F311691

General Info

Members Datasets Scaffolds Average Seq Length
203 139 406 321

Family's Representative Sequence

Representative Sequence 3300048913|Ga0496110_0286623|Ga0496110_0286623_154_1215
Length 346
Sequence LVGPRSVASRDERRYSAGEEQGWNAVNRRREILVTLAIGAAFTPRAAQAQRQSSRLVHIGYLDTSSASIASVRLDRLRDGLRDLGYVEGRNMVIEVRWAESLYDRLPGLAAELLERKLDVIVAAGPAAIQAVRQATTTVPIVFAASGDPLVFGFVQSLSRPGGNVTGLSTVGANLSSKYLDILREAIPSLSTVAVLMNPGLRSIQATARDTVRILPIRAANVGQIEAAFDVIKQARADALIVPGDGLFFSQARRIAELAVQQHLPTMFSTREPVQAGALMSYGPNLAEQFYRAATYVDRILKGAHPGDLPVEQPTTFELVINLKTAKAIGMTLRQELLLRADVLVE

Samples

Sample ID Description Type Environment
1 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
97 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
98 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
101 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
102 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
103 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
104 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
105 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
109 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
110 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
111 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
112 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
113 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
114 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
115 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
116 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
117 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
118 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
119 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
120 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
123 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
124 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
125 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
126 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
127 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
128 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
129 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
130 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
131 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
134 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
135 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
136 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
137 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
138 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
139 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.48
Rhizosphere 97.04
Stem 0
Stem Tuber 0
Unclassified 13.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496110_0286623 3300048913 Bacteria 1500
2 Ga0065714_10108204 3300005288 Bacteria 1519
3 Ga0065712_10000663 3300005290 Bacteria 9864
4 Ga0065715_10101422 3300005293 Unclassified 3198
5 Ga0070676_10003481 3300005328 Bacteria 8208
6 Ga0070690_100050588 3300005330 Bacteria 2651
7 Ga0070690_100144685 3300005330 Unclassified 1616
8 Ga0070670_100034616 3300005331 Plasmid 4346
9 Ga0070670_100066302 3300005331 Unclassified 3098
10 Ga0070670_100243248 3300005331 Bacteria 1567
11 Ga0070677_10088276 3300005333 Bacteria 1343
12 Ga0070666_10094708 3300005335 Bacteria 2054
13 Ga0070680_100109659 3300005336 Bacteria 2297
14 Ga0068868_100113049 3300005338 Bacteria 2207
15 Ga0068868_100375517 3300005338 Unclassified 1222
16 Ga0070689_100151131 3300005340 Bacteria 1873
17 Ga0070687_100001026 3300005343 Bacteria 9519
18 Ga0070668_100002516 3300005347 Bacteria 13492
19 Ga0070669_100120694 3300005353 Bacteria 1999
20 Ga0070675_100020095 3300005354 Bacteria 5327
21 Ga0070675_100302388 3300005354 Bacteria 1410
22 Ga0070671_100394501 3300005355 Bacteria 1183
23 Ga0070674_100051750 3300005356 Bacteria 2831
24 Ga0070673_100274824 3300005364 Bacteria 1476
25 Ga0070667_100020395 3300005367 Bacteria 5502
26 Ga0070710_10018031 3300005437 Bacteria 3625
27 Ga0070694_100019137 3300005444 Bacteria 4353
28 Ga0070694_100250914 3300005444 Bacteria 1338
29 Ga0070708_100012415 3300005445 Bacteria 6954
30 Ga0070708_100070389 3300005445 Bacteria 3147
31 Ga0070708_100375537 3300005445 Unclassified 1340
32 Ga0070678_100062195 3300005456 Plasmid 2756
33 Ga0070678_100151499 3300005456 Bacteria 1868
34 Ga0070678_100202149 3300005456 Unclassified 1640
35 Ga0070678_100217743 3300005456 Bacteria 1586
36 Ga0070681_10010263 3300005458 Bacteria 9242
37 Ga0068867_100085578 3300005459 Bacteria 2383
38 Ga0068867_100157594 3300005459 Bacteria 1788
39 Ga0070706_100158969 3300005467 Bacteria 2110
40 Ga0070707_100144006 3300005468 Bacteria 2319
41 Ga0070707_100398985 3300005468 Unclassified 1335
42 Ga0070697_100002775 3300005536 Bacteria 13486
43 Ga0070697_100260961 3300005536 Bacteria 1483
44 Ga0070672_100005857 3300005543 Bacteria 8198
45 Ga0070672_100176537 3300005543 Bacteria 1779
46 Ga0070672_100217541 3300005543 Bacteria 1601
47 Ga0070695_100038010 3300005545 Bacteria 3035
48 Ga0070696_100035346 3300005546 Bacteria 3440
49 Ga0070696_100044967 3300005546 Bacteria 3058
50 Ga0070665_100061257 3300005548 Bacteria 3771
51 Ga0070665_100086099 3300005548 Bacteria 3148
52 Ga0070665_100255349 3300005548 Bacteria 1754
53 Ga0070665_100369165 3300005548 Unclassified 1442
54 Ga0070704_100104866 3300005549 Bacteria 2139
55 Ga0068852_100076019 3300005616 Bacteria 2964
56 Ga0068859_100196083 3300005617 Bacteria 2104
57 Ga0068859_100360135 3300005617 Bacteria 1550
58 Ga0068859_100388548 3300005617 Bacteria 1491
59 Ga0068859_100756888 3300005617 Unclassified 1060
60 Ga0068864_100065293 3300005618 Bacteria 3157
61 Ga0068864_100090765 3300005618 Bacteria 2694
62 Ga0068864_100501411 3300005618 Bacteria 1168
63 Ga0068863_100038374 3300005841 Bacteria 4557
64 Ga0068863_100117419 3300005841 Bacteria 2535
65 Ga0068858_100091857 3300005842 Bacteria 2825
66 Ga0068860_100007803 3300005843 Bacteria 10688
67 Ga0068862_100054517 3300005844 Bacteria 3423
68 Ga0081455_10079805 3300005937 Bacteria 2685
69 Ga0081455_10081512 3300005937 Bacteria 2650
70 Ga0070716_100056908 3300006173 Bacteria 2245
71 Ga0068871_100143368 3300006358 Bacteria 2032
72 Ga0075428_100034531 3300006844 Bacteria 5578
73 Ga0075428_100181717 3300006844 Bacteria 2276
74 Ga0075430_100043530 3300006846 Bacteria 3795
75 Ga0075431_100029687 3300006847 Bacteria 5629
76 Ga0075434_100048248 3300006871 Bacteria 4225
77 Ga0075434_100179072 3300006871 Bacteria 2139
78 Ga0097620_100196092 3300006931 Bacteria 2104
79 Ga0097620_100360133 3300006931 Bacteria 1550
80 Ga0097620_100388587 3300006931 Bacteria 1491
81 Ga0097620_100756796 3300006931 Unclassified 1060
82 Ga0075435_100006052 3300007076 Bacteria 8521
83 Ga0099794_10022586 3300007265 Bacteria 2869
84 Ga0099794_10099455 3300007265 Unclassified 1451
85 Ga0111539_10199284 3300009094 Bacteria 2335
86 Ga0111539_10214960 3300009094 Bacteria 2240
87 Ga0111539_10247023 3300009094 Bacteria 2077
88 Ga0105247_10208714 3300009101 Unclassified 1316
89 Ga0114129_10135890 3300009147 Bacteria 3374
90 Ga0114129_10515765 3300009147 Bacteria 1559
91 Ga0114129_10568125 3300009147 Unclassified 1473
92 Ga0105243_10017318 3300009148 Bacteria 5448
93 Ga0105248_10240385 3300009177 Bacteria 2038
94 Ga0105249_10013202 3300009553 Bacteria 7289
95 Ga0105249_10477701 3300009553 Bacteria 1289
96 Ga0157378_10096469 3300013297 Bacteria 2695
97 Ga0157378_10330327 3300013297 Unclassified 1484
98 Ga0163162_10158796 3300013306 Bacteria 2382
99 Ga0157375_10081480 3300013308 Plasmid 3276
100 Ga0157375_10116127 3300013308 Bacteria 2780
101 Ga0157375_10281884 3300013308 Bacteria 1825
102 Ga0157375_10726703 3300013308 Bacteria 1145
103 Ga0163163_10066530 3300014325 Bacteria 3579
104 Ga0157380_10029652 3300014326 Bacteria 4183
105 Ga0157380_10373142 3300014326 Bacteria 1343
106 Ga0157379_10022399 3300014968 Bacteria 5596
107 Ga0157376_10008345 3300014969 Bacteria 7472
108 Ga0163161_10041189 3300017792 Bacteria 3319
109 Ga0207682_10043140 3300025893 Bacteria 1845
110 Ga0207692_10017288 3300025898 Bacteria 3214
111 Ga0207684_10062284 3300025910 Bacteria 3167
112 Ga0207684_10093930 3300025910 Bacteria 2558
113 Ga0207684_10222157 3300025910 Bacteria 1630
114 Ga0207707_10008014 3300025912 Bacteria 9175
115 Ga0207662_10005998 3300025918 Bacteria 6529
116 Ga0207662_10129651 3300025918 Bacteria 1589
117 Ga0207681_10007900 3300025923 Bacteria 6504
118 Ga0207659_10015842 3300025926 Bacteria 4897
119 Ga0207659_10086433 3300025926 Bacteria 2332
120 Ga0207644_10152107 3300025931 Bacteria 1791
121 Ga0207706_10021941 3300025933 Bacteria 5731
122 Ga0207706_10108079 3300025933 Bacteria 2448
123 Ga0207686_10078700 3300025934 Bacteria 2145
124 Ga0207709_10070585 3300025935 Bacteria 2215
125 Ga0207665_10053677 3300025939 Bacteria 2717
126 Ga0207691_10011445 3300025940 Bacteria 8513
127 Ga0207691_10099331 3300025940 Bacteria 2599
128 Ga0207691_10188032 3300025940 Bacteria 1802
129 Ga0207711_10061694 3300025941 Bacteria 3232
130 Ga0207689_10261519 3300025942 Unclassified 1432
131 Ga0207668_10024365 3300025972 Bacteria 3904
132 Ga0207668_10186176 3300025972 Unclassified 1642
133 Ga0207658_10009704 3300025986 Bacteria 6535
134 Ga0207677_10224705 3300026023 Unclassified 1508
135 Ga0207677_10228544 3300026023 Bacteria 1497
136 Ga0207703_10500798 3300026035 Unclassified 1140
137 Ga0207641_10062945 3300026088 Bacteria 3167
138 Ga0207641_10528804 3300026088 Bacteria 1148
139 Ga0207648_10022349 3300026089 Bacteria 5683
140 Ga0207648_10234647 3300026089 Bacteria 1632
141 Ga0207676_10042131 3300026095 Unclassified 3510
142 Ga0207674_10224636 3300026116 Bacteria 1826
143 Ga0207675_100004220 3300026118 Bacteria 13908
144 Ga0207683_10087971 3300026121 Plasmid 2763
145 Ga0207683_10135495 3300026121 Bacteria 2217
146 Ga0207683_10164420 3300026121 Bacteria 2007
147 Ga0207683_10208092 3300026121 Bacteria 1780
148 Ga0207683_10210425 3300026121 Bacteria 1770
149 Ga0207698_10148912 3300026142 Bacteria 2028
150 Ga0210002_1010814 3300027617 Unclassified 1405
151 Ga0268266_10236527 3300028379 Bacteria 1684
152 Ga0268266_10237409 3300028379 Bacteria 1681
153 Ga0268265_10050100 3300028380 Bacteria 3145
154 Ga0268264_10029646 3300028381 Bacteria 4483
155 Ga0307515_10206357 3300028794 Bacteria 1823
156 Ga0307513_10290725 3300031456 Unclassified 1406
157 Ga0307516_10021238 3300031730 Bacteria 6688
158 Ga0307416_100311475 3300032002 Bacteria 1571
159 Ga0373940_0056436 3300035088 Unclassified 1114
160 Ga0373953_0030323 3300035117 Bacteria 2096
161 Ga0373956_0123513 3300035119 Bacteria 1210
162 Ga0373957_0009528 3300035120 Bacteria 3181
163 Ga0373955_0079781 3300035172 Bacteria 1847
164 Ga0373933_0037773 3300035724 Bacteria 2834
165 Ga0373937_0001176 3300036401 Bacteria 21996
166 Ga0373937_0149145 3300036401 Bacteria 2190
167 Ga0395901_0071522 3300038443 Bacteria 3615
168 Ga0439436_0022557 3300041404 Bacteria 1864
169 Ga0439438_024447 3300041405 Bacteria 1654
170 Ga0439433_0017633 3300041999 Bacteria 1586
171 Ga0439442_008601 3300042002 Bacteria 2060
172 Ga0439432_044793 3300042006 Bacteria 1393
173 Ga0439449_0006710 3300042007 Bacteria 4395
174 Ga0439452_004254 3300042010 Bacteria 4839
175 Ga0439462_0003574 3300042015 Bacteria 3741
176 Ga0450923_015047 3300042125 Bacteria 1442
177 Ga0450906_023074 3300042145 Bacteria 1109
178 Ga0439446_0013426 3300042156 Bacteria 2248
179 Ga0451577_0568071 3300042876 Unclassified 1029
180 Ga0453684_0046531 3300044712 Bacteria 5769
181 Ga0451576_0102019 3300045051 Bacteria 2984
182 Ga0495580_0042084 3300046472 Unclassified 3256
183 Ga0495586_0002957 3300046535 Bacteria 9156
184 Ga0495656_0002439 3300046615 Bacteria 6179
185 Ga0495658_0032347 3300046683 Bacteria 2855
186 Ga0495669_0064423 3300046684 Bacteria 1663
187 Ga0495604_0177874 3300047317 Bacteria 1490
188 Ga0495604_0238459 3300047317 Bacteria 1245
189 Ga0495615_0003117 3300048090 Bacteria 2746
190 Ga0496105_0070748 3300048908 Bacteria 2884
191 Ga0496112_0439198 3300048915 Unclassified 1243
192 Ga0501067_0276599 3300049583 Bacteria 935
193 nmdc:mga05p37_38060_c1 3300050507 Bacteria 5900
194 nmdc:mga09592_160778_c1 3300050508 Bacteria 1940
195 nmdc:mga0qj67_121685_c1 3300050509 Bacteria 2111
196 nmdc:mga06r32_251667_c1 3300050510 Bacteria 1754
197 nmdc:mga06r32_411594_c1 3300050510 Unclassified 1334
198 nmdc:mga06r32_88824_c1 3300050510 Bacteria 3017
199 nmdc:mga0n895_34906_c1 3300050512 Bacteria 4844
200 nmdc:mga0rr50_111485_c1 3300050513 Bacteria 2165
201 nmdc:mga0rr50_29243_c1 3300050513 Bacteria 3884
202 nmdc:mga0a205_27232_c3 3300050515 Bacteria 4691
203 Ga0495601_0214379 3300053077 Unclassified 1258
204 Ga0496110_0286623
205 Ga0065714_10108204
206 Ga0065712_10000663
207 Ga0065715_10101422
208 Ga0070676_10003481
209 Ga0070690_100050588
210 Ga0070690_100144685
211 Ga0070670_100034616
212 Ga0070670_100066302
213 Ga0070670_100243248
214 Ga0070677_10088276
215 Ga0070666_10094708
216 Ga0070680_100109659
217 Ga0068868_100113049
218 Ga0068868_100375517
219 Ga0070689_100151131
220 Ga0070687_100001026
221 Ga0070668_100002516
222 Ga0070669_100120694
223 Ga0070675_100020095
224 Ga0070675_100302388
225 Ga0070671_100394501
226 Ga0070674_100051750
227 Ga0070673_100274824
228 Ga0070667_100020395
229 Ga0070710_10018031
230 Ga0070694_100019137
231 Ga0070694_100250914
232 Ga0070708_100012415
233 Ga0070708_100070389
234 Ga0070708_100375537
235 Ga0070678_100062195
236 Ga0070678_100151499
237 Ga0070678_100202149
238 Ga0070678_100217743
239 Ga0070681_10010263
240 Ga0068867_100085578
241 Ga0068867_100157594
242 Ga0070706_100158969
243 Ga0070707_100144006
244 Ga0070707_100398985
245 Ga0070697_100002775
246 Ga0070697_100260961
247 Ga0070672_100005857
248 Ga0070672_100176537
249 Ga0070672_100217541
250 Ga0070695_100038010
251 Ga0070696_100035346
252 Ga0070696_100044967
253 Ga0070665_100061257
254 Ga0070665_100086099
255 Ga0070665_100255349
256 Ga0070665_100369165
257 Ga0070704_100104866
258 Ga0068852_100076019
259 Ga0068859_100196083
260 Ga0068859_100360135
261 Ga0068859_100388548
262 Ga0068859_100756888
263 Ga0068864_100065293
264 Ga0068864_100090765
265 Ga0068864_100501411
266 Ga0068863_100038374
267 Ga0068863_100117419
268 Ga0068858_100091857
269 Ga0068860_100007803
270 Ga0068862_100054517
271 Ga0081455_10079805
272 Ga0081455_10081512
273 Ga0070716_100056908
274 Ga0068871_100143368
275 Ga0075428_100034531
276 Ga0075428_100181717
277 Ga0075430_100043530
278 Ga0075431_100029687
279 Ga0075434_100048248
280 Ga0075434_100179072
281 Ga0097620_100196092
282 Ga0097620_100360133
283 Ga0097620_100388587
284 Ga0097620_100756796
285 Ga0075435_100006052
286 Ga0099794_10022586
287 Ga0099794_10099455
288 Ga0111539_10199284
289 Ga0111539_10214960
290 Ga0111539_10247023
291 Ga0105247_10208714
292 Ga0114129_10135890
293 Ga0114129_10515765
294 Ga0114129_10568125
295 Ga0105243_10017318
296 Ga0105248_10240385
297 Ga0105249_10013202
298 Ga0105249_10477701
299 Ga0157378_10096469
300 Ga0157378_10330327
301 Ga0163162_10158796
302 Ga0157375_10081480
303 Ga0157375_10116127
304 Ga0157375_10281884
305 Ga0157375_10726703
306 Ga0163163_10066530
307 Ga0157380_10029652
308 Ga0157380_10373142
309 Ga0157379_10022399
310 Ga0157376_10008345
311 Ga0163161_10041189
312 Ga0207682_10043140
313 Ga0207692_10017288
314 Ga0207684_10062284
315 Ga0207684_10093930
316 Ga0207684_10222157
317 Ga0207707_10008014
318 Ga0207662_10005998
319 Ga0207662_10129651
320 Ga0207681_10007900
321 Ga0207659_10015842
322 Ga0207659_10086433
323 Ga0207644_10152107
324 Ga0207706_10021941
325 Ga0207706_10108079
326 Ga0207686_10078700
327 Ga0207709_10070585
328 Ga0207665_10053677
329 Ga0207691_10011445
330 Ga0207691_10099331
331 Ga0207691_10188032
332 Ga0207711_10061694
333 Ga0207689_10261519
334 Ga0207668_10024365
335 Ga0207668_10186176
336 Ga0207658_10009704
337 Ga0207677_10224705
338 Ga0207677_10228544
339 Ga0207703_10500798
340 Ga0207641_10062945
341 Ga0207641_10528804
342 Ga0207648_10022349
343 Ga0207648_10234647
344 Ga0207676_10042131
345 Ga0207674_10224636
346 Ga0207675_100004220
347 Ga0207683_10087971
348 Ga0207683_10135495
349 Ga0207683_10164420
350 Ga0207683_10208092
351 Ga0207683_10210425
352 Ga0207698_10148912
353 Ga0210002_1010814
354 Ga0268266_10236527
355 Ga0268266_10237409
356 Ga0268265_10050100
357 Ga0268264_10029646
358 Ga0307515_10206357
359 Ga0307513_10290725
360 Ga0307516_10021238
361 Ga0307416_100311475
362 Ga0373940_0056436
363 Ga0373953_0030323
364 Ga0373956_0123513
365 Ga0373957_0009528
366 Ga0373955_0079781
367 Ga0373933_0037773
368 Ga0373937_0001176
369 Ga0373937_0149145
370 Ga0395901_0071522
371 Ga0439436_0022557
372 Ga0439438_024447
373 Ga0439433_0017633
374 Ga0439442_008601
375 Ga0439432_044793
376 Ga0439449_0006710
377 Ga0439452_004254
378 Ga0439462_0003574
379 Ga0450923_015047
380 Ga0450906_023074
381 Ga0439446_0013426
382 Ga0451577_0568071
383 Ga0453684_0046531
384 Ga0451576_0102019
385 Ga0495580_0042084
386 Ga0495586_0002957
387 Ga0495656_0002439
388 Ga0495658_0032347
389 Ga0495669_0064423
390 Ga0495604_0177874
391 Ga0495604_0238459
392 Ga0495615_0003117
393 Ga0496105_0070748
394 Ga0496112_0439198
395 Ga0501067_0276599
396 nmdc:mga05p37_38060_c1
397 nmdc:mga09592_160778_c1
398 nmdc:mga0qj67_121685_c1
399 nmdc:mga06r32_251667_c1
400 nmdc:mga06r32_411594_c1
401 nmdc:mga06r32_88824_c1
402 nmdc:mga0n895_34906_c1
403 nmdc:mga0rr50_111485_c1
404 nmdc:mga0rr50_29243_c1
405 nmdc:mga0a205_27232_c3
406 Ga0495601_0214379

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04392

ABC_sub_bind

ABC transporter substrate binding protein

69

345

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.8876 33 333
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.8848 33 333
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.8838 33 332
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.8783 33 332
6k1w-assembly1.cif.gz_A crystal structure of rhodothermus marinus substrate-binding protein at ph 5.5 0.8698 157 325
ID Description Score Start End Superfamily
3lftB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9095 37 147 3.40.50.2300
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9016 156 332 3.40.50.2300
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8872 156 333 3.40.50.2300
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8783 156 332 3.40.50.2300
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8703 156 333 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A535APG1-F1-model_v4 ABC transporter substrate-binding protein 0.9707 27 334
AF-A0A537TG30-F1-model_v4 ABC transporter substrate-binding protein 0.9686 153 318
AF-A0A1G8MYH6-F1-model_v4 Putative ABC transport system substrate-binding protein 0.9625 28 334
AF-A0A537MYP8-F1-model_v4 ABC transporter substrate-binding protein 0.9616 57 334
AF-A0A5S4YJP2-F1-model_v4 ABC transporter substrate-binding protein 0.9615 29 147

Map