
63 Ga0209758_1001478 3300025297 Bacteria 27491
64 Ga0207645_10174100 3300025907 Bacteria 1411
65 Ga0207707_10083634 3300025912 Bacteria 2787
66 Ga0207695_10000006 3300025913 Bacteria 1135309
67 Ga0207671_10001082 3300025914 Bacteria 33044
68 Ga0207693_10003625 3300025915 Bacteria 13195
69 Ga0207660_10071252 3300025917 Bacteria 2528
70 Ga0207662_10013174 3300025918 Bacteria 4620
71 Ga0207657_10056151 3300025919 Bacteria 3398
72 Ga0207652_10038886 3300025921 Bacteria 4035
73 Ga0207652_10104762 3300025921 Bacteria 2502
74 Ga0207681_10061149 3300025923 Bacteria 2588
75 Ga0207664_10120928 3300025929 Bacteria 2191
76 Ga0207644_10251214 3300025931 Bacteria 1411
77 Ga0207670_10008437 3300025936 Bacteria 5821
78 Ga0207669_10246574 3300025937 Bacteria 1327
79 Ga0207661_10044164 3300025944 Bacteria 3521
80 Ga0207668_10121979 3300025972 Bacteria 1975
81 Ga0207640_10050309 3300025981 Bacteria 2703
82 Ga0207658_10012657 3300025986 Bacteria 5763
83 Ga0207641_10116334 3300026088 Bacteria 2379
84 Ga0207676_10019968 3300026095 Bacteria 4895
85 Ga0207683_10019311 3300026121 Bacteria 5818
86 Ga0265337_1001245 3300028556 Bacteria 12858
87 Ga0265325_10005459 3300031241 Bacteria 7843
88 Ga0265325_10064567 3300031241 Bacteria 1850
89 Ga0265340_10055675 3300031247 Bacteria 1904
90 Ga0265339_10027469 3300031249 Bacteria 3248
91 Ga0265331_10048535 3300031250 Bacteria 2040
92 Ga0265313_10000710 3300031595 Bacteria 34401
93 Ga0265313_10017389 3300031595 Bacteria 4089
94 Ga0265313_10041650 3300031595 Bacteria 2261
95 Ga0265314_10075889 3300031711 Bacteria 2235
96 Ga0265342_10031710 3300031712 Bacteria 3265
97 Ga0373949_0025724 3300035090 Bacteria 1375
98 Ga0373941_0001285 3300035115 Bacteria 5283
99 Ga0373931_0006962 3300035691 Bacteria 5319
100 Ga0373933_0040422 3300035724 Bacteria 2748
101 Ga0373937_0006911 3300036401 Bacteria 9795
102 Ga0373925_0090412 3300037068 Bacteria 2340
103 Ga0395905_0046772 3300037471 Bacteria 4057
104 Ga0395905_0266849 3300037471 Bacteria 1597
105 Ga0495629_0006119 3300046459 Bacteria 8938
106 Ga0495582_0023476 3300046473 Bacteria 3374
107 Ga0495639_0111260 3300046475 Bacteria 1300
108 Ga0495584_0018932 3300046491 Bacteria 3498
109 Ga0495625_0082780 3300046660 Bacteria 2231
110 Ga0495657_0075945 3300046675 Bacteria 2183
111 Ga0495581_0079931 3300047315 Bacteria 1892
112 Ga0495672_0117508 3300047320 Bacteria 1419
113 Ga0495676_0043328 3300047321 Bacteria 3685
114 Ga0495686_0122821 3300047472 Bacteria 1546
115 Ga0496100_0125945 3300048903 Bacteria 1798
116 Ga0496101_0092285 3300048904 Bacteria 2254
117 Ga0496101_0295504 3300048904 Bacteria 1268
118 Ga0496102_0372985 3300048905 Bacteria 1343
119 Ga0496104_0001299 3300048907 Bacteria 21528
120 Ga0496104_0003482 3300048907 Bacteria 13576
121 Ga0496105_0014107 3300048908 Bacteria 6358
122 Ga0496105_0051359 3300048908 Bacteria 3406
123 Ga0496106_0173668 3300048909 Bacteria 1709
124 Ga0496106_0336988 3300048909 Bacteria 1211
125 Ga0496107_0210117 3300048910 Bacteria 1447
126 Ga0496108_0179904 3300048911 Bacteria 1831
127 Ga0496108_0303285 3300048911 Bacteria 1391
128 Ga0496108_0322025 3300048911 Bacteria 1348
129 Ga0496109_0433639 3300048912 Bacteria 1241
130 Ga0496110_0051698 3300048913 Bacteria 3611
131 Ga0496110_0096172 3300048913 Bacteria 2654
132 Ga0496110_0468811 3300048913 Bacteria 1147
133 Ga0496111_0068794 3300048914 Bacteria 2574
134 Ga0496112_0125655 3300048915 Bacteria 2536
135 Ga0496113_0121278 3300048916 Bacteria 2044
136 Ga0496113_0258751 3300048916 Bacteria 1390
137 Ga0496115_0006241 3300048918 Bacteria 8719
138 Ga0496119_0029709 3300048922 Bacteria 3697
139 Ga0496120_0010509 3300048923 Bacteria 6452
140 Ga0496121_0033731 3300048924 Bacteria 4626
141 Ga0496125_0046201 3300048928 Bacteria 3656
142 Ga0501031_0087956 3300049568 Bacteria 2026
143 Ga0501032_0028622 3300049569 Bacteria 3827
144 Ga0501033_0111457 3300049570 Bacteria 1991
145 Ga0501034_0001125 3300049571 Bacteria 37359
146 Ga0501034_0060853 3300049571 Bacteria 3793
147 Ga0501034_0147598 3300049571 Bacteria 2328
148 Ga0501034_0317207 3300049571 Bacteria 1492
149 Ga0501036_0040563 3300049572 Bacteria 3937
150 Ga0501037_0011886 3300049573 Bacteria 6411
151 Ga0501037_0054011 3300049573 Bacteria 2938
152 Ga0501038_0102065 3300049574 Bacteria 2387
153 Ga0501039_0016269 3300049575 Bacteria 5697
154 Ga0501043_0057612 3300049579 Bacteria 3050
155 Ga0501043_0198857 3300049579 Bacteria 1556
156 Ga0501046_0067816 3300049580 Bacteria 2777
157 Ga0501046_0171352 3300049580 Bacteria 1629
158 Ga0501047_0042279 3300049581 Bacteria 4404
159 Ga0501047_0088881 3300049581 Bacteria 2966
160 Ga0501047_0253117 3300049581 Bacteria 1609
161 Ga0501067_0005232 3300049583 Bacteria 7212
162 Ga0501068_0052741 3300049584 Bacteria 2461
163 Ga0501069_0027682 3300049585 Bacteria 3107
164 Ga0501070_0096145 3300049586 Bacteria 2451
165 Ga0501070_0171781 3300049586 Bacteria 1785
166 Ga0501073_0014278 3300049589 Bacteria 5768
167 Ga0501073_0131263 3300049589 Bacteria 1736
168 Ga0501074_0027819 3300049590 Bacteria 4099
169 Ga0501076_0054510 3300049592 Bacteria 3169
170 Ga0501080_0102865 3300049742 Bacteria 2649
171 Ga0501080_0114578 3300049742 Bacteria 2499
172 Ga0501083_0015403 3300049744 Bacteria 5354
173 Ga0501083_0046313 3300049744 Bacteria 2941
174 Ga0501083_0090517 3300049744 Bacteria 2020
175 Ga0501035_0118836 3300049822 Bacteria 2312
176 Ga0501035_0127640 3300049822 Bacteria 2220
177 Ga0501035_0329515 3300049822 Bacteria 1281
178 Ga0501044_0006324 3300049823 Bacteria 13095
179 Ga0501044_0058102 3300049823 Bacteria 3968
180 Ga0501044_0088733 3300049823 Bacteria 3121
181 Ga0501044_0095929 3300049823 Bacteria 2988
182 Ga0501044_0105845 3300049823 Bacteria 2825
183 nmdc:mga03683_29140_c1 3300050489 Bacteria 2199
184 nmdc:mga03n38_180203_c1 3300050490 Bacteria 1082
185 nmdc:mga0yw44_24500_c1 3300050492 Bacteria 3416
186 nmdc:mga0k408_149236_c1 3300050493 Bacteria 1392
187 nmdc:mga0k408_69042_c1 3300050493 Bacteria 2062
188 nmdc:mga07m45_36013_c1 3300050496 Bacteria 2754
189 nmdc:mga05p37_25378_c1 3300050507 Bacteria 7207
190 nmdc:mga05p37_5871_c1 3300050507 Bacteria 14439
191 nmdc:mga09592_21392_c1 3300050508 Bacteria 5330
192 nmdc:mga0qj67_195_c1 3300050509 Bacteria 41144
193 nmdc:mga0n895_59551_c1 3300050512 Bacteria 3767
194 nmdc:mga0a205_162397_c1 3300050515 Bacteria 2130
195 Ga0495601_0211889 3300053077 Bacteria 1266
196 Ga0500610_0110735 3300053079 Bacteria 1412
197 Ga0495619_0148122 3300053085 Bacteria 1619
198 Ga0500641_0032453 3300053096 Bacteria 2066
199 Ga0500557_038692 3300053105 Bacteria 1485
200 Ga0500562_038580 3300053108 Bacteria 1269
201 Ga0500616_0043677 3300053153 Bacteria 2395
202 Ga0501084_0126544 3300054114 Bacteria 2150
203 Ga0501084_0154237 3300054114 Bacteria 1936
204 Ga0501082_0017083 3300060353 Bacteria 6251
205 Ga0501047_0079102
206 JGI25153J46596_10000558
207 JGI25153J46596_10044622
208 Ga0070683_100387807
209 Ga0070690_100011327
210 Ga0070680_100020695
211 Ga0070660_100016089
212 Ga0070687_100039233
213 Ga0070671_100032311
214 Ga0070688_100011151
215 Ga0070714_100064615
216 Ga0070678_100043439
217 Ga0070681_10049654
218 Ga0070681_10074217
219 Ga0070679_100038284
220 Ga0070684_100076920
221 Ga0070686_100062665
222 Ga0070696_100022114
223 Ga0070665_100161435
224 Ga0068859_100037035
225 Ga0068864_100026278
226 Ga0068863_100167743
227 Ga0081455_10093151
228 Ga0081455_10191050
229 Ga0081538_10007831
230 Ga0081540_1000075
231 Ga0081540_1000807
232 Ga0081540_1020074
233 Ga0081540_1058158
234 Ga0075362_10097976
235 Ga0075367_10035524
236 Ga0075367_10056308
237 Ga0075366_10034372
238 Ga0075366_10043937
239 Ga0075366_10074863
240 Ga0068871_100036715
241 Ga0075430_100001165
242 Ga0075431_100251997
243 Ga0075429_100055786
244 Ga0097620_100037035
245 Ga0099795_10000315
246 Ga0105240_10001522
247 Ga0105240_10093833
248 Ga0105245_10296514
249 Ga0105247_10132766
250 Ga0114129_10016044
251 Ga0105241_10014577
252 Ga0105242_10184813
253 Ga0105248_10013450
254 Ga0105237_10006400
255 Ga0105238_10214593
256 Ga0105249_10001043
257 Ga0105239_10036387
258 Ga0105239_10056091
259 Ga0157373_10153656
260 Ga0157370_10059350
261 Ga0157369_10106849
262 Ga0163162_10476925
263 Ga0157372_10283059
264 Ga0163163_10122525
265 Ga0209233_1012145
266 Ga0209758_1000389
267 Ga0209758_1001478
268 Ga0207645_10174100
269 Ga0207707_10083634
270 Ga0207695_10000006
271 Ga0207671_10001082
272 Ga0207693_10003625
273 Ga0207660_10071252
274 Ga0207662_10013174
275 Ga0207657_10056151
276 Ga0207652_10038886
277 Ga0207652_10104762
278 Ga0207681_10061149
279 Ga0207664_10120928
280 Ga0207644_10251214
281 Ga0207670_10008437
282 Ga0207669_10246574
283 Ga0207661_10044164
284 Ga0207668_10121979
285 Ga0207640_10050309
286 Ga0207658_10012657
287 Ga0207641_10116334
288 Ga0207676_10019968
289 Ga0207683_10019311
290 Ga0265337_1001245
291 Ga0265325_10005459
292 Ga0265325_10064567
293 Ga0265340_10055675
294 Ga0265339_10027469
295 Ga0265331_10048535
296 Ga0265313_10000710
297 Ga0265313_10017389
298 Ga0265313_10041650
299 Ga0265314_10075889
300 Ga0265342_10031710
301 Ga0373949_0025724
302 Ga0373941_0001285
303 Ga0373931_0006962
304 Ga0373933_0040422
305 Ga0373937_0006911
306 Ga0373925_0090412
307 Ga0395905_0046772
308 Ga0395905_0266849
309 Ga0495629_0006119
310 Ga0495582_0023476
311 Ga0495639_0111260
312 Ga0495584_0018932
313 Ga0495625_0082780
314 Ga0495657_0075945
315 Ga0495581_0079931
316 Ga0495672_0117508
317 Ga0495676_0043328
318 Ga0495686_0122821
319 Ga0496100_0125945
320 Ga0496101_0092285
321 Ga0496101_0295504
322 Ga0496102_0372985
323 Ga0496104_0001299
324 Ga0496104_0003482
325 Ga0496105_0014107
326 Ga0496105_0051359
327 Ga0496106_0173668
328 Ga0496106_0336988
329 Ga0496107_0210117
330 Ga0496108_0179904
331 Ga0496108_0303285
332 Ga0496108_0322025
333 Ga0496109_0433639
334 Ga0496110_0051698
335 Ga0496110_0096172
336 Ga0496110_0468811
337 Ga0496111_0068794
338 Ga0496112_0125655
339 Ga0496113_0121278
340 Ga0496113_0258751
341 Ga0496115_0006241
342 Ga0496119_0029709
343 Ga0496120_0010509
344 Ga0496121_0033731
345 Ga0496125_0046201
346 Ga0501031_0087956
347 Ga0501032_0028622
348 Ga0501033_0111457
349 Ga0501034_0001125
350 Ga0501034_0060853
351 Ga0501034_0147598
352 Ga0501034_0317207
353 Ga0501036_0040563
354 Ga0501037_0011886
355 Ga0501037_0054011
356 Ga0501038_0102065
357 Ga0501039_0016269
358 Ga0501043_0057612
359 Ga0501043_0198857
360 Ga0501046_0067816
361 Ga0501046_0171352
362 Ga0501047_0042279
363 Ga0501047_0088881
364 Ga0501047_0253117
365 Ga0501067_0005232
366 Ga0501068_0052741
367 Ga0501069_0027682
368 Ga0501070_0096145
369 Ga0501070_0171781
370 Ga0501073_0014278
371 Ga0501073_0131263
372 Ga0501074_0027819
373 Ga0501076_0054510
374 Ga0501080_0102865
375 Ga0501080_0114578
376 Ga0501083_0015403
377 Ga0501083_0046313
378 Ga0501083_0090517
379 Ga0501035_0118836
380 Ga0501035_0127640
381 Ga0501035_0329515
382 Ga0501044_0006324
383 Ga0501044_0058102
384 Ga0501044_0088733
385 Ga0501044_0095929
386 Ga0501044_0105845
387 nmdc:mga03683_29140_c1
388 nmdc:mga03n38_180203_c1
389 nmdc:mga0yw44_24500_c1
390 nmdc:mga0k408_149236_c1
391 nmdc:mga0k408_69042_c1
392 nmdc:mga07m45_36013_c1
393 nmdc:mga05p37_25378_c1
394 nmdc:mga05p37_5871_c1
395 nmdc:mga09592_21392_c1
396 nmdc:mga0qj67_195_c1
397 nmdc:mga0n895_59551_c1
398 nmdc:mga0a205_162397_c1
399 Ga0495601_0211889
400 Ga0500610_0110735
401 Ga0495619_0148122
402 Ga0500641_0032453
403 Ga0500557_038692
404 Ga0500562_038580
405 Ga0500616_0043677
406 Ga0501084_0126544
407 Ga0501084_0154237
408 Ga0501082_0017083

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01757

Acyl_transf_3

Acyltransferase family

56

362

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xt4-assembly1.cif.gz_A c3_hd-1069 (1bh-69) - fusion protein of helical bundle and repeat protein 0.214 124 298
6ob6-assembly1.cif.gz_A human equilibrative nucleoside transporter-1, s-(4-nitrobenzyl)-6-thioinosine bound, merohedrally twinned 0.2056 23 253
5i20-assembly6.cif.gz_F crystal structure of protein 0.1966 25 283
5i20-assembly6.cif.gz_F crystal structure of protein 0.1904 25 283
3vvp-assembly2.cif.gz_B crystal structure of mate in complex with br-nrf 0.1861 13 298
ID Description Score Start End Superfamily
af_B6T9A5_7_198_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2631 23 240 1.20.1250.20
af_O02340_274_499_1.10.357.20 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain 0.2577 160 295 1.10.357.20
af_Q8IBB7_55_248_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2564 22 224 1.20.1250.20
af_Q2G226_6_195_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2469 23 246 1.20.1250.20
af_B6T9A5_7_198_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2446 23 240 1.20.1250.20
ID Description Score Start End GO Terms
AF-J3C8E1-F1-model_v4 Putative membrane protein 0.8057 13 310 GO:0005886
GO:0009246
GO:0016413
AF-A0A059FMA3-F1-model_v4 Acyltransferase 3 domain-containing protein 0.8052 20 315 GO:0005886
GO:0009246
GO:0016413
AF-K8P1L1-F1-model_v4 Acyltransferase 3 domain-containing protein 0.8046 10 320 GO:0005886
GO:0009246
GO:0016413
AF-A0A679F6H1-F1-model_v4 Acyltransferase 0.7998 19 314 GO:0005886
GO:0009246
GO:0016413
AF-A0A1I5KUG4-F1-model_v4 Uncharacterized membrane protein YcfT 0.7972 21 316 GO:0005886
GO:0009246
GO:0016413

Map