F312652

General Info

Members Datasets Scaffolds Average Seq Length
204 139 205 188

Family's Representative Sequence

Representative Sequence 3300026142|Ga0207698_11062839|Ga0207698_110628391
Length 229
Sequence MMERSNRPDIRSLLLPVRETSLKRTTAAHREPVPTPNATRIKMPKAKDLTAKQRDDLLKTLKARFEAHMHRHAGLEWSAVEARLKSNSDRLWSLSEMEQSGGEPDVVDVDAATDELIFMDCSAQSPKGRRSVCYDRAALEARKEHKPKNSAVEMASAMGATLLTAAEYRRLQEIDEVDTTTSSWVQTPDNVRKLGGALFCDRRYDTVFVYHNGAESYYAARGFRCSLRV

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
101 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
107 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
112 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
113 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
114 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
115 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
121 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
122 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
123 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
124 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
125 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
126 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
127 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
130 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
131 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
132 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
133 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
134 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
135 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
136 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
137 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
138 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
139 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.49
Rhizosphere 96.08
Stem 0
Stem Tuber 0
Unclassified 3.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10000778 3300003323 Bacteria 106851
2 rootH1_10071981 3300003316 Bacteria 4895
3 rootH1_10071981 3300003323 Bacteria 2392
4 rootH1_10193028 3300003323 Bacteria 8241
5 Ga0065712_10001094 3300005290 Bacteria 7140
6 Ga0070658_10585690 3300005327 Bacteria 966
7 Ga0070658_11018865 3300005327 Bacteria 720
8 Ga0070683_100187092 3300005329 Bacteria 1966
9 Ga0070683_100281624 3300005329 Bacteria 1581
10 Ga0070670_100031243 3300005331 Bacteria 4586
11 Ga0070670_100428765 3300005331 Bacteria 1170
12 Ga0070670_100491080 3300005331 Unclassified 1091
13 Ga0068869_100911419 3300005334 Bacteria 761
14 Ga0070680_100023614 3300005336 Bacteria 4906
15 Ga0070661_100563279 3300005344 Bacteria 918
16 Ga0070668_100158694 3300005347 Bacteria 1834
17 Ga0070669_100060677 3300005353 Bacteria 2778
18 Ga0070669_100093613 3300005353 Bacteria 2257
19 Ga0070675_100663050 3300005354 Bacteria 949
20 Ga0070671_100362289 3300005355 Bacteria 1238
21 Ga0070673_100427842 3300005364 Bacteria 1188
22 Ga0070688_100283330 3300005365 Bacteria 1191
23 Ga0070688_100486481 3300005365 Bacteria 928
24 Ga0070659_101107677 3300005366 Bacteria 698
25 Ga0070705_100205723 3300005440 Bacteria 1353
26 Ga0070700_100503456 3300005441 Bacteria 932
27 Ga0070700_100520683 3300005441 Bacteria 918
28 Ga0070662_100969922 3300005457 Bacteria 727
29 Ga0070681_10008306 3300005458 Bacteria 10166
30 Ga0070681_10491540 3300005458 Bacteria 1140
31 Ga0068867_100438051 3300005459 Bacteria 1111
32 Ga0070685_10004783 3300005466 Bacteria 6857
33 Ga0070706_100163614 3300005467 Unclassified 2078
34 Ga0070679_100016306 3300005530 Bacteria 7160
35 Ga0070684_100589640 3300005535 Bacteria 1033
36 Ga0070684_101497713 3300005535 Bacteria 636
37 Ga0070672_100113285 3300005543 Bacteria 2214
38 Ga0070686_100015801 3300005544 Bacteria 4381
39 Ga0070693_100082958 3300005547 Bacteria 1915
40 Ga0070704_100259153 3300005549 Bacteria 1432
41 Ga0068855_100026032 3300005563 Bacteria 6997
42 Ga0070664_100307906 3300005564 Bacteria 1433
43 Ga0068857_101189497 3300005577 Bacteria 738
44 Ga0068854_100090266 3300005578 Bacteria 2278
45 Ga0068859_100207822 3300005617 Bacteria 2043
46 Ga0068861_100035976 3300005719 Bacteria 3671
47 Ga0068861_101005914 3300005719 Bacteria 796
48 Ga0068870_10024541 3300005840 Bacteria 2984
49 Ga0068863_100627388 3300005841 Bacteria 1065
50 Ga0068860_100795391 3300005843 Bacteria 959
51 Ga0068862_100009833 3300005844 Bacteria 7900
52 Ga0068862_100027031 3300005844 Bacteria 4827
53 Ga0081455_10040710 3300005937 Bacteria 4095
54 Ga0075428_100461132 3300006844 Bacteria 1361
55 Ga0075430_100002258 3300006846 Bacteria 15985
56 Ga0075431_100016476 3300006847 Bacteria 7502
57 Ga0075429_100016586 3300006880 Bacteria 6382
58 Ga0068865_101041965 3300006881 Bacteria 718
59 Ga0097620_100207817 3300006931 Bacteria 2043
60 Ga0111539_10266134 3300009094 Bacteria 1995
61 Ga0111539_10307418 3300009094 Bacteria 1845
62 Ga0114129_10037326 3300009147 Bacteria 6860
63 Ga0114129_10121584 3300009147 Bacteria 3593
64 Ga0105243_10350522 3300009148 Bacteria 1355
65 Ga0105243_10532686 3300009148 Bacteria 1119
66 Ga0105243_10899369 3300009148 Bacteria 880
67 Ga0105241_10232582 3300009174 Bacteria 1554
68 Ga0105242_10023582 3300009176 Bacteria 4849
69 Ga0105242_10522226 3300009176 Bacteria 1133
70 Ga0105248_10221332 3300009177 Bacteria 2131
71 Ga0105237_10098521 3300009545 Bacteria 2914
72 Ga0105238_10036262 3300009551 Bacteria 5012
73 Ga0105249_10008862 3300009553 Bacteria 8787
74 Ga0105249_10226692 3300009553 Bacteria 1841
75 Ga0105246_10749086 3300011119 Bacteria 861
76 Ga0157373_10280827 3300013100 Bacteria 1180
77 Ga0157371_10303961 3300013102 Bacteria 1155
78 Ga0157371_10370161 3300013102 Bacteria 1045
79 Ga0157370_10632674 3300013104 Bacteria 979
80 Ga0157369_10033285 3300013105 Bacteria 5665
81 Ga0157369_10167550 3300013105 Bacteria 2316
82 Ga0157374_11757519 3300013296 Bacteria 645
83 Ga0163162_10794037 3300013306 Bacteria 1064
84 Ga0157372_10126187 3300013307 Bacteria 2942
85 Ga0157372_10241657 3300013307 Bacteria 2095
86 Ga0157372_10301785 3300013307 Bacteria 1863
87 Ga0157375_10207095 3300013308 Bacteria 2118
88 Ga0157375_10244602 3300013308 Bacteria 1954
89 Ga0157375_11223984 3300013308 Bacteria 881
90 Ga0163163_10590940 3300014325 Bacteria 1173
91 Ga0163163_10908670 3300014325 Unclassified 944
92 Ga0163163_11071220 3300014325 Bacteria 869
93 Ga0157380_10047271 3300014326 Bacteria 3384
94 Ga0157380_10529480 3300014326 Bacteria 1151
95 Ga0157377_10183124 3300014745 Bacteria 1319
96 Ga0213876_10099921 3300021384 Bacteria 1538
97 Ga0207697_10081656 3300025315 Bacteria 1362
98 Ga0207645_10184612 3300025907 Bacteria 1369
99 Ga0207643_10011496 3300025908 Bacteria 4781
100 Ga0207705_10017601 3300025909 Bacteria 5114
101 Ga0207705_10550120 3300025909 Bacteria 897
102 Ga0207684_10140169 3300025910 Unclassified 2078
103 Ga0207707_10011169 3300025912 Bacteria 7813
104 Ga0207695_10001853 3300025913 Bacteria 33132
105 Ga0207695_10018072 3300025913 Bacteria 8162
106 Ga0207660_10048694 3300025917 Bacteria 3000
107 Ga0207660_10525054 3300025917 Bacteria 961
108 Ga0207652_10014724 3300025921 Bacteria 6339
109 Ga0207652_10454310 3300025921 Bacteria 1155
110 Ga0207652_10777864 3300025921 Bacteria 851
111 Ga0207646_10415861 3300025922 Bacteria 1214
112 Ga0207646_10494012 3300025922 Viruses 1103
113 Ga0207681_10335415 3300025923 Bacteria 1206
114 Ga0207681_10673594 3300025923 Bacteria 859
115 Ga0207659_10085205 3300025926 Bacteria 2347
116 Ga0207659_10553407 3300025926 Bacteria 978
117 Ga0207706_10121046 3300025933 Bacteria 2301
118 Ga0207706_10125146 3300025933 Bacteria 2261
119 Ga0207709_10601942 3300025935 Bacteria 870
120 Ga0207670_10134075 3300025936 Bacteria 1818
121 Ga0207691_10064340 3300025940 Bacteria 3323
122 Ga0207691_10079327 3300025940 Bacteria 2954
123 Ga0207691_10111116 3300025940 Bacteria 2437
124 Ga0207691_10209053 3300025940 Bacteria 1696
125 Ga0207691_10298509 3300025940 Bacteria 1384
126 Ga0207661_10312514 3300025944 Bacteria 1411
127 Ga0207661_10339830 3300025944 Bacteria 1353
128 Ga0207661_10922481 3300025944 Bacteria 804
129 Ga0207679_10574726 3300025945 Bacteria 1013
130 Ga0207667_10888843 3300025949 Bacteria 883
131 Ga0207651_10069384 3300025960 Bacteria 2489
132 Ga0207651_10109396 3300025960 Bacteria 2071
133 Ga0207712_10002965 3300025961 Bacteria 10836
134 Ga0207712_10172293 3300025961 Bacteria 1693
135 Ga0207668_10120188 3300025972 Bacteria 1988
136 Ga0207640_10052963 3300025981 Bacteria 2646
137 Ga0207708_10049378 3300026075 Bacteria 3203
138 Ga0207648_10371491 3300026089 Bacteria 1292
139 Ga0207676_10830643 3300026095 Unclassified 903
140 Ga0207675_100078347 3300026118 Bacteria 3096
141 Ga0207683_10251413 3300026121 Bacteria 1613
142 Ga0207698_11062839 3300026142 Bacteria 821
143 Ga0209974_10043582 3300027876 Bacteria 1496
144 Ga0268265_10020973 3300028380 Bacteria 4568
145 Ga0268265_10035879 3300028380 Bacteria 3627
146 Ga0307408_100284118 3300031548 Bacteria 1379
147 Ga0307408_101286705 3300031548 Bacteria 685
148 Ga0307413_10114345 3300031824 Bacteria 1814
149 Ga0307413_10158049 3300031824 Bacteria 1589
150 Ga0307410_10086743 3300031852 Bacteria 2212
151 Ga0307410_10114582 3300031852 Unclassified 1956
152 Ga0307410_10459575 3300031852 Unclassified 1040
153 Ga0307412_10056599 3300031911 Bacteria 2614
154 Ga0307409_100287801 3300031995 Bacteria 1522
155 Ga0307409_100501451 3300031995 Bacteria 1182
156 Ga0307409_101140638 3300031995 Unclassified 802
157 Ga0307416_100240093 3300032002 Unclassified 1755
158 Ga0307414_10249837 3300032004 Bacteria 1474
159 Ga0307415_100138881 3300032126 Bacteria 1853
160 Ga0307415_100347784 3300032126 Bacteria 1247
161 Ga0373947_0143043 3300035725 Bacteria 1536
162 Ga0395900_0933763 3300037418 Unclassified 790
163 Ga0395905_0400149 3300037471 Bacteria 1268
164 Ga0436365_1366357 3300039437 Bacteria 814
165 Ga0436365_1411290 3300039437 Bacteria 4519
166 Ga0436365_1731778 3300039437 Bacteria 4905
167 Ga0495594_0082128 3300046499 Bacteria 1800
168 Ga0495588_0018301 3300046674 Bacteria 3414
169 Ga0495658_0657819 3300046683 Bacteria 671
170 Ga0495672_0025498 3300047320 Bacteria 3783
171 Ga0496112_0049739 3300048915 Bacteria 4108
172 Ga0501034_0005520 3300049571 Bacteria 13798
173 Ga0501034_0709873 3300049571 Bacteria 904
174 Ga0501036_0729099 3300049572 Bacteria 818
175 Ga0501047_0230291 3300049581 Bacteria 1707
176 Ga0501048_0619635 3300049582 Bacteria 777
177 Ga0501067_0056588 3300049583 Bacteria 2172
178 Ga0501069_0015501 3300049585 Bacteria 4086
179 Ga0501070_0000169 3300049586 Bacteria 60220
180 Ga0501073_0001631 3300049589 Bacteria 16641
181 Ga0501073_0032481 3300049589 Bacteria 3721
182 Ga0501073_0295768 3300049589 Bacteria 1117
183 Ga0501074_0020429 3300049590 Bacteria 4813
184 Ga0501076_0246177 3300049592 Bacteria 1463
185 Ga0501216_069533 3300049660 Bacteria 725
186 Ga0501249_053341 3300049679 Bacteria 930
187 Ga0501080_0001429 3300049742 Bacteria 20060
188 Ga0501080_0556581 3300049742 Bacteria 1021
189 Ga0501081_0178207 3300049743 Bacteria 1536
190 Ga0501083_0032517 3300049744 Bacteria 3577
191 Ga0501268_037619 3300049765 Bacteria 900
192 Ga0501035_0125479 3300049822 Bacteria 2241
193 nmdc:mga05p37_264686_c1 3300050507 Bacteria 2056
194 nmdc:mga05p37_48771_c1 3300050507 Bacteria 5207
195 nmdc:mga05p37_558105_c1 3300050507 Bacteria 1302
196 nmdc:mga09592_29473_c1 3300050508 Bacteria 4565
197 nmdc:mga0qj67_15923_c1 3300050509 Bacteria 5694
198 nmdc:mga0qj67_22525_c1 3300050509 Bacteria 4839
199 nmdc:mga06r32_64491_c1 3300050510 Bacteria 3532
200 nmdc:mga06r32_68959_c1 3300050510 Bacteria 3417
201 nmdc:mga08y16_166140_c1 3300050511 Bacteria 2292
202 nmdc:mga08y16_671492_c1 3300050511 Bacteria 1038
203 Ga0501082_0019237 3300060353 Bacteria 5886
204 Ga0530510_0103643 3300061734 Bacteria 2081
205 Ga0530510_0233992 3300061734 Bacteria 1367

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025921 Ga0207652_10777864 Ga0207652_107778642 185
2 3300025944 Ga0207661_10312514 Ga0207661_103125142 185
3 3300050511 nmdc:mga08y16_671492_c1 nmdc:mga08y16_671492_c1_47_604 185
4 3300005290 Ga0065712_10001094 Ga0065712_100010944 186
5 3300005344 Ga0070661_100563279 Ga0070661_1005632791 186
6 3300005440 Ga0070705_100205723 Ga0070705_1002057231 186
7 3300013296 Ga0157374_11757519 Ga0157374_117575191 186
8 3300014325 Ga0163163_11071220 Ga0163163_110712202 186
9 3300025315 Ga0207697_10081656 Ga0207697_100816562 186
10 3300037471 Ga0395905_0400149 Ga0395905_0400149_185_745 186
11 3300003323 rootH1_10000778 rootH1_1000077841 187
12 3300003323 rootH1_10071981 rootH1_100719813 187
13 3300003323 rootH1_10193028 rootH1_101930284 187
14 3300005327 Ga0070658_10585690 Ga0070658_105856902 187
15 3300005327 Ga0070658_11018865 Ga0070658_110188651 187
16 3300005329 Ga0070683_100187092 Ga0070683_1001870922 187
17 3300005329 Ga0070683_100281624 Ga0070683_1002816242 187
18 3300005331 Ga0070670_100031243 Ga0070670_1000312432 187
19 3300005331 Ga0070670_100428765 Ga0070670_1004287652 187
20 3300005331 Ga0070670_100491080 Ga0070670_1004910802 187
21 3300005334 Ga0068869_100911419 Ga0068869_1009114191 187
22 3300005336 Ga0070680_100023614 Ga0070680_1000236142 187
23 3300005347 Ga0070668_100158694 Ga0070668_1001586942 187
24 3300005353 Ga0070669_100060677 Ga0070669_1000606772 187
25 3300005353 Ga0070669_100093613 Ga0070669_1000936133 187
26 3300005354 Ga0070675_100663050 Ga0070675_1006630501 187
27 3300005355 Ga0070671_100362289 Ga0070671_1003622892 187
28 3300005364 Ga0070673_100427842 Ga0070673_1004278422 187
29 3300005365 Ga0070688_100283330 Ga0070688_1002833302 187
30 3300005365 Ga0070688_100486481 Ga0070688_1004864812 187
31 3300005366 Ga0070659_101107677 Ga0070659_1011076771 187
32 3300005441 Ga0070700_100503456 Ga0070700_1005034562 187
33 3300005441 Ga0070700_100520683 Ga0070700_1005206831 187
34 3300005457 Ga0070662_100969922 Ga0070662_1009699222 187
35 3300005458 Ga0070681_10008306 Ga0070681_100083065 187
36 3300005458 Ga0070681_10491540 Ga0070681_104915402 187
37 3300005459 Ga0068867_100438051 Ga0068867_1004380512 187
38 3300005466 Ga0070685_10004783 Ga0070685_100047836 187
39 3300005467 Ga0070706_100163614 Ga0070706_1001636142 187
40 3300005530 Ga0070679_100016306 Ga0070679_1000163065 187
41 3300005535 Ga0070684_100589640 Ga0070684_1005896402 187
42 3300005535 Ga0070684_101497713 Ga0070684_1014977131 187
43 3300005543 Ga0070672_100113285 Ga0070672_1001132852 187
44 3300005544 Ga0070686_100015801 Ga0070686_1000158014 187
45 3300005547 Ga0070693_100082958 Ga0070693_1000829583 187
46 3300005549 Ga0070704_100259153 Ga0070704_1002591532 187
47 3300005563 Ga0068855_100026032 Ga0068855_1000260323 187
48 3300005564 Ga0070664_100307906 Ga0070664_1003079063 187
49 3300005577 Ga0068857_101189497 Ga0068857_1011894971 187
50 3300005578 Ga0068854_100090266 Ga0068854_1000902663 187
51 3300005617 Ga0068859_100207822 Ga0068859_1002078223 187
52 3300005719 Ga0068861_100035976 Ga0068861_1000359762 187
53 3300005719 Ga0068861_101005914 Ga0068861_1010059142 187
54 3300005840 Ga0068870_10024541 Ga0068870_100245413 187
55 3300005841 Ga0068863_100627388 Ga0068863_1006273882 187
56 3300005843 Ga0068860_100795391 Ga0068860_1007953912 187
57 3300005844 Ga0068862_100009833 Ga0068862_1000098333 187
58 3300005844 Ga0068862_100027031 Ga0068862_1000270314 187
59 3300005937 Ga0081455_10040710 Ga0081455_100407103 187
60 3300006844 Ga0075428_100461132 Ga0075428_1004611323 187
61 3300006846 Ga0075430_100002258 Ga0075430_1000022587 187
62 3300006847 Ga0075431_100016476 Ga0075431_1000164763 187
63 3300006880 Ga0075429_100016586 Ga0075429_1000165864 187
64 3300006881 Ga0068865_101041965 Ga0068865_1010419651 187
65 3300006931 Ga0097620_100207817 Ga0097620_1002078173 187
66 3300009094 Ga0111539_10266134 Ga0111539_102661344 187
67 3300009094 Ga0111539_10307418 Ga0111539_103074181 187
68 3300009147 Ga0114129_10037326 Ga0114129_100373267 187
69 3300009147 Ga0114129_10121584 Ga0114129_101215842 187
70 3300009148 Ga0105243_10350522 Ga0105243_103505222 187
71 3300009148 Ga0105243_10532686 Ga0105243_105326863 187
72 3300009148 Ga0105243_10899369 Ga0105243_108993691 187
73 3300009174 Ga0105241_10232582 Ga0105241_102325823 187
74 3300009176 Ga0105242_10023582 Ga0105242_100235824 187
75 3300009176 Ga0105242_10522226 Ga0105242_105222262 187
76 3300009177 Ga0105248_10221332 Ga0105248_102213322 187
77 3300009545 Ga0105237_10098521 Ga0105237_100985214 187
78 3300009551 Ga0105238_10036262 Ga0105238_100362626 187
79 3300009553 Ga0105249_10008862 Ga0105249_100088622 187
80 3300009553 Ga0105249_10226692 Ga0105249_102266922 187
81 3300011119 Ga0105246_10749086 Ga0105246_107490862 187
82 3300013100 Ga0157373_10280827 Ga0157373_102808272 187
83 3300013102 Ga0157371_10303961 Ga0157371_103039612 187
84 3300013102 Ga0157371_10370161 Ga0157371_103701612 187
85 3300013104 Ga0157370_10632674 Ga0157370_106326742 187
86 3300013105 Ga0157369_10033285 Ga0157369_100332854 187
87 3300013105 Ga0157369_10167550 Ga0157369_101675502 187
88 3300013306 Ga0163162_10794037 Ga0163162_107940372 187
89 3300013307 Ga0157372_10126187 Ga0157372_101261876 187
90 3300013307 Ga0157372_10241657 Ga0157372_102416573 187
91 3300013307 Ga0157372_10301785 Ga0157372_103017851 187
92 3300013308 Ga0157375_10207095 Ga0157375_102070953 187
93 3300013308 Ga0157375_10244602 Ga0157375_102446022 187
94 3300013308 Ga0157375_11223984 Ga0157375_112239842 187
95 3300014325 Ga0163163_10590940 Ga0163163_105909402 187
96 3300014325 Ga0163163_10908670 Ga0163163_109086702 187
97 3300014326 Ga0157380_10047271 Ga0157380_100472712 187
98 3300014326 Ga0157380_10529480 Ga0157380_105294801 187
99 3300014745 Ga0157377_10183124 Ga0157377_101831242 187
100 3300021384 Ga0213876_10099921 Ga0213876_100999213 187
101 3300025907 Ga0207645_10184612 Ga0207645_101846122 187
102 3300025908 Ga0207643_10011496 Ga0207643_100114962 187
103 3300025909 Ga0207705_10017601 Ga0207705_100176012 187
104 3300025909 Ga0207705_10550120 Ga0207705_105501202 187
105 3300025910 Ga0207684_10140169 Ga0207684_101401692 187
106 3300025912 Ga0207707_10011169 Ga0207707_100111695 187
107 3300025913 Ga0207695_10001853 Ga0207695_1000185337 187
108 3300025913 Ga0207695_10018072 Ga0207695_100180726 187
109 3300025917 Ga0207660_10048694 Ga0207660_100486943 187
110 3300025917 Ga0207660_10525054 Ga0207660_105250542 187
111 3300025921 Ga0207652_10014724 Ga0207652_100147245 187
112 3300025921 Ga0207652_10454310 Ga0207652_104543102 187
113 3300025922 Ga0207646_10415861 Ga0207646_104158612 187
114 3300025922 Ga0207646_10494012 Ga0207646_104940121 187
115 3300025923 Ga0207681_10335415 Ga0207681_103354153 187
116 3300025923 Ga0207681_10673594 Ga0207681_106735941 187
117 3300025926 Ga0207659_10085205 Ga0207659_100852052 187
118 3300025926 Ga0207659_10553407 Ga0207659_105534072 187
119 3300025933 Ga0207706_10121046 Ga0207706_101210463 187
120 3300025933 Ga0207706_10125146 Ga0207706_101251464 187
121 3300025935 Ga0207709_10601942 Ga0207709_106019422 187
122 3300025936 Ga0207670_10134075 Ga0207670_101340752 187
123 3300025940 Ga0207691_10064340 Ga0207691_100643402 187
124 3300025940 Ga0207691_10079327 Ga0207691_100793273 187
125 3300025940 Ga0207691_10111116 Ga0207691_101111163 187
126 3300025940 Ga0207691_10209053 Ga0207691_102090531 187
127 3300025940 Ga0207691_10298509 Ga0207691_102985092 187
128 3300025944 Ga0207661_10339830 Ga0207661_103398302 187
129 3300025944 Ga0207661_10922481 Ga0207661_109224811 187
130 3300025945 Ga0207679_10574726 Ga0207679_105747263 187
131 3300025949 Ga0207667_10888843 Ga0207667_108888431 187
132 3300025960 Ga0207651_10069384 Ga0207651_100693841 187
133 3300025960 Ga0207651_10109396 Ga0207651_101093963 187
134 3300025961 Ga0207712_10002965 Ga0207712_100029654 187
135 3300025961 Ga0207712_10172293 Ga0207712_101722932 187
136 3300025972 Ga0207668_10120188 Ga0207668_101201882 187
137 3300025981 Ga0207640_10052963 Ga0207640_100529634 187
138 3300026075 Ga0207708_10049378 Ga0207708_100493782 187
139 3300026089 Ga0207648_10371491 Ga0207648_103714913 187
140 3300026095 Ga0207676_10830643 Ga0207676_108306432 187
141 3300026118 Ga0207675_100078347 Ga0207675_1000783472 187
142 3300026121 Ga0207683_10251413 Ga0207683_102514133 187
143 3300026142 Ga0207698_11062839 Ga0207698_110628391 187
144 3300027876 Ga0209974_10043582 Ga0209974_100435823 187
145 3300028380 Ga0268265_10020973 Ga0268265_100209732 187
146 3300028380 Ga0268265_10035879 Ga0268265_100358793 187
147 3300031548 Ga0307408_100284118 Ga0307408_1002841181 187
148 3300031548 Ga0307408_101286705 Ga0307408_1012867051 187
149 3300031824 Ga0307413_10114345 Ga0307413_101143451 187
150 3300031824 Ga0307413_10158049 Ga0307413_101580491 187
151 3300031852 Ga0307410_10086743 Ga0307410_100867432 187
152 3300031852 Ga0307410_10114582 Ga0307410_101145822 187
153 3300031852 Ga0307410_10459575 Ga0307410_104595752 187
154 3300031911 Ga0307412_10056599 Ga0307412_100565995 187
155 3300031995 Ga0307409_100287801 Ga0307409_1002878013 187
156 3300031995 Ga0307409_100501451 Ga0307409_1005014512 187
157 3300031995 Ga0307409_101140638 Ga0307409_1011406381 187
158 3300032002 Ga0307416_100240093 Ga0307416_1002400933 187
159 3300032004 Ga0307414_10249837 Ga0307414_102498372 187
160 3300032126 Ga0307415_100138881 Ga0307415_1001388811 187
161 3300032126 Ga0307415_100347784 Ga0307415_1003477842 187
162 3300035725 Ga0373947_0143043 Ga0373947_0143043_382_945 187
163 3300037418 Ga0395900_0933763 Ga0395900_0933763_203_766 187
164 3300039437 Ga0436365_1366357 Ga0436365_1366357_30_593 187
165 3300039437 Ga0436365_1411290 Ga0436365_1411290_1389_1952 187
166 3300039437 Ga0436365_1731778 Ga0436365_1731778_2523_3086 187
167 3300046499 Ga0495594_0082128 Ga0495594_0082128_1044_1607 187
168 3300046674 Ga0495588_0018301 Ga0495588_0018301_2551_3114 187
169 3300046683 Ga0495658_0657819 Ga0495658_0657819_68_631 187
170 3300047320 Ga0495672_0025498 Ga0495672_0025498_1433_1996 187
171 3300048915 Ga0496112_0049739 Ga0496112_0049739_798_1361 187
172 3300049571 Ga0501034_0005520 Ga0501034_0005520_12335_12910 187
173 3300049571 Ga0501034_0709873 Ga0501034_0709873_88_696 187
174 3300049572 Ga0501036_0729099 Ga0501036_0729099_101_709 187
175 3300049581 Ga0501047_0230291 Ga0501047_0230291_773_1381 187
176 3300049582 Ga0501048_0619635 Ga0501048_0619635_47_610 187
177 3300049583 Ga0501067_0056588 Ga0501067_0056588_1238_1801 187
178 3300049585 Ga0501069_0015501 Ga0501069_0015501_1501_2064 187
179 3300049586 Ga0501070_0000169 Ga0501070_0000169_7035_7598 187
180 3300049589 Ga0501073_0001631 Ga0501073_0001631_15930_16493 187
181 3300049589 Ga0501073_0032481 Ga0501073_0032481_1360_1923 187
182 3300049589 Ga0501073_0295768 Ga0501073_0295768_446_1009 187
183 3300049590 Ga0501074_0020429 Ga0501074_0020429_759_1322 187
184 3300049592 Ga0501076_0246177 Ga0501076_0246177_370_933 187
185 3300049660 Ga0501216_069533 Ga0501216_069533_124_687 187
186 3300049679 Ga0501249_053341 Ga0501249_053341_119_682 187
187 3300049742 Ga0501080_0001429 Ga0501080_0001429_12204_12767 187
188 3300049742 Ga0501080_0556581 Ga0501080_0556581_244_819 187
189 3300049743 Ga0501081_0178207 Ga0501081_0178207_957_1520 187
190 3300049744 Ga0501083_0032517 Ga0501083_0032517_2251_2814 187
191 3300049765 Ga0501268_037619 Ga0501268_037619_17_580 187
192 3300049822 Ga0501035_0125479 Ga0501035_0125479_747_1310 187
193 3300050507 nmdc:mga05p37_264686_c1 nmdc:mga05p37_264686_c1_782_1345 187
194 3300050507 nmdc:mga05p37_48771_c1 nmdc:mga05p37_48771_c1_653_1216 187
195 3300050507 nmdc:mga05p37_558105_c1 nmdc:mga05p37_558105_c1_723_1289 187
196 3300050508 nmdc:mga09592_29473_c1 nmdc:mga09592_29473_c1_1994_2557 187
197 3300050509 nmdc:mga0qj67_15923_c1 nmdc:mga0qj67_15923_c1_2311_2874 187
198 3300050509 nmdc:mga0qj67_22525_c1 nmdc:mga0qj67_22525_c1_3204_3767 187
199 3300050510 nmdc:mga06r32_64491_c1 nmdc:mga06r32_64491_c1_920_1483 187
200 3300050510 nmdc:mga06r32_68959_c1 nmdc:mga06r32_68959_c1_2424_2987 187
201 3300050511 nmdc:mga08y16_166140_c1 nmdc:mga08y16_166140_c1_1569_2132 187
202 3300060353 Ga0501082_0019237 Ga0501082_0019237_3934_4497 187
203 3300061734 Ga0530510_0103643 Ga0530510_0103643_124_687 187
204 3300061734 Ga0530510_0233992 Ga0530510_0233992_647_1210 187

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14066

DUF4256

Protein of unknown function (DUF4256)

57

229

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
5k8p-assembly1.cif.gz_A zn2+/tetrahedral intermediate-bound r289a 5-nitroanthranilate aminohydrolase 0.6262 47 78
2qvp-assembly1.cif.gz_A crystal structure of a putative metallopeptidase (sama_0725) from shewanella amazonensis sb2b at 2.00 a resolution 0.4302 47 84
3b2y-assembly1.cif.gz_A crystal structure of a putative metallopeptidase (sden_2526) from shewanella denitrificans os217 at 1.74 a resolution 0.4153 47 84
3b2y-assembly2.cif.gz_B crystal structure of a putative metallopeptidase (sden_2526) from shewanella denitrificans os217 at 1.74 a resolution 0.4048 47 82
4e6f-assembly1.cif.gz_A crystal structure of a duf4468 family protein (bacova_04320) from bacteroides ovatus atcc 8483 at 1.49 a resolution 0.3888 48 77
ID Description Score Start End Superfamily
af_Q9C5X4_207_256_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.8985 62 76 2.30.30.140
af_I1L2N2_154_206_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.6337 62 84 2.30.30.140
5k8oC01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.6279 47 78 3.40.630.10
af_Q1ZXN8_290_341_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.6023 62 83 2.30.30.140
af_Q2QTK4_151_212_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.5118 62 90 2.30.30.140
ID Description Score Start End GO Terms
AF-M6JPN8-F1-model_v4 DUF4256 domain-containing protein 0.9785 7 74
AF-A0A2V9S5S2-F1-model_v4 DUF4256 domain-containing protein 0.9703 1 82
AF-M1ZA69-F1-model_v4 DUF4256 domain-containing protein 0.962 1 76
AF-A0A7J4J5B0-F1-model_v4 DUF4256 domain-containing protein 0.9604 2 60
AF-A0A355IJW0-F1-model_v4 DUF4256 domain-containing protein 0.9591 17 83

Feature Viewer

pLDDT pTM Quality
58.88 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map