F311556

General Info

Members Datasets Scaffolds Average Seq Length
203 108 406 149

Family's Representative Sequence

Representative Sequence 3300044693|Ga0466961_0009063|Ga0466961_0009063_4195_4626
Length 143
Sequence MAKHLREPEAELAILLIEDDPGDILIAQEALRAGKLGSALTVVQDGGEALARLRSDQERPDLVLLDLNLPGMSGHEVLSAVKGDAELRILPVVVLSTSATEQDVRRSYELGANLYVHKPVDFDRFADVIKQLEEFFRTVVRLP

Samples

Sample ID Description Type Environment
1 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
6 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
7 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
8 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
9 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
10 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
11 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
12 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
13 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
14 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
15 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
16 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
17 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
18 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
19 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
20 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
21 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
22 3300009829 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample D Metatranscriptome Rhizosphere
23 3300009835 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample B Metatranscriptome Rhizosphere
24 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
25 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
26 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
27 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
28 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
29 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
30 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
43 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
45 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
46 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
47 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
48 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
49 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
50 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
51 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
52 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
53 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
54 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
55 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
56 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
57 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
58 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
59 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
60 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
61 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
62 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
63 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
64 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
65 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
66 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
67 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
68 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
69 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
70 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
71 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
72 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
73 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
74 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
75 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
76 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
77 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
88 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
89 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
90 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
91 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
92 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
94 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
95 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
96 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
97 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
98 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
99 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
100 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
101 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
102 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
103 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
104 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
107 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
108 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.06
Metatranscriptomes 2.96
Isolates 0.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.12
Nodule 0
Rhizoplane 1.97
Rhizosphere 70.94
Stem 0
Stem Tuber 0
Unclassified 0.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466961_0009063 3300044693 Bacteria 6347
2 Ga0070658_10263795 3300005327 Bacteria 1463
3 Ga0070667_100003678 3300005367 Bacteria 13059
4 Ga0070667_100084542 3300005367 Bacteria 2720
5 Ga0070714_100642775 3300005435 Bacteria 1021
6 Ga0070714_100659108 3300005435 Bacteria 1008
7 Ga0070710_10180796 3300005437 Bacteria 1320
8 Ga0070697_100495263 3300005536 Bacteria 1068
9 Ga0068855_100082836 3300005563 Bacteria 3717
10 Ga0068856_100242055 3300005614 Bacteria 1819
11 Ga0068863_100577896 3300005841 Bacteria 1111
12 Ga0068860_100000237 3300005843 Bacteria 84631
13 Ga0070717_10159199 3300006028 Bacteria 1958
14 Ga0075365_10075348 3300006038 Bacteria 2277
15 Ga0075365_10174009 3300006038 Bacteria 1503
16 Ga0075365_10252062 3300006038 Bacteria 1240
17 Ga0075365_10455270 3300006038 Bacteria 904
18 Ga0075365_10638629 3300006038 Unclassified 752
19 Ga0075368_10252547 3300006042 Bacteria 754
20 Ga0075363_100008683 3300006048 Bacteria 4744
21 Ga0075363_100139176 3300006048 Bacteria 1366
22 Ga0075363_100215161 3300006048 Bacteria 1100
23 Ga0075363_100432802 3300006048 Bacteria 775
24 Ga0075364_10011385 3300006051 Bacteria 5404
25 Ga0075364_10017420 3300006051 Bacteria 4488
26 Ga0075364_10070736 3300006051 Bacteria 2297
27 Ga0075364_10401958 3300006051 Bacteria 935
28 Ga0075367_10029241 3300006178 Bacteria 3151
29 Ga0075367_10308494 3300006178 Bacteria 997
30 Ga0075367_10513612 3300006178 Bacteria 760
31 Ga0075367_10631833 3300006178 Bacteria 681
32 Ga0075370_10122675 3300006353 Bacteria 1514
33 Ga0075370_10126027 3300006353 Bacteria 1492
34 Ga0075430_101421441 3300006846 Bacteria 570
35 Ga0105240_10119217 3300009093 Bacteria 3179
36 Ga0105241_10043075 3300009174 Bacteria 3417
37 Ga0105237_10040888 3300009545 Bacteria 4676
38 Ga0105237_10188813 3300009545 Bacteria 2061
39 Ga0130086_1020701 3300009829 Bacteria 706
40 Ga0130084_1083554 3300009835 Bacteria 706
41 Ga0105239_10019933 3300010375 Bacteria 7401
42 Ga0105239_10115444 3300010375 Bacteria 2978
43 Ga0105239_11102477 3300010375 Bacteria 914
44 Ga0157369_10089010 3300013105 Bacteria 3296
45 Ga0157369_10399223 3300013105 Bacteria 1426
46 Ga0157378_11377899 3300013297 Bacteria 748
47 Ga0157372_10663294 3300013307 Bacteria 1214
48 Ga0197907_11109665 3300020069 Bacteria 1270
49 Ga0206353_10130040 3300020082 Bacteria 1450
50 Ga0207647_10027153 3300025904 Bacteria 3735
51 Ga0207647_10048955 3300025904 Bacteria 2623
52 Ga0207654_10012696 3300025911 Bacteria 4321
53 Ga0207695_10041075 3300025913 Bacteria 4952
54 Ga0207671_10014808 3300025914 Bacteria 6143
55 Ga0207671_10062406 3300025914 Bacteria 2767
56 Ga0207694_10783674 3300025924 Bacteria 805
57 Ga0207664_10425122 3300025929 Bacteria 1184
58 Ga0207664_10698935 3300025929 Bacteria 912
59 Ga0207667_10057230 3300025949 Bacteria 4093
60 Ga0207667_10085139 3300025949 Bacteria 3273
61 Ga0207658_10020197 3300025986 Bacteria 4614
62 Ga0207658_10051784 3300025986 Bacteria 3027
63 Ga0207639_10995098 3300026041 Bacteria 785
64 Ga0207702_10257578 3300026078 Bacteria 1641
65 Ga0207641_10268636 3300026088 Bacteria 1600
66 Ga0207698_10592077 3300026142 Bacteria 1092
67 Ga0209813_10312530 3300027866 Bacteria 613
68 Ga0268264_10000195 3300028381 Bacteria 123899
69 Ga0307409_100072672 3300031995 Bacteria 2740
70 Ga0307409_100172299 3300031995 Bacteria 1906
71 Ga0307416_100220091 3300032002 Bacteria 1820
72 Ga0307411_10895460 3300032005 Bacteria 788
73 Ga0307415_100024182 3300032126 Bacteria 3788
74 Ga0307415_100182217 3300032126 Bacteria 1649
75 Ga0466969_0525749 3300044656 Bacteria 541
76 Ga0466972_0023756 3300044658 Bacteria 3047
77 Ga0466972_0224522 3300044658 Bacteria 879
78 Ga0453683_0607251 3300044673 Bacteria 714
79 Ga0466965_0041512 3300044683 Bacteria 2267
80 Ga0466966_0060490 3300044684 Bacteria 2391
81 Ga0466966_0085368 3300044684 Bacteria 1962
82 Ga0466966_0182886 3300044684 Bacteria 1272
83 Ga0466961_0004796 3300044693 Bacteria 8511
84 Ga0466961_0025044 3300044693 Bacteria 3840
85 Ga0466961_0111747 3300044693 Bacteria 1719
86 Ga0466961_0338522 3300044693 Bacteria 916
87 Ga0466963_0016162 3300044694 Bacteria 4637
88 Ga0466963_0021325 3300044694 Bacteria 4085
89 Ga0466963_0034407 3300044694 Bacteria 3296
90 Ga0466963_0051129 3300044694 Bacteria 2738
91 Ga0466963_0170048 3300044694 Bacteria 1519
92 Ga0466963_0180888 3300044694 Bacteria 1472
93 Ga0466963_0392001 3300044694 Bacteria 979
94 Ga0466963_0603647 3300044694 Bacteria 775
95 Ga0466963_0657339 3300044694 Bacteria 740
96 Ga0466964_0021491 3300044706 Bacteria 2496
97 Ga0466964_0040740 3300044706 Bacteria 1877
98 Ga0466964_0087724 3300044706 Bacteria 1348
99 Ga0453684_0653642 3300044712 Bacteria 1147
100 Ga0466971_0011155 3300044719 Bacteria 3934
101 Ga0466971_0120263 3300044719 Bacteria 1215
102 Ga0466970_0007343 3300044765 Bacteria 5521
103 Ga0466970_0062560 3300044765 Bacteria 1995
104 Ga0466970_0704934 3300044765 Bacteria 589
105 Ga0466957_0079696 3300044842 Bacteria 2038
106 Ga0466957_0665794 3300044842 Bacteria 733
107 Ga0466960_0104364 3300044901 Bacteria 1464
108 Ga0466960_0169966 3300044901 Bacteria 1176
109 Ga0466960_0245295 3300044901 Bacteria 993
110 Ga0466960_0338416 3300044901 Bacteria 856
111 Ga0466959_0136500 3300045049 Bacteria 1736
112 Ga0466959_0148554 3300045049 Bacteria 1653
113 Ga0466959_0217603 3300045049 Bacteria 1326
114 Ga0466959_0436864 3300045049 Bacteria 888
115 Ga0451576_0039384 3300045051 Bacteria 5002
116 Ga0466958_0055564 3300045836 Bacteria 2403
117 Ga0466958_0072160 3300045836 Bacteria 2114
118 Ga0466958_0093178 3300045836 Bacteria 1866
119 Ga0466958_0195947 3300045836 Bacteria 1285
120 Ga0466958_0513970 3300045836 Bacteria 777
121 Ga0466958_0516994 3300045836 Bacteria 775
122 Ga0466958_0548000 3300045836 Bacteria 751
123 Ga0466967_0040358 3300045976 Bacteria 4017
124 Ga0466967_0046918 3300045976 Bacteria 3764
125 Ga0466967_0085741 3300045976 Bacteria 2852
126 Ga0466967_0348311 3300045976 Bacteria 1433
127 Ga0466967_0650313 3300045976 Bacteria 1042
128 Ga0466967_0890237 3300045976 Bacteria 885
129 Ga0466967_1023324 3300045976 Bacteria 823
130 Ga0495664_0337855 3300046477 Bacteria 908
131 Ga0495583_0042913 3300046506 Bacteria 2109
132 Ga0495648_0017009 3300046524 Bacteria 5218
133 Ga0495671_0144218 3300046692 Bacteria 1160
134 Ga0495672_0002514 3300047320 Bacteria 16766
135 Ga0495673_0005853 3300047469 Bacteria 7351
136 Ga0496102_0208181 3300048905 Bacteria 1844
137 Ga0496103_0218651 3300048906 Bacteria 1225
138 Ga0496109_1646761 3300048912 Bacteria 576
139 Ga0496114_0021304 3300048917 Bacteria 5272
140 Ga0496118_0182677 3300048921 Bacteria 1265
141 Ga0496119_0000022 3300048922 Bacteria 269878
142 Ga0496120_0011207 3300048923 Bacteria 6184
143 Ga0501031_0201903 3300049568 Bacteria 1297
144 Ga0501032_0003273 3300049569 Bacteria 12462
145 Ga0501033_0125174 3300049570 Bacteria 1864
146 Ga0501033_0313683 3300049570 Bacteria 1102
147 Ga0501034_0144432 3300049571 Bacteria 2357
148 Ga0501037_0032418 3300049573 Bacteria 3858
149 Ga0501037_0220489 3300049573 Bacteria 1335
150 Ga0501037_0544114 3300049573 Bacteria 784
151 Ga0501038_0001690 3300049574 Bacteria 20451
152 Ga0501038_0306971 3300049574 Bacteria 1244
153 Ga0501039_0115149 3300049575 Bacteria 2104
154 Ga0501043_0008222 3300049579 Bacteria 8221
155 Ga0501047_0003389 3300049581 Bacteria 15085
156 Ga0501047_0444722 3300049581 Bacteria 1126
157 Ga0501048_0002197 3300049582 Bacteria 14837
158 Ga0501067_0317912 3300049583 Bacteria 867
159 Ga0501069_0538901 3300049585 Bacteria 698
160 Ga0501070_0085002 3300049586 Bacteria 2620
161 Ga0501072_0200445 3300049588 Bacteria 1591
162 Ga0501083_0276257 3300049744 Bacteria 1093
163 Ga0501083_0533741 3300049744 Bacteria 764
164 Ga0501035_0007915 3300049822 Bacteria 9925
165 Ga0501035_0130926 3300049822 Bacteria 2187
166 Ga0501044_0018547 3300049823 Bacteria 7456
167 Ga0501044_0690877 3300049823 Bacteria 906
168 nmdc:mga03n38_199428_c1 3300050490 Bacteria 1035
169 nmdc:mga03n38_4240_c1 3300050490 Bacteria 4717
170 nmdc:mga03n38_88879_c1 3300050490 Bacteria 1467
171 nmdc:mga00v17_139660_c1 3300050491 Bacteria 1553
172 nmdc:mga00v17_178601_c1 3300050491 Bacteria 1369
173 nmdc:mga00v17_399014_c1 3300050491 Bacteria 894
174 nmdc:mga00v17_475590_c1 3300050491 Bacteria 811
175 nmdc:mga0yw44_1244774_c1 3300050492 Bacteria 502
176 nmdc:mga0yw44_161781_c1 3300050492 Bacteria 1466
177 nmdc:mga0yw44_180265_c1 3300050492 Bacteria 1390
178 nmdc:mga0yw44_25053_c1 3300050492 Bacteria 3386
179 nmdc:mga0yw44_270569_c1 3300050492 Bacteria 1134
180 nmdc:mga0yw44_29211_c1 3300050492 Bacteria 3181
181 nmdc:mga0yw44_338728_c1 3300050492 Bacteria 1011
182 nmdc:mga0yw44_462818_c1 3300050492 Bacteria 860
183 nmdc:mga0yw44_48237_c1 3300050492 Bacteria 2568
184 nmdc:mga0yw44_550955_c1 3300050492 Bacteria 783
185 nmdc:mga0yw44_934_c1 3300050492 Bacteria 11085
186 nmdc:mga06z11_20938_c1 3300050494 Bacteria 3030
187 nmdc:mga06z11_38396_c1 3300050494 Bacteria 2378
188 nmdc:mga04h51_348050_c1 3300050495 Bacteria 612
189 nmdc:mga04h51_88465_c1 3300050495 Bacteria 1111
190 nmdc:mga07m45_125321_c1 3300050496 Bacteria 1485
191 nmdc:mga07m45_34892_c2 3300050496 Bacteria 2059
192 nmdc:mga07m45_354246_c1 3300050496 Bacteria 853
193 nmdc:mga07m45_786203_c1 3300050496 Bacteria 546
194 nmdc:mga0sz30_13350_c1 3300050516 Bacteria 1638
195 Ga0500643_007882 3300053087 Bacteria 4243
196 Ga0500554_244034 3300053102 Bacteria 593
197 Ga0500573_0216808 3300053140 Bacteria 1006
198 Ga0587066_163739 3300059490 Bacteria 561
199 Ga0587091_219045 3300059511 Bacteria 520
200 Ga0466962_0032277 3300061719 Bacteria 2506
201 Ga0466962_0339496 3300061719 Bacteria 747
202 2902795089 2902792274 Bacteria 7270173
203 2920114734 2920107658 Bacteria 10042636
204 Ga0466961_0009063
205 Ga0070658_10263795
206 Ga0070667_100003678
207 Ga0070667_100084542
208 Ga0070714_100642775
209 Ga0070714_100659108
210 Ga0070710_10180796
211 Ga0070697_100495263
212 Ga0068855_100082836
213 Ga0068856_100242055
214 Ga0068863_100577896
215 Ga0068860_100000237
216 Ga0070717_10159199
217 Ga0075365_10075348
218 Ga0075365_10174009
219 Ga0075365_10252062
220 Ga0075365_10455270
221 Ga0075365_10638629
222 Ga0075368_10252547
223 Ga0075363_100008683
224 Ga0075363_100139176
225 Ga0075363_100215161
226 Ga0075363_100432802
227 Ga0075364_10011385
228 Ga0075364_10017420
229 Ga0075364_10070736
230 Ga0075364_10401958
231 Ga0075367_10029241
232 Ga0075367_10308494
233 Ga0075367_10513612
234 Ga0075367_10631833
235 Ga0075370_10122675
236 Ga0075370_10126027
237 Ga0075430_101421441
238 Ga0105240_10119217
239 Ga0105241_10043075
240 Ga0105237_10040888
241 Ga0105237_10188813
242 Ga0130086_1020701
243 Ga0130084_1083554
244 Ga0105239_10019933
245 Ga0105239_10115444
246 Ga0105239_11102477
247 Ga0157369_10089010
248 Ga0157369_10399223
249 Ga0157378_11377899
250 Ga0157372_10663294
251 Ga0197907_11109665
252 Ga0206353_10130040
253 Ga0207647_10027153
254 Ga0207647_10048955
255 Ga0207654_10012696
256 Ga0207695_10041075
257 Ga0207671_10014808
258 Ga0207671_10062406
259 Ga0207694_10783674
260 Ga0207664_10425122
261 Ga0207664_10698935
262 Ga0207667_10057230
263 Ga0207667_10085139
264 Ga0207658_10020197
265 Ga0207658_10051784
266 Ga0207639_10995098
267 Ga0207702_10257578
268 Ga0207641_10268636
269 Ga0207698_10592077
270 Ga0209813_10312530
271 Ga0268264_10000195
272 Ga0307409_100072672
273 Ga0307409_100172299
274 Ga0307416_100220091
275 Ga0307411_10895460
276 Ga0307415_100024182
277 Ga0307415_100182217
278 Ga0466969_0525749
279 Ga0466972_0023756
280 Ga0466972_0224522
281 Ga0453683_0607251
282 Ga0466965_0041512
283 Ga0466966_0060490
284 Ga0466966_0085368
285 Ga0466966_0182886
286 Ga0466961_0004796
287 Ga0466961_0025044
288 Ga0466961_0111747
289 Ga0466961_0338522
290 Ga0466963_0016162
291 Ga0466963_0021325
292 Ga0466963_0034407
293 Ga0466963_0051129
294 Ga0466963_0170048
295 Ga0466963_0180888
296 Ga0466963_0392001
297 Ga0466963_0603647
298 Ga0466963_0657339
299 Ga0466964_0021491
300 Ga0466964_0040740
301 Ga0466964_0087724
302 Ga0453684_0653642
303 Ga0466971_0011155
304 Ga0466971_0120263
305 Ga0466970_0007343
306 Ga0466970_0062560
307 Ga0466970_0704934
308 Ga0466957_0079696
309 Ga0466957_0665794
310 Ga0466960_0104364
311 Ga0466960_0169966
312 Ga0466960_0245295
313 Ga0466960_0338416
314 Ga0466959_0136500
315 Ga0466959_0148554
316 Ga0466959_0217603
317 Ga0466959_0436864
318 Ga0451576_0039384
319 Ga0466958_0055564
320 Ga0466958_0072160
321 Ga0466958_0093178
322 Ga0466958_0195947
323 Ga0466958_0513970
324 Ga0466958_0516994
325 Ga0466958_0548000
326 Ga0466967_0040358
327 Ga0466967_0046918
328 Ga0466967_0085741
329 Ga0466967_0348311
330 Ga0466967_0650313
331 Ga0466967_0890237
332 Ga0466967_1023324
333 Ga0495664_0337855
334 Ga0495583_0042913
335 Ga0495648_0017009
336 Ga0495671_0144218
337 Ga0495672_0002514
338 Ga0495673_0005853
339 Ga0496102_0208181
340 Ga0496103_0218651
341 Ga0496109_1646761
342 Ga0496114_0021304
343 Ga0496118_0182677
344 Ga0496119_0000022
345 Ga0496120_0011207
346 Ga0501031_0201903
347 Ga0501032_0003273
348 Ga0501033_0125174
349 Ga0501033_0313683
350 Ga0501034_0144432
351 Ga0501037_0032418
352 Ga0501037_0220489
353 Ga0501037_0544114
354 Ga0501038_0001690
355 Ga0501038_0306971
356 Ga0501039_0115149
357 Ga0501043_0008222
358 Ga0501047_0003389
359 Ga0501047_0444722
360 Ga0501048_0002197
361 Ga0501067_0317912
362 Ga0501069_0538901
363 Ga0501070_0085002
364 Ga0501072_0200445
365 Ga0501083_0276257
366 Ga0501083_0533741
367 Ga0501035_0007915
368 Ga0501035_0130926
369 Ga0501044_0018547
370 Ga0501044_0690877
371 nmdc:mga03n38_199428_c1
372 nmdc:mga03n38_4240_c1
373 nmdc:mga03n38_88879_c1
374 nmdc:mga00v17_139660_c1
375 nmdc:mga00v17_178601_c1
376 nmdc:mga00v17_399014_c1
377 nmdc:mga00v17_475590_c1
378 nmdc:mga0yw44_1244774_c1
379 nmdc:mga0yw44_161781_c1
380 nmdc:mga0yw44_180265_c1
381 nmdc:mga0yw44_25053_c1
382 nmdc:mga0yw44_270569_c1
383 nmdc:mga0yw44_29211_c1
384 nmdc:mga0yw44_338728_c1
385 nmdc:mga0yw44_462818_c1
386 nmdc:mga0yw44_48237_c1
387 nmdc:mga0yw44_550955_c1
388 nmdc:mga0yw44_934_c1
389 nmdc:mga06z11_20938_c1
390 nmdc:mga06z11_38396_c1
391 nmdc:mga04h51_348050_c1
392 nmdc:mga04h51_88465_c1
393 nmdc:mga07m45_125321_c1
394 nmdc:mga07m45_34892_c2
395 nmdc:mga07m45_354246_c1
396 nmdc:mga07m45_786203_c1
397 nmdc:mga0sz30_13350_c1
398 Ga0500643_007882
399 Ga0500554_244034
400 Ga0500573_0216808
401 Ga0587066_163739
402 Ga0587091_219045
403 Ga0466962_0032277
404 Ga0466962_0339496
405 2902795089
406 2920114734

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

14

130

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1k68-assembly1.cif.gz_B crystal structure of the phosphorylated cyanobacterial phytochrome response regulator rcpa 0.9654 10 148
1k68-assembly1.cif.gz_B crystal structure of the phosphorylated cyanobacterial phytochrome response regulator rcpa 0.952 10 148
1jlk-assembly1.cif.gz_B crystal structure of the mn(2+)-bound form of response regulator rcp1 0.9491 12 148
1jlk-assembly1.cif.gz_B crystal structure of the mn(2+)-bound form of response regulator rcp1 0.9296 12 148
1k66-assembly1.cif.gz_B crystal structure of the cyanobacterial phytochrome response regulator, rcpb 0.9276 4 147
ID Description Score Start End Superfamily
1jlkA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9694 10 148 3.40.50.2300
1jlkA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9494 10 148 3.40.50.2300
af_P0AFJ5_1_84_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9315 10 100 3.40.50.2300
1k66B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9276 4 147 3.40.50.2300
4zylA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9185 12 149 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A1C6W4V8-F1-model_v4 Response regulator receiver domain-containing protein 0.9942 12 148 GO:0000160
AF-A0A0W8FGC1-F1-model_v4 Two-component system response regulator 0.9927 37 149 GO:0000160
AF-A0A850JKB0-F1-model_v4 Response regulator 0.9917 10 148 GO:0000160
AF-A0A2R6K300-F1-model_v4 Response regulatory domain-containing protein 0.9915 11 148 GO:0000160
AF-A0A1Q9TTS2-F1-model_v4 Two-component system response regulator 0.9914 10 149 GO:0000160

Map