F312867

General Info

Members Datasets Scaffolds Average Seq Length
204 136 204 279

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0056371|Ga0451576_0056371_424_1389
Length 321
Sequence MMVNRPTWNGLNIRPVVTISPLVVLTQRTPFRLKGKRQAMETPRSGTLYIVATPIGNLEDITFRAVRILKEVDLIAAEDTRHSRKLVSHFGIPTRLTPYHDHNERLKTDYLLERLRAGDSVAIITDAGTPCIADPGYRIARAAASAGIRVVPVPGPSAIIAALSAAGLPTDRFAFEGFLPPKQGKRKNRLQELRGDDRVLIFYEAPHRLADALADMAELFGDRDAVVARELTKIHEEFRHGRLSELADHYGNAGVKGEIVILVSPAGEEDDSAVPDPAELLRRKLLEEGLSIRDAVAATVAATGKSRSDVYPLALKIREES

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
85 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
86 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
87 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
88 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
92 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
93 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
94 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
95 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
96 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
97 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
98 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
99 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
100 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
101 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
102 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
103 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
104 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
105 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
106 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
107 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
108 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
109 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
110 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
111 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
112 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
113 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
114 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
115 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
116 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
121 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
122 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
123 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
124 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
125 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
126 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
127 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
128 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
129 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
130 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
131 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
132 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
133 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
134 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
135 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
136 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.98
Nodule 0
Rhizoplane 1.47
Rhizosphere 81.37
Stem 0
Stem Tuber 0
Unclassified 16.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10001707 3300005290 Bacteria 6184
2 Ga0065715_10018798 3300005293 Bacteria 3244
3 Ga0070690_100028669 3300005330 Bacteria 3450
4 Ga0070690_100124066 3300005330 Bacteria 1737
5 Ga0070670_100004673 3300005331 Bacteria 11488
6 Ga0070680_100024204 3300005336 Bacteria 4846
7 Ga0070680_100221406 3300005336 Bacteria 1597
8 Ga0070682_100097955 3300005337 Bacteria 1931
9 Ga0070669_100023168 3300005353 Bacteria 4445
10 Ga0070674_100034112 3300005356 Bacteria 3395
11 Ga0070673_100063293 3300005364 Bacteria 2943
12 Ga0070667_100227117 3300005367 Bacteria 1663
13 Ga0070705_100116153 3300005440 Bacteria 1720
14 Ga0070694_100003148 3300005444 Bacteria 9828
15 Ga0070708_100152746 3300005445 Bacteria 2148
16 Ga0070681_10016429 3300005458 Bacteria 7389
17 Ga0070681_10036704 3300005458 Bacteria 4921
18 Ga0070681_10425112 3300005458 Bacteria 1240
19 Ga0068867_100043958 3300005459 Bacteria 3271
20 Ga0070685_10366961 3300005466 Bacteria 988
21 Ga0070698_100107392 3300005471 Unclassified 2759
22 Ga0070698_100246375 3300005471 Bacteria 1720
23 Ga0070699_100138571 3300005518 Bacteria 2147
24 Ga0070679_100459626 3300005530 Bacteria 1218
25 Ga0070697_100431245 3300005536 Unclassified 1146
26 Ga0070686_100006639 3300005544 Bacteria 6440
27 Ga0070695_100033071 3300005545 Bacteria 3234
28 Ga0070696_100031073 3300005546 Bacteria 3659
29 Ga0070696_100201985 3300005546 Bacteria 1484
30 Ga0070704_100134490 3300005549 Bacteria 1921
31 Ga0070664_100001266 3300005564 Bacteria 20248
32 Ga0068856_100003580 3300005614 Bacteria 15629
33 Ga0068866_10015604 3300005718 Bacteria 3377
34 Ga0075367_10256508 3300006178 Unclassified 1097
35 Ga0068871_100162621 3300006358 Bacteria 1910
36 Ga0075431_100009406 3300006847 Bacteria 9809
37 Ga0075433_10070274 3300006852 Bacteria 3077
38 Ga0075434_100016699 3300006871 Bacteria 7060
39 Ga0075434_100171940 3300006871 Bacteria 2186
40 Ga0068865_100033753 3300006881 Bacteria 3427
41 Ga0075436_100020138 3300006914 Bacteria 4579
42 Ga0075435_100171056 3300007076 Bacteria 1833
43 Ga0111539_10946541 3300009094 Bacteria 1001
44 Ga0105245_10242226 3300009098 Bacteria 1748
45 Ga0114129_10150487 3300009147 Bacteria 3185
46 Ga0105243_10191058 3300009148 Bacteria 1789
47 Ga0105243_10605381 3300009148 Bacteria 1055
48 Ga0105241_10200452 3300009174 Bacteria 1667
49 Ga0105242_10103561 3300009176 Bacteria 2415
50 Ga0105248_10035898 3300009177 Bacteria 5545
51 Ga0105237_10231097 3300009545 Bacteria 1850
52 Ga0105249_10022041 3300009553 Bacteria 5705
53 Ga0105249_10558908 3300009553 Bacteria 1196
54 Ga0105239_10020111 3300010375 Bacteria 7365
55 Ga0105246_10225722 3300011119 Bacteria 1471
56 Ga0157378_10003746 3300013297 Bacteria 13472
57 Ga0157378_10010590 3300013297 Bacteria 8058
58 Ga0157378_10099725 3300013297 Bacteria 2650
59 Ga0163162_10015279 3300013306 Bacteria 7499
60 Ga0163162_10016982 3300013306 Bacteria 7121
61 Ga0163162_10055726 3300013306 Bacteria 3981
62 Ga0163162_10511993 3300013306 Bacteria 1330
63 Ga0157372_10142894 3300013307 Bacteria 2759
64 Ga0157375_10312823 3300013308 Bacteria 1735
65 Ga0163163_10360782 3300014325 Bacteria 1510
66 Ga0157380_10029206 3300014326 Unclassified 4214
67 Ga0157376_10015654 3300014969 Bacteria 5735
68 Ga0207688_10011732 3300025901 Bacteria 4767
69 Ga0207645_10000621 3300025907 Bacteria 29382
70 Ga0207684_10109047 3300025910 Bacteria 2369
71 Ga0207684_10207085 3300025910 Bacteria 1692
72 Ga0207654_10086114 3300025911 Bacteria 1904
73 Ga0207707_10021118 3300025912 Bacteria 5690
74 Ga0207707_10107709 3300025912 Bacteria 2436
75 Ga0207707_10326154 3300025912 Bacteria 1325
76 Ga0207660_10064139 3300025917 Bacteria 2651
77 Ga0207657_10005433 3300025919 Bacteria 13313
78 Ga0207646_10012972 3300025922 Bacteria 7988
79 Ga0207650_10000544 3300025925 Bacteria 30733
80 Ga0207687_10348038 3300025927 Bacteria 1207
81 Ga0207690_10016194 3300025932 Bacteria 4532
82 Ga0207686_10141731 3300025934 Bacteria 1662
83 Ga0207704_10328616 3300025938 Bacteria 1182
84 Ga0207691_10015801 3300025940 Bacteria 7172
85 Ga0207711_10013840 3300025941 Bacteria 6698
86 Ga0207661_10275764 3300025944 Bacteria 1502
87 Ga0207679_10003349 3300025945 Bacteria 9896
88 Ga0207667_10347726 3300025949 Bacteria 1512
89 Ga0207668_10008830 3300025972 Bacteria 6024
90 Ga0207703_10118724 3300026035 Bacteria 2268
91 Ga0207708_10150776 3300026075 Bacteria 1830
92 Ga0207702_10246319 3300026078 Bacteria 1676
93 Ga0207641_10281975 3300026088 Bacteria 1563
94 Ga0207648_10040981 3300026089 Bacteria 4067
95 Ga0207674_10058635 3300026116 Bacteria 3899
96 Ga0207675_100084446 3300026118 Bacteria 2979
97 Ga0207675_100129424 3300026118 Bacteria 2393
98 Ga0207683_10011609 3300026121 Bacteria 7520
99 Ga0209971_1002771 3300027682 Bacteria 4190
100 Ga0209974_10020504 3300027876 Unclassified 2190
101 Ga0268264_10186118 3300028381 Bacteria 1890
102 Ga0316577_10060646 3300031733 Bacteria 2111
103 Ga0373947_0035122 3300035725 Bacteria 2967
104 Ga0373937_0253432 3300036401 Bacteria 1659
105 Ga0316584_0037919 3300036712 Bacteria 3584
106 Ga0373925_0157268 3300037068 Bacteria 1788
107 Ga0395900_0005538 3300037418 Bacteria 13220
108 Ga0395898_0021085 3300037466 Bacteria 6611
109 Ga0395898_0679559 3300037466 Bacteria 972
110 Ga0316581_0040997 3300037588 Unclassified 1410
111 Ga0400490_60356 3300038726 Bacteria 41641
112 Ga0400485_11527 3300038735 Bacteria 2044
113 Ga0400488_06264 3300038741 Bacteria 2970
114 Ga0400483_082421 3300039062 Bacteria 22526
115 Ga0400487_04330 3300039110 Bacteria 3037
116 Ga0400487_07774 3300039110 Bacteria 5699
117 Ga0400487_30214 3300039110 Bacteria 8672
118 Ga0451577_0000398 3300042876 Bacteria 79644
119 Ga0451577_0019126 3300042876 Bacteria 6302
120 Ga0451577_0026703 3300042876 Bacteria 5230
121 Ga0451577_0075303 3300042876 Bacteria 3010
122 Ga0453683_0000068 3300044673 Bacteria 164042
123 Ga0453683_0000071 3300044673 Bacteria 158207
124 Ga0453683_0007948 3300044673 Bacteria 7147
125 Ga0453683_0017391 3300044673 Bacteria 4628
126 Ga0453683_0023965 3300044673 Bacteria 3887
127 Ga0453683_0097425 3300044673 Bacteria 1846
128 Ga0453684_0001180 3300044712 Bacteria 80973
129 Ga0453684_0007314 3300044712 Bacteria 20423
130 Ga0453684_0033759 3300044712 Bacteria 7122
131 Ga0453684_0081143 3300044712 Bacteria 4046
132 Ga0453684_0220397 3300044712 Bacteria 2198
133 Ga0453684_0223963 3300044712 Bacteria 2176
134 Ga0453684_0253147 3300044712 Bacteria 2021
135 Ga0451576_0000847 3300045051 Bacteria 59370
136 Ga0451576_0005205 3300045051 Bacteria 16433
137 Ga0451576_0031525 3300045051 Bacteria 5650
138 Ga0451576_0056371 3300045051 Bacteria 4109
139 Ga0451576_0101899 3300045051 Bacteria 2986
140 Ga0451576_0122853 3300045051 Bacteria 2704
141 Ga0451576_0272008 3300045051 Bacteria 1771
142 Ga0451576_0319663 3300045051 Bacteria 1624
143 Ga0451576_0326897 3300045051 Bacteria 1605
144 Ga0451576_0490102 3300045051 Bacteria 1291
145 Ga0495594_0118724 3300046499 Bacteria 1494
146 Ga0495645_0097772 3300046543 Bacteria 2090
147 Ga0496106_0034253 3300048909 Bacteria 3793
148 Ga0496112_0198140 3300048915 Bacteria 1968
149 Ga0496113_0256449 3300048916 Bacteria 1397
150 Ga0496116_0000467 3300048919 Bacteria 55852
151 Ga0496116_0021623 3300048919 Bacteria 4843
152 Ga0496116_0100174 3300048919 Bacteria 1733
153 Ga0496117_0000384 3300048920 Bacteria 75876
154 Ga0496118_0024746 3300048921 Bacteria 5172
155 Ga0496118_0089477 3300048921 Bacteria 2125
156 Ga0496119_0001960 3300048922 Bacteria 23400
157 Ga0496119_0009275 3300048922 Bacteria 8474
158 Ga0496119_0024055 3300048922 Bacteria 4298
159 Ga0496120_0000037 3300048923 Bacteria 204517
160 Ga0496120_0000436 3300048923 Bacteria 66033
161 Ga0496120_0001867 3300048923 Bacteria 23443
162 Ga0496120_0007173 3300048923 Bacteria 8352
163 Ga0496122_0000139 3300048925 Bacteria 169425
164 Ga0496122_0000198 3300048925 Bacteria 135710
165 Ga0496122_0001053 3300048925 Bacteria 48216
166 Ga0496122_0193129 3300048925 Bacteria 1199
167 Ga0496123_0000864 3300048926 Bacteria 48216
168 Ga0496123_0017982 3300048926 Bacteria 5656
169 Ga0496124_0037508 3300048927 Bacteria 4215
170 Ga0496125_0000084 3300048928 Bacteria 223170
171 Ga0496125_0158941 3300048928 Bacteria 1538
172 Ga0496126_0000354 3300048929 Bacteria 96154
173 Ga0496126_0000413 3300048929 Bacteria 86439
174 Ga0496126_0001622 3300048929 Bacteria 34017
175 Ga0496126_0183561 3300048929 Bacteria 1775
176 Ga0501039_0091785 3300049575 Bacteria 2367
177 Ga0501040_0441387 3300049576 Bacteria 936
178 Ga0501041_0169436 3300049577 Unclassified 1366
179 Ga0501046_0077263 3300049580 Bacteria 2578
180 Ga0501070_0047308 3300049586 Bacteria 3575
181 Ga0501071_0036956 3300049587 Bacteria 3485
182 Ga0501071_0073827 3300049587 Unclassified 2489
183 Ga0501072_0096374 3300049588 Bacteria 2351
184 Ga0501072_0101723 3300049588 Unclassified 2284
185 Ga0501074_0305013 3300049590 Bacteria 1131
186 Ga0501075_0014412 3300049591 Bacteria 5664
187 Ga0501077_0146327 3300049593 Unclassified 1499
188 Ga0501077_0149879 3300049593 Unclassified 1480
189 Ga0501079_0112272 3300049741 Unclassified 2118
190 Ga0501080_0353099 3300049742 Unclassified 1327
191 Ga0501081_0002676 3300049743 Bacteria 11260
192 Ga0501081_0151210 3300049743 Bacteria 1668
193 Ga0501081_0385967 3300049743 Unclassified 1035
194 Ga0501083_0090472 3300049744 Bacteria 2021
195 nmdc:mga06z11_280824_c1 3300050494 Unclassified 986
196 nmdc:mga0qj67_52294_c1 3300050509 Bacteria 3232
197 nmdc:mga06r32_224193_c1 3300050510 Bacteria 1868
198 nmdc:mga08y16_39669_c1 3300050511 Bacteria 4940
199 nmdc:mga08y16_67133_c1 3300050511 Bacteria 3741
200 nmdc:mga0n895_32702_c1 3300050512 Bacteria 4994
201 nmdc:mga0n895_42048_c2 3300050512 Bacteria 2724
202 nmdc:mga0rr50_25548_c1 3300050513 Bacteria 4108
203 Ga0501082_0003683 3300060353 Bacteria 13394
204 Ga0501082_0015916 3300060353 Bacteria 6469

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009148 Ga0105243_10605381 Ga0105243_106053812 236
2 3300005471 Ga0070698_100246375 Ga0070698_1002463752 247
3 3300037418 Ga0395900_0005538 Ga0395900_0005538_9530_10507 251
4 3300039110 Ga0400487_30214 Ga0400487_30214_844_1752 252
5 3300027876 Ga0209974_10020504 Ga0209974_100205042 257
6 3300005518 Ga0070699_100138571 Ga0070699_1001385712 260
7 3300025910 Ga0207684_10207085 Ga0207684_102070852 260
8 3300037466 Ga0395898_0021085 Ga0395898_0021085_3415_4392 260
9 3300038741 Ga0400488_06264 Ga0400488_06264_83_970 260
10 3300039110 Ga0400487_07774 Ga0400487_07774_3202_4089 260
11 3300048919 Ga0496116_0021623 Ga0496116_0021623_501_1358 261
12 3300048919 Ga0496116_0100174 Ga0496116_0100174_433_1290 261
13 3300044673 Ga0453683_0023965 Ga0453683_0023965_1873_2748 263
14 3300045051 Ga0451576_0326897 Ga0451576_0326897_502_1368 263
15 3300049586 Ga0501070_0047308 Ga0501070_0047308_534_1364 265
16 3300049587 Ga0501071_0036956 Ga0501071_0036956_729_1559 265
17 3300049588 Ga0501072_0096374 Ga0501072_0096374_189_1019 265
18 3300049590 Ga0501074_0305013 Ga0501074_0305013_13_843 265
19 3300049743 Ga0501081_0385967 Ga0501081_0385967_150_980 265
20 3300049744 Ga0501083_0090472 Ga0501083_0090472_1088_1918 265
21 3300060353 Ga0501082_0015916 Ga0501082_0015916_1669_2499 265
22 3300037466 Ga0395898_0679559 Ga0395898_0679559_42_929 266
23 3300006852 Ga0075433_10070274 Ga0075433_100702743 267
24 3300006871 Ga0075434_100171940 Ga0075434_1001719403 267
25 3300050511 nmdc:mga08y16_67133_c1 nmdc:mga08y16_67133_c1_18_851 267
26 3300050512 nmdc:mga0n895_32702_c1 nmdc:mga0n895_32702_c1_2855_3688 267
27 3300005458 Ga0070681_10425112 Ga0070681_104251122 268
28 3300005546 Ga0070696_100201985 Ga0070696_1002019853 268
29 3300025912 Ga0207707_10326154 Ga0207707_103261542 268
30 3300036401 Ga0373937_0253432 Ga0373937_0253432_310_1158 268
31 3300048929 Ga0496126_0183561 Ga0496126_0183561_925_1755 269
32 3300044712 Ga0453684_0220397 Ga0453684_0220397_451_1281 270
33 3300045051 Ga0451576_0319663 Ga0451576_0319663_142_972 270
34 3300048921 Ga0496118_0024746 Ga0496118_0024746_1753_2610 270
35 3300048922 Ga0496119_0024055 Ga0496119_0024055_1338_2195 270
36 3300048923 Ga0496120_0000436 Ga0496120_0000436_42254_43111 270
37 3300048927 Ga0496124_0037508 Ga0496124_0037508_3151_4008 270
38 3300006178 Ga0075367_10256508 Ga0075367_102565081 273
39 3300031733 Ga0316577_10060646 Ga0316577_100606462 273
40 3300036712 Ga0316584_0037919 Ga0316584_0037919_1103_1942 273
41 3300037588 Ga0316581_0040997 Ga0316581_0040997_21_860 273
42 3300048919 Ga0496116_0000467 Ga0496116_0000467_24736_25578 273
43 3300048925 Ga0496122_0193129 Ga0496122_0193129_79_921 273
44 3300050494 nmdc:mga06z11_280824_c1 nmdc:mga06z11_280824_c1_70_921 273
45 3300005471 Ga0070698_100107392 Ga0070698_1001073923 274
46 3300009177 Ga0105248_10035898 Ga0105248_100358983 274
47 3300013306 Ga0163162_10016982 Ga0163162_100169829 274
48 3300025941 Ga0207711_10013840 Ga0207711_100138405 274
49 3300042876 Ga0451577_0019126 Ga0451577_0019126_3054_3908 274
50 3300042876 Ga0451577_0075303 Ga0451577_0075303_564_1394 274
51 3300044712 Ga0453684_0223963 Ga0453684_0223963_256_1110 274
52 3300046543 Ga0495645_0097772 Ga0495645_0097772_1126_1992 274
53 3300025910 Ga0207684_10109047 Ga0207684_101090472 275
54 3300025922 Ga0207646_10012972 Ga0207646_100129724 275
55 3300044712 Ga0453684_0007314 Ga0453684_0007314_3991_4848 275
56 3300048920 Ga0496117_0000384 Ga0496117_0000384_52132_52989 275
57 3300048921 Ga0496118_0089477 Ga0496118_0089477_1083_1940 275
58 3300048922 Ga0496119_0001960 Ga0496119_0001960_21081_21938 275
59 3300048922 Ga0496119_0009275 Ga0496119_0009275_4133_4990 275
60 3300048923 Ga0496120_0000037 Ga0496120_0000037_21081_21938 275
61 3300048923 Ga0496120_0001867 Ga0496120_0001867_6273_7139 275
62 3300048923 Ga0496120_0007173 Ga0496120_0007173_3351_4208 275
63 3300048925 Ga0496122_0000139 Ga0496122_0000139_147062_147919 275
64 3300048925 Ga0496122_0000198 Ga0496122_0000198_66561_67409 275
65 3300048925 Ga0496122_0001053 Ga0496122_0001053_26463_27320 275
66 3300048926 Ga0496123_0000864 Ga0496123_0000864_20897_21754 275
67 3300048926 Ga0496123_0017982 Ga0496123_0017982_4286_5143 275
68 3300048928 Ga0496125_0000084 Ga0496125_0000084_195851_196708 275
69 3300048928 Ga0496125_0158941 Ga0496125_0158941_556_1404 275
70 3300048929 Ga0496126_0000354 Ga0496126_0000354_54788_55636 275
71 3300048929 Ga0496126_0000413 Ga0496126_0000413_64076_64933 275
72 3300048929 Ga0496126_0001622 Ga0496126_0001622_29167_30024 275
73 3300049575 Ga0501039_0091785 Ga0501039_0091785_598_1443 275
74 3300049576 Ga0501040_0441387 Ga0501040_0441387_55_900 275
75 3300049577 Ga0501041_0169436 Ga0501041_0169436_506_1351 275
76 3300049580 Ga0501046_0077263 Ga0501046_0077263_1625_2452 275
77 3300049587 Ga0501071_0073827 Ga0501071_0073827_499_1344 275
78 3300049588 Ga0501072_0101723 Ga0501072_0101723_290_1135 275
79 3300049591 Ga0501075_0014412 Ga0501075_0014412_2673_3518 275
80 3300049593 Ga0501077_0146327 Ga0501077_0146327_155_1000 275
81 3300049741 Ga0501079_0112272 Ga0501079_0112272_437_1282 275
82 3300049742 Ga0501080_0353099 Ga0501080_0353099_75_920 275
83 3300049743 Ga0501081_0002676 Ga0501081_0002676_8320_9165 275
84 3300060353 Ga0501082_0003683 Ga0501082_0003683_9872_10717 275
85 3300005330 Ga0070690_100124066 Ga0070690_1001240662 276
86 3300005445 Ga0070708_100152746 Ga0070708_1001527462 276
87 3300005536 Ga0070697_100431245 Ga0070697_1004312452 276
88 3300005549 Ga0070704_100134490 Ga0070704_1001344901 276
89 3300009148 Ga0105243_10191058 Ga0105243_101910581 276
90 3300009553 Ga0105249_10558908 Ga0105249_105589082 276
91 3300013297 Ga0157378_10010590 Ga0157378_100105902 276
92 3300013306 Ga0163162_10511993 Ga0163162_105119931 276
93 3300014326 Ga0157380_10029206 Ga0157380_100292065 276
94 3300025934 Ga0207686_10141731 Ga0207686_101417311 276
95 3300026035 Ga0207703_10118724 Ga0207703_101187243 276
96 3300026118 Ga0207675_100129424 Ga0207675_1001294242 276
97 3300035725 Ga0373947_0035122 Ga0373947_0035122_2023_2865 276
98 3300038726 Ga0400490_60356 Ga0400490_60356_15933_16802 276
99 3300038735 Ga0400485_11527 Ga0400485_11527_715_1584 276
100 3300039110 Ga0400487_04330 Ga0400487_04330_1766_2635 276
101 3300042876 Ga0451577_0000398 Ga0451577_0000398_68514_69356 276
102 3300044673 Ga0453683_0000071 Ga0453683_0000071_107511_108365 276
103 3300044673 Ga0453683_0007948 Ga0453683_0007948_3362_4213 276
104 3300044673 Ga0453683_0097425 Ga0453683_0097425_175_1014 276
105 3300044712 Ga0453684_0001180 Ga0453684_0001180_55504_56346 276
106 3300044712 Ga0453684_0253147 Ga0453684_0253147_615_1469 276
107 3300045051 Ga0451576_0000847 Ga0451576_0000847_57992_58846 276
108 3300045051 Ga0451576_0122853 Ga0451576_0122853_1339_2190 276
109 3300045051 Ga0451576_0272008 Ga0451576_0272008_523_1365 276
110 3300049593 Ga0501077_0149879 Ga0501077_0149879_156_986 276
111 3300005290 Ga0065712_10001707 Ga0065712_100017072 277
112 3300005293 Ga0065715_10018798 Ga0065715_100187981 277
113 3300005330 Ga0070690_100028669 Ga0070690_1000286694 277
114 3300005331 Ga0070670_100004673 Ga0070670_1000046732 277
115 3300005336 Ga0070680_100024204 Ga0070680_1000242043 277
116 3300005336 Ga0070680_100221406 Ga0070680_1002214062 277
117 3300005337 Ga0070682_100097955 Ga0070682_1000979552 277
118 3300005353 Ga0070669_100023168 Ga0070669_1000231682 277
119 3300005356 Ga0070674_100034112 Ga0070674_1000341124 277
120 3300005364 Ga0070673_100063293 Ga0070673_1000632934 277
121 3300005367 Ga0070667_100227117 Ga0070667_1002271172 277
122 3300005440 Ga0070705_100116153 Ga0070705_1001161532 277
123 3300005444 Ga0070694_100003148 Ga0070694_1000031487 277
124 3300005458 Ga0070681_10016429 Ga0070681_100164295 277
125 3300005458 Ga0070681_10036704 Ga0070681_100367045 277
126 3300005459 Ga0068867_100043958 Ga0068867_1000439582 277
127 3300005466 Ga0070685_10366961 Ga0070685_103669611 277
128 3300005530 Ga0070679_100459626 Ga0070679_1004596262 277
129 3300005544 Ga0070686_100006639 Ga0070686_1000066396 277
130 3300005545 Ga0070695_100033071 Ga0070695_1000330714 277
131 3300005546 Ga0070696_100031073 Ga0070696_1000310734 277
132 3300005564 Ga0070664_100001266 Ga0070664_10000126615 277
133 3300005614 Ga0068856_100003580 Ga0068856_1000035805 277
134 3300005718 Ga0068866_10015604 Ga0068866_100156042 277
135 3300006358 Ga0068871_100162621 Ga0068871_1001626213 277
136 3300006847 Ga0075431_100009406 Ga0075431_1000094062 277
137 3300006871 Ga0075434_100016699 Ga0075434_1000166994 277
138 3300006881 Ga0068865_100033753 Ga0068865_1000337534 277
139 3300006914 Ga0075436_100020138 Ga0075436_1000201385 277
140 3300007076 Ga0075435_100171056 Ga0075435_1001710563 277
141 3300009094 Ga0111539_10946541 Ga0111539_109465411 277
142 3300009098 Ga0105245_10242226 Ga0105245_102422262 277
143 3300009147 Ga0114129_10150487 Ga0114129_101504872 277
144 3300009174 Ga0105241_10200452 Ga0105241_102004521 277
145 3300009176 Ga0105242_10103561 Ga0105242_101035613 277
146 3300009545 Ga0105237_10231097 Ga0105237_102310973 277
147 3300009553 Ga0105249_10022041 Ga0105249_100220415 277
148 3300010375 Ga0105239_10020111 Ga0105239_100201116 277
149 3300011119 Ga0105246_10225722 Ga0105246_102257222 277
150 3300013297 Ga0157378_10003746 Ga0157378_100037468 277
151 3300013297 Ga0157378_10099725 Ga0157378_100997254 277
152 3300013306 Ga0163162_10015279 Ga0163162_100152795 277
153 3300013306 Ga0163162_10055726 Ga0163162_100557264 277
154 3300013307 Ga0157372_10142894 Ga0157372_101428944 277
155 3300013308 Ga0157375_10312823 Ga0157375_103128232 277
156 3300014325 Ga0163163_10360782 Ga0163163_103607822 277
157 3300014969 Ga0157376_10015654 Ga0157376_100156546 277
158 3300025901 Ga0207688_10011732 Ga0207688_100117324 277
159 3300025907 Ga0207645_10000621 Ga0207645_100006214 277
160 3300025911 Ga0207654_10086114 Ga0207654_100861142 277
161 3300025912 Ga0207707_10021118 Ga0207707_100211185 277
162 3300025912 Ga0207707_10107709 Ga0207707_101077094 277
163 3300025917 Ga0207660_10064139 Ga0207660_100641393 277
164 3300025919 Ga0207657_10005433 Ga0207657_1000543312 277
165 3300025925 Ga0207650_10000544 Ga0207650_100005448 277
166 3300025927 Ga0207687_10348038 Ga0207687_103480381 277
167 3300025932 Ga0207690_10016194 Ga0207690_100161942 277
168 3300025938 Ga0207704_10328616 Ga0207704_103286162 277
169 3300025940 Ga0207691_10015801 Ga0207691_100158014 277
170 3300025944 Ga0207661_10275764 Ga0207661_102757641 277
171 3300025945 Ga0207679_10003349 Ga0207679_100033496 277
172 3300025949 Ga0207667_10347726 Ga0207667_103477261 277
173 3300025972 Ga0207668_10008830 Ga0207668_100088306 277
174 3300026075 Ga0207708_10150776 Ga0207708_101507761 277
175 3300026078 Ga0207702_10246319 Ga0207702_102463192 277
176 3300026088 Ga0207641_10281975 Ga0207641_102819752 277
177 3300026089 Ga0207648_10040981 Ga0207648_100409814 277
178 3300026116 Ga0207674_10058635 Ga0207674_100586354 277
179 3300026118 Ga0207675_100084446 Ga0207675_1000844464 277
180 3300026121 Ga0207683_10011609 Ga0207683_100116095 277
181 3300027682 Ga0209971_1002771 Ga0209971_10027714 277
182 3300028381 Ga0268264_10186118 Ga0268264_101861182 277
183 3300037068 Ga0373925_0157268 Ga0373925_0157268_276_1118 277
184 3300039062 Ga0400483_082421 Ga0400483_082421_13768_14661 277
185 3300042876 Ga0451577_0026703 Ga0451577_0026703_1414_2253 277
186 3300044673 Ga0453683_0000068 Ga0453683_0000068_132353_133216 277
187 3300044673 Ga0453683_0017391 Ga0453683_0017391_1550_2398 277
188 3300044712 Ga0453684_0033759 Ga0453684_0033759_641_1480 277
189 3300044712 Ga0453684_0081143 Ga0453684_0081143_1906_2769 277
190 3300045051 Ga0451576_0005205 Ga0451576_0005205_11406_12269 277
191 3300045051 Ga0451576_0031525 Ga0451576_0031525_2988_3827 277
192 3300045051 Ga0451576_0056371 Ga0451576_0056371_424_1389 277
193 3300045051 Ga0451576_0101899 Ga0451576_0101899_943_1791 277
194 3300045051 Ga0451576_0490102 Ga0451576_0490102_105_953 277
195 3300046499 Ga0495594_0118724 Ga0495594_0118724_416_1255 277
196 3300048909 Ga0496106_0034253 Ga0496106_0034253_32_865 277
197 3300048915 Ga0496112_0198140 Ga0496112_0198140_900_1733 277
198 3300048916 Ga0496113_0256449 Ga0496113_0256449_286_1119 277
199 3300049743 Ga0501081_0151210 Ga0501081_0151210_134_973 277
200 3300050509 nmdc:mga0qj67_52294_c1 nmdc:mga0qj67_52294_c1_1821_2663 277
201 3300050510 nmdc:mga06r32_224193_c1 nmdc:mga06r32_224193_c1_630_1472 277
202 3300050511 nmdc:mga08y16_39669_c1 nmdc:mga08y16_39669_c1_805_1647 277
203 3300050512 nmdc:mga0n895_42048_c2 nmdc:mga0n895_42048_c2_1426_2259 277
204 3300050513 nmdc:mga0rr50_25548_c1 nmdc:mga0rr50_25548_c1_1432_2265 277

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00590

TP_methylase

Tetrapyrrole (Corrin/Porphyrin) Methylases

47

247

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hw4-assembly1.cif.gz_B crystal structure of escherichia coli 16s rrna methyltransferase rsmi in complex with adomet 0.9405 3 222
5hw4-assembly2.cif.gz_C-2 crystal structure of escherichia coli 16s rrna methyltransferase rsmi in complex with adomet 0.9397 3 221
3kwp-assembly1.cif.gz_A-2 crystal structure of putative methyltransferase from lactobacillus brevis 0.939 1 223
5hw4-assembly1.cif.gz_A crystal structure of escherichia coli 16s rrna methyltransferase rsmi in complex with adomet 0.9348 3 224
5hw4-assembly1.cif.gz_B crystal structure of escherichia coli 16s rrna methyltransferase rsmi in complex with adomet 0.9281 3 222
ID Description Score Start End Superfamily
af_Q338C6_169_282_3.30.950.10 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.9643 113 221 3.30.950.10
af_P9WGW7_115_230_3.30.950.10 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.9584 112 224 3.30.950.10
5hw4C01 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.9577 3 111 3.40.1010.10
5hw4C02 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.9497 112 221 3.30.950.10
af_P9WGW7_1_114_3.40.1010.10 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.949 2 111 3.40.1010.10
ID Description Score Start End GO Terms
AF-A0A7Y4XYD7-F1-model_v4 16S rRNA (Cytidine(1402)-2'-O)-methyltransferase 0.9871 2 83 GO:0008168
GO:0032259
AF-A0A3C1WV85-F1-model_v4 16S rRNA (Cytidine(1402)-2'-O)-methyltransferase 0.9851 2 82 GO:0008168
GO:0032259
AF-A0A2M7E8N8-F1-model_v4 16S rRNA (Cytidine(1402)-2'-O)-methyltransferase 0.9833 124 221 GO:0005737
GO:0006364
GO:0008168
GO:0032259
AF-A0A7C6TVT8-F1-model_v4 16S rRNA (Cytidine(1402)-2'-O)-methyltransferase 0.9823 5 83 GO:0008168
GO:0032259
AF-A0A524KUW4-F1-model_v4 16S rRNA (Cytidine(1402)-2'-O)-methyltransferase 0.9806 1 107 GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
89.45 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map