F312788

General Info

Members Datasets Scaffolds Average Seq Length
204 143 408 305

Family's Representative Sequence

Representative Sequence 3300037588|Ga0316581_0020749|Ga0316581_0020749_802_1782
Length 326
Sequence MWQGDETDIIVVRHRTGEQEVHMKLGFVSAILPELSLEEVIDFAAAEGFDCVELMCWPVGKAERRYAGVTHVDVSEFGAGDAQRINDLLAAKGVEISGLGYYPNPLAPDRAEAQVYIDHIEKVIQAAALLGVNQVNTFIGRDWTRSVEDNWPRFLEVWPPLVGFAGSQGVRIGIENCPMFFTGDEWPGGKNLAYAPAIWRRMFEAIPSAALGLNYDPSHLVWLRIDYLKPLWEFGERIYHVHAKDVRLDRQRLDEVGILATPLEFHTPKLPGLGEIDWGRFFSVLSDVGYEGAVCIEVEDRAYEGSLARRKAALVQSARYLRGFMS

Samples

Sample ID Description Type Environment
1 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
44 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
45 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
65 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
66 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
67 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
68 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
69 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
70 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
71 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
72 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
73 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
74 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
75 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
76 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
77 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
78 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
79 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
80 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
81 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
82 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
83 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
84 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
85 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
86 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
87 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
88 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
89 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
90 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
91 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
92 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
93 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
94 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
95 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
96 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
97 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
98 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
99 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
100 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
101 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
102 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
103 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
104 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
105 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
106 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
107 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
108 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
109 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
110 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
111 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
112 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
124 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
125 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
126 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
127 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
128 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
129 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
130 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
131 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
132 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
133 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
134 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
136 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
137 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
138 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
140 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
141 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
142 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
143 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.49
Nodule 0
Rhizoplane 2.94
Rhizosphere 92.65
Stem 0
Stem Tuber 0
Unclassified 20.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316581_0020749 3300037588 Bacteria 1925
2 Ga0065715_10187933 3300005293 Bacteria 1433
3 Ga0065707_10151049 3300005295 Unclassified 1658
4 Ga0070658_10001896 3300005327 Bacteria 17651
5 Ga0070658_10032105 3300005327 Unclassified 4221
6 Ga0070680_100052134 3300005336 Bacteria 3340
7 Ga0070660_100012446 3300005339 Bacteria 6075
8 Ga0070660_100108829 3300005339 Unclassified 2203
9 Ga0070689_100146407 3300005340 Bacteria 1903
10 Ga0070661_100161162 3300005344 Bacteria 1699
11 Ga0070692_10061188 3300005345 Bacteria 1984
12 Ga0070668_100271247 3300005347 Bacteria 1414
13 Ga0070674_100082132 3300005356 Bacteria 2305
14 Ga0070709_10007313 3300005434 Bacteria 6051
15 Ga0070713_100203165 3300005436 Bacteria 1791
16 Ga0070694_100480355 3300005444 Bacteria 986
17 Ga0070708_100483855 3300005445 Bacteria 1168
18 Ga0070681_10098372 3300005458 Bacteria 2872
19 Ga0070707_100110683 3300005468 Bacteria 2663
20 Ga0070698_100002350 3300005471 Bacteria 20904
21 Ga0070679_100082403 3300005530 Unclassified 3207
22 Ga0070679_100117114 3300005530 Bacteria 2649
23 Ga0070679_100162449 3300005530 Bacteria 2208
24 Ga0070684_100203514 3300005535 Bacteria 1803
25 Ga0070697_100028446 3300005536 Unclassified 4475
26 Ga0070697_100188076 3300005536 Unclassified 1752
27 Ga0070686_100008613 3300005544 Bacteria 5716
28 Ga0070665_100000170 3300005548 Bacteria 116622
29 Ga0070665_100366011 3300005548 Unclassified 1448
30 Ga0068855_100232998 3300005563 Bacteria 2061
31 Ga0068855_100295867 3300005563 Unclassified 1794
32 Ga0068855_100477734 3300005563 Bacteria 1357
33 Ga0068856_100042245 3300005614 Bacteria 4484
34 Ga0068864_100196777 3300005618 Bacteria 1850
35 Ga0068858_100262100 3300005842 Bacteria 1643
36 Ga0097621_100205395 3300006237 Bacteria 1712
37 Ga0075428_100282792 3300006844 Bacteria 1785
38 Ga0075433_10113465 3300006852 Bacteria 2404
39 Ga0075436_100261554 3300006914 Bacteria 1234
40 Ga0105240_10000264 3300009093 Bacteria 103844
41 Ga0105240_10285118 3300009093 Bacteria 1896
42 Ga0105240_10581174 3300009093 Bacteria 1236
43 Ga0111539_10291611 3300009094 Bacteria 1898
44 Ga0114129_10677352 3300009147 Bacteria 1328
45 Ga0105248_10339739 3300009177 Bacteria 1691
46 Ga0105248_10619212 3300009177 Bacteria 1221
47 Ga0105237_10109123 3300009545 Bacteria 2759
48 Ga0157370_10176846 3300013104 Bacteria 1983
49 Ga0157369_10060367 3300013105 Bacteria 4089
50 Ga0157369_10224969 3300013105 Bacteria 1963
51 Ga0157369_10419145 3300013105 Bacteria 1388
52 Ga0157374_10066251 3300013296 Bacteria 3394
53 Ga0157378_10164401 3300013297 Bacteria 2078
54 Ga0157378_10237859 3300013297 Unclassified 1739
55 Ga0157372_10042534 3300013307 Bacteria 5025
56 Ga0157372_10228397 3300013307 Bacteria 2157
57 Ga0157372_10319349 3300013307 Bacteria 1808
58 Ga0163163_10115808 3300014325 Bacteria 2711
59 Ga0182008_10134472 3300014497 Bacteria 1234
60 Ga0213872_10015459 3300021361 Unclassified 3547
61 Ga0213872_10030903 3300021361 Bacteria 2455
62 Ga0213872_10116266 3300021361 Unclassified 1185
63 Ga0213871_10000959 3300021441 Bacteria 4472
64 Ga0207705_10030455 3300025909 Bacteria 3850
65 Ga0207684_10065254 3300025910 Bacteria 3091
66 Ga0207695_10011555 3300025913 Bacteria 10681
67 Ga0207660_10115675 3300025917 Unclassified 2025
68 Ga0207657_10096765 3300025919 Bacteria 2455
69 Ga0207649_10443722 3300025920 Bacteria 978
70 Ga0207652_10065500 3300025921 Unclassified 3146
71 Ga0207646_10042164 3300025922 Unclassified 4101
72 Ga0207690_10091280 3300025932 Bacteria 2153
73 Ga0207669_10197738 3300025937 Bacteria 1456
74 Ga0207665_10109374 3300025939 Unclassified 1940
75 Ga0207661_10107768 3300025944 Bacteria 2351
76 Ga0207667_10065406 3300025949 Unclassified 3792
77 Ga0207703_10242506 3300026035 Bacteria 1621
78 Ga0207703_10337796 3300026035 Bacteria 1383
79 Ga0207702_10013802 3300026078 Bacteria 6710
80 Ga0207676_10171466 3300026095 Unclassified 1891
81 Ga0207674_10066946 3300026116 Unclassified 3617
82 Ga0268266_10003360 3300028379 Bacteria 16021
83 Ga0265337_1002602 3300028556 Bacteria 8164
84 Ga0265326_10081362 3300028558 Bacteria 916
85 Ga0265334_10004877 3300028573 Bacteria 5899
86 Ga0265318_10002901 3300028577 Bacteria 8915
87 Ga0265338_10000514 3300028800 Bacteria 68056
88 Ga0265338_10022199 3300028800 Bacteria 6581
89 Ga0265338_10190026 3300028800 Unclassified 1558
90 Ga0265324_10002030 3300029957 Bacteria 10768
91 Ga0265324_10046902 3300029957 Unclassified 1487
92 Ga0265320_10017252 3300031240 Bacteria 4016
93 Ga0265320_10033594 3300031240 Bacteria 2616
94 Ga0265325_10002919 3300031241 Bacteria 11388
95 Ga0265340_10055338 3300031247 Bacteria 1911
96 Ga0265339_10040682 3300031249 Bacteria 2583
97 Ga0265331_10012858 3300031250 Bacteria 4517
98 Ga0265316_10001088 3300031344 Bacteria 29441
99 Ga0265316_10011645 3300031344 Bacteria 7919
100 Ga0265316_10032336 3300031344 Bacteria 4270
101 Ga0265316_10061971 3300031344 Unclassified 2903
102 Ga0265313_10000262 3300031595 Bacteria 57454
103 Ga0265313_10004330 3300031595 Bacteria 10980
104 Ga0316579_10017981 3300031691 Bacteria 3107
105 Ga0316577_10001903 3300031733 Bacteria 10091
106 Ga0316584_0002722 3300036712 Bacteria 11301
107 Ga0316584_0125841 3300036712 Bacteria 1914
108 Ga0316584_0372610 3300036712 Bacteria 1022
109 Ga0395900_0301922 3300037418 Bacteria 1587
110 Ga0316581_0043382 3300037588 Bacteria 1373
111 Ga0436364_0455867 3300037853 Unclassified 1683
112 Ga0436364_0907690 3300037853 Bacteria 2122
113 Ga0436364_0925160 3300037853 Bacteria 2304
114 Ga0436365_0214570 3300039437 Bacteria 45618
115 Ga0436365_1048427 3300039437 Unclassified 2056
116 Ga0436365_1060491 3300039437 Bacteria 1146
117 Ga0436360_0047287 3300039438 Bacteria 6653
118 Ga0436360_0354490 3300039438 Unclassified 989
119 Ga0436360_0633001 3300039438 Bacteria 5776
120 Ga0436360_0834815 3300039438 Unclassified 1811
121 Ga0436360_1306295 3300039438 Bacteria 1884
122 Ga0436361_0117379 3300039447 Bacteria 4140
123 Ga0436361_0149975 3300039447 Unclassified 2321
124 Ga0436361_0438902 3300039447 Unclassified 2521
125 Ga0436361_0532084 3300039447 Unclassified 1651
126 Ga0436361_0758750 3300039447 Unclassified 3816
127 Ga0436361_0922655 3300039447 Bacteria 8621
128 Ga0436361_1150857 3300039447 Bacteria 2852
129 Ga0436363_0999486 3300039450 Bacteria 11530
130 Ga0436363_1275656 3300039450 Unclassified 1935
131 Ga0436362_0253198 3300039453 Unclassified 2823
132 Ga0450923_011520 3300042125 Bacteria 1591
133 Ga0450894_000308 3300042131 Bacteria 8757
134 Ga0450896_002631 3300042133 Bacteria 2335
135 Ga0450908_022500 3300042184 Bacteria 1104
136 Ga0451577_0000909 3300042876 Bacteria 43634
137 Ga0451577_0001600 3300042876 Bacteria 29483
138 Ga0451577_0256150 3300042876 Bacteria 1584
139 Ga0453683_0000084 3300044673 Bacteria 142500
140 Ga0453683_0042717 3300044673 Bacteria 2846
141 Ga0453683_0157196 3300044673 Bacteria 1437
142 Ga0453684_0000010 3300044712 Bacteria 1133422
143 Ga0453684_0043515 3300044712 Bacteria 6034
144 Ga0453684_0109589 3300044712 Bacteria 3358
145 Ga0453684_0165855 3300044712 Unclassified 2607
146 Ga0453684_0230741 3300044712 Bacteria 2137
147 Ga0466959_0050683 3300045049 Bacteria 3047
148 Ga0451576_0000112 3300045051 Bacteria 209574
149 Ga0451576_0002245 3300045051 Bacteria 29623
150 Ga0451576_0104722 3300045051 Bacteria 2943
151 Ga0451576_0182949 3300045051 Bacteria 2188
152 Ga0495651_0266958 3300046462 Unclassified 1162
153 Ga0495582_0018258 3300046473 Bacteria 3838
154 Ga0495628_0095130 3300046516 Bacteria 2302
155 Ga0495630_0000441 3300046517 Bacteria 31615
156 Ga0495666_0000586 3300046526 Bacteria 16276
157 Ga0495586_0001176 3300046535 Bacteria 14677
158 Ga0495634_0005983 3300046642 Bacteria 9293
159 Ga0495647_0022708 3300046681 Bacteria 2269
160 Ga0495658_0194231 3300046683 Bacteria 1263
161 Ga0495613_0027869 3300046689 Bacteria 4205
162 Ga0495604_0019783 3300047317 Bacteria 5386
163 Ga0495674_0108633 3300047319 Unclassified 2353
164 Ga0496101_0540989 3300048904 Unclassified 921
165 Ga0496109_0557777 3300048912 Bacteria 1081
166 Ga0496112_0074185 3300048915 Bacteria 3364
167 Ga0496112_0279530 3300048915 Unclassified 1617
168 Ga0496112_0436680 3300048915 Bacteria 1247
169 Ga0496115_0074055 3300048918 Bacteria 2765
170 Ga0501032_0000600 3300049569 Bacteria 29121
171 Ga0501033_0019135 3300049570 Bacteria 5177
172 Ga0501034_0007299 3300049571 Bacteria 11784
173 Ga0501036_0000278 3300049572 Bacteria 35218
174 Ga0501037_0002134 3300049573 Bacteria 14318
175 Ga0501038_0002449 3300049574 Bacteria 17281
176 Ga0501039_0003684 3300049575 Bacteria 11486
177 Ga0501042_0043032 3300049578 Unclassified 3215
178 Ga0501046_0000565 3300049580 Bacteria 36610
179 Ga0501047_0105948 3300049581 Unclassified 2692
180 Ga0501047_0415954 3300049581 Bacteria 1176
181 Ga0501048_0311594 3300049582 Bacteria 1120
182 Ga0501067_0000780 3300049583 Bacteria 17129
183 Ga0501068_0000838 3300049584 Bacteria 16023
184 Ga0501069_0010527 3300049585 Unclassified 4898
185 Ga0501070_0010168 3300049586 Bacteria 7965
186 Ga0501072_0014686 3300049588 Bacteria 6004
187 Ga0501073_0009159 3300049589 Bacteria 7302
188 Ga0501073_0200566 3300049589 Bacteria 1380
189 Ga0501074_0007433 3300049590 Bacteria 7927
190 Ga0501077_0024045 3300049593 Unclassified 3866
191 Ga0501079_0012006 3300049741 Bacteria 6611
192 Ga0501080_0000169 3300049742 Bacteria 47582
193 Ga0501083_0017709 3300049744 Unclassified 4967
194 Ga0501035_0007457 3300049822 Bacteria 10216
195 Ga0501044_0114898 3300049823 Bacteria 2697
196 nmdc:mga0yw44_358426_c1 3300050492 Bacteria 982
197 nmdc:mga05p37_502267_c1 3300050507 Bacteria 1391
198 nmdc:mga06r32_141054_c1 3300050510 Bacteria 2386
199 nmdc:mga0a205_551399_c1 3300050515 Bacteria 1008
200 Ga0495601_0004793 3300053077 Bacteria 7843
201 Ga0495619_0006130 3300053085 Bacteria 7616
202 Ga0501084_0002228 3300054114 Bacteria 15571
203 Ga0501084_0058294 3300054114 Bacteria 3231
204 Ga0501082_0051756 3300060353 Bacteria 3539
205 Ga0316581_0020749
206 Ga0065715_10187933
207 Ga0065707_10151049
208 Ga0070658_10001896
209 Ga0070658_10032105
210 Ga0070680_100052134
211 Ga0070660_100012446
212 Ga0070660_100108829
213 Ga0070689_100146407
214 Ga0070661_100161162
215 Ga0070692_10061188
216 Ga0070668_100271247
217 Ga0070674_100082132
218 Ga0070709_10007313
219 Ga0070713_100203165
220 Ga0070694_100480355
221 Ga0070708_100483855
222 Ga0070681_10098372
223 Ga0070707_100110683
224 Ga0070698_100002350
225 Ga0070679_100082403
226 Ga0070679_100117114
227 Ga0070679_100162449
228 Ga0070684_100203514
229 Ga0070697_100028446
230 Ga0070697_100188076
231 Ga0070686_100008613
232 Ga0070665_100000170
233 Ga0070665_100366011
234 Ga0068855_100232998
235 Ga0068855_100295867
236 Ga0068855_100477734
237 Ga0068856_100042245
238 Ga0068864_100196777
239 Ga0068858_100262100
240 Ga0097621_100205395
241 Ga0075428_100282792
242 Ga0075433_10113465
243 Ga0075436_100261554
244 Ga0105240_10000264
245 Ga0105240_10285118
246 Ga0105240_10581174
247 Ga0111539_10291611
248 Ga0114129_10677352
249 Ga0105248_10339739
250 Ga0105248_10619212
251 Ga0105237_10109123
252 Ga0157370_10176846
253 Ga0157369_10060367
254 Ga0157369_10224969
255 Ga0157369_10419145
256 Ga0157374_10066251
257 Ga0157378_10164401
258 Ga0157378_10237859
259 Ga0157372_10042534
260 Ga0157372_10228397
261 Ga0157372_10319349
262 Ga0163163_10115808
263 Ga0182008_10134472
264 Ga0213872_10015459
265 Ga0213872_10030903
266 Ga0213872_10116266
267 Ga0213871_10000959
268 Ga0207705_10030455
269 Ga0207684_10065254
270 Ga0207695_10011555
271 Ga0207660_10115675
272 Ga0207657_10096765
273 Ga0207649_10443722
274 Ga0207652_10065500
275 Ga0207646_10042164
276 Ga0207690_10091280
277 Ga0207669_10197738
278 Ga0207665_10109374
279 Ga0207661_10107768
280 Ga0207667_10065406
281 Ga0207703_10242506
282 Ga0207703_10337796
283 Ga0207702_10013802
284 Ga0207676_10171466
285 Ga0207674_10066946
286 Ga0268266_10003360
287 Ga0265337_1002602
288 Ga0265326_10081362
289 Ga0265334_10004877
290 Ga0265318_10002901
291 Ga0265338_10000514
292 Ga0265338_10022199
293 Ga0265338_10190026
294 Ga0265324_10002030
295 Ga0265324_10046902
296 Ga0265320_10017252
297 Ga0265320_10033594
298 Ga0265325_10002919
299 Ga0265340_10055338
300 Ga0265339_10040682
301 Ga0265331_10012858
302 Ga0265316_10001088
303 Ga0265316_10011645
304 Ga0265316_10032336
305 Ga0265316_10061971
306 Ga0265313_10000262
307 Ga0265313_10004330
308 Ga0316579_10017981
309 Ga0316577_10001903
310 Ga0316584_0002722
311 Ga0316584_0125841
312 Ga0316584_0372610
313 Ga0395900_0301922
314 Ga0316581_0043382
315 Ga0436364_0455867
316 Ga0436364_0907690
317 Ga0436364_0925160
318 Ga0436365_0214570
319 Ga0436365_1048427
320 Ga0436365_1060491
321 Ga0436360_0047287
322 Ga0436360_0354490
323 Ga0436360_0633001
324 Ga0436360_0834815
325 Ga0436360_1306295
326 Ga0436361_0117379
327 Ga0436361_0149975
328 Ga0436361_0438902
329 Ga0436361_0532084
330 Ga0436361_0758750
331 Ga0436361_0922655
332 Ga0436361_1150857
333 Ga0436363_0999486
334 Ga0436363_1275656
335 Ga0436362_0253198
336 Ga0450923_011520
337 Ga0450894_000308
338 Ga0450896_002631
339 Ga0450908_022500
340 Ga0451577_0000909
341 Ga0451577_0001600
342 Ga0451577_0256150
343 Ga0453683_0000084
344 Ga0453683_0042717
345 Ga0453683_0157196
346 Ga0453684_0000010
347 Ga0453684_0043515
348 Ga0453684_0109589
349 Ga0453684_0165855
350 Ga0453684_0230741
351 Ga0466959_0050683
352 Ga0451576_0000112
353 Ga0451576_0002245
354 Ga0451576_0104722
355 Ga0451576_0182949
356 Ga0495651_0266958
357 Ga0495582_0018258
358 Ga0495628_0095130
359 Ga0495630_0000441
360 Ga0495666_0000586
361 Ga0495586_0001176
362 Ga0495634_0005983
363 Ga0495647_0022708
364 Ga0495658_0194231
365 Ga0495613_0027869
366 Ga0495604_0019783
367 Ga0495674_0108633
368 Ga0496101_0540989
369 Ga0496109_0557777
370 Ga0496112_0074185
371 Ga0496112_0279530
372 Ga0496112_0436680
373 Ga0496115_0074055
374 Ga0501032_0000600
375 Ga0501033_0019135
376 Ga0501034_0007299
377 Ga0501036_0000278
378 Ga0501037_0002134
379 Ga0501038_0002449
380 Ga0501039_0003684
381 Ga0501042_0043032
382 Ga0501046_0000565
383 Ga0501047_0105948
384 Ga0501047_0415954
385 Ga0501048_0311594
386 Ga0501067_0000780
387 Ga0501068_0000838
388 Ga0501069_0010527
389 Ga0501070_0010168
390 Ga0501072_0014686
391 Ga0501073_0009159
392 Ga0501073_0200566
393 Ga0501074_0007433
394 Ga0501077_0024045
395 Ga0501079_0012006
396 Ga0501080_0000169
397 Ga0501083_0017709
398 Ga0501035_0007457
399 Ga0501044_0114898
400 nmdc:mga0yw44_358426_c1
401 nmdc:mga05p37_502267_c1
402 nmdc:mga06r32_141054_c1
403 nmdc:mga0a205_551399_c1
404 Ga0495601_0004793
405 Ga0495619_0006130
406 Ga0501084_0002228
407 Ga0501084_0058294
408 Ga0501082_0051756

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

41

324

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lmz-assembly1.cif.gz_A-2 crystal structure of putative sugar isomerase. (yp_001305105.1) from parabacteroides distasonis atcc 8503 at 1.44 a resolution 0.8472 3 301
3cqj-assembly1.cif.gz_B crystal structure of l-xylulose-5-phosphate 3-epimerase ulae (form b) complex with zn2+ 0.8048 3 300
7vpf-assembly1.cif.gz_B crystal structure of a novel putative sugar isomerase from the psychrophilic bacterium paenibacillus sp. r4 0.8003 1 302
2zds-assembly1.cif.gz_F crystal structure of sco6571 from streptomyces coelicolor a3(2) 0.7988 3 301
3lmz-assembly1.cif.gz_A-2 crystal structure of putative sugar isomerase. (yp_001305105.1) from parabacteroides distasonis atcc 8503 at 1.44 a resolution 0.7981 3 301
ID Description Score Start End Superfamily
af_P45541_1_270_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8476 3 300 3.20.20.150
af_P45541_1_270_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8418 3 300 3.20.20.150
3lmzA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8398 3 301 3.20.20.150
af_Q2G1E4_1_314_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8345 3 298 3.20.20.150
af_Q58587_1_265_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8225 3 296 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A2N1Q351-F1-model_v4 AP endonuclease 0.9776 3 302 GO:0004519
AF-F4L7E4-F1-model_v4 Xylose isomerase domain-containing protein TIM barrel 0.9752 2 302 GO:0016853
AF-A0A7V2Z220-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9751 59 302 GO:0016853
AF-A0A3M1X110-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9741 3 113 GO:0016853
AF-A0A7L6MZX7-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9726 3 302 GO:0016853

Map