F311154

General Info

Members Datasets Scaffolds Average Seq Length
203 167 201 384

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10128159|Ga0111539_101281592
Length 415
Sequence VNVDSRRTIHDQAFEGNTMKQLKIPAVFMRGGTSNAVVFHAKDLPQDRAQWDEIFLAAIGSPDPYGRQLDGMGGGVSSLSKVCVVGPSSRPDADIDYTFAQVQVKEAKVDYGANCGNMSSAMGPFAVDEGLVKASGNEALVKVHNTNTKKLIWSRFPLDDGLSAVDGDLAIPGVAGTGAPVKLEFREPGGATTGKLLPTGNVADVLDVPGVGKIRVSMVDAANACVFVRAADLGIKGTELPEEIEANPVLLKKLAAIRVAASVAMGIAKTPEEAAKRATVPFVGFISAPQEAKTLTGETLKEAGMDLTGRMMSSGQPHRALPLTCTLCMAVAARLEGSVVHEATRPGGNPEAEIRIAMPSGVLTVAASVRKLEGQWHAEQGAFYRTQRRMFEGHVVVRASRVPALAVAAGKRRAI

Samples

Sample ID Description Type Environment
1 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
2 2902330777 Methylobacterium sp. 2A Isolate Unclassified
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
85 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
87 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
88 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
89 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
90 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
93 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
94 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
98 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
102 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
103 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
104 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
105 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
111 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
112 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
113 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
114 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
115 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
116 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
117 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
118 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
119 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
120 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
121 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
122 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
123 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
124 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
125 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
126 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
127 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
128 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
129 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
130 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
131 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
132 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
133 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
134 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
135 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
136 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
137 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
138 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
139 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
140 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
141 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
142 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
143 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
148 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
149 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
155 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
156 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
159 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
160 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
161 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
162 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
165 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
166 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
167 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.54
Metatranscriptomes 1.48
Isolates 0.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.96
Nodule 0
Rhizoplane 1.48
Rhizosphere 85.71
Stem 0
Stem Tuber 0
Unclassified 9.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100030971 3300005331 Bacteria 4607
2 Ga0070680_100020575 3300005336 Bacteria 5239
3 Ga0070661_100026344 3300005344 Unclassified 4181
4 Ga0070668_100028988 3300005347 Bacteria 4203
5 Ga0070675_100111689 3300005354 Bacteria 2313
6 Ga0070671_100072650 3300005355 Bacteria 2873
7 Ga0070673_100277734 3300005364 Bacteria 1468
8 Ga0070688_100063460 3300005365 Bacteria 2341
9 Ga0070713_100036175 3300005436 Bacteria 3982
10 Ga0070713_100166850 3300005436 Bacteria 1969
11 Ga0070701_10026543 3300005438 Unclassified 2825
12 Ga0070694_100053731 3300005444 Bacteria 2727
13 Ga0070708_100123372 3300005445 Bacteria 2392
14 Ga0070662_100080682 3300005457 Unclassified 2422
15 Ga0070681_10004772 3300005458 Bacteria 12989
16 Ga0070706_100017053 3300005467 Bacteria 6708
17 Ga0070679_100022009 3300005530 Bacteria 6227
18 Ga0070679_100033869 3300005530 Bacteria 5059
19 Ga0070684_100003486 3300005535 Bacteria 11813
20 Ga0070697_100095342 3300005536 Bacteria 2467
21 Ga0070672_100038978 3300005543 Unclassified 3635
22 Ga0070704_100007050 3300005549 Bacteria 6669
23 Ga0068857_100080866 3300005577 Bacteria 2901
24 Ga0068854_100153759 3300005578 Bacteria 1776
25 Ga0068856_100020512 3300005614 Bacteria 6419
26 Ga0068856_100086659 3300005614 Bacteria 3112
27 Ga0068856_100165146 3300005614 Bacteria 2225
28 Ga0068864_100074949 3300005618 Unclassified 2953
29 Ga0068864_100111677 3300005618 Bacteria 2435
30 Ga0068851_10021846 3300005834 Bacteria 3110
31 Ga0068863_100138755 3300005841 Bacteria 2323
32 Ga0068858_100007860 3300005842 Bacteria 10279
33 Ga0068862_100014691 3300005844 Bacteria 6503
34 Ga0075365_10001585 3300006038 Bacteria 10457
35 Ga0075364_10086730 3300006051 Unclassified 2074
36 Ga0075364_10155711 3300006051 Bacteria 1541
37 Ga0097621_100037922 3300006237 Bacteria 3866
38 Ga0068871_100041898 3300006358 Bacteria 3673
39 Ga0075428_100003302 3300006844 Bacteria 17652
40 Ga0075430_100017972 3300006846 Bacteria 6019
41 Ga0075431_100016252 3300006847 Bacteria 7550
42 Ga0075431_100019085 3300006847 Bacteria 6985
43 Ga0075431_100196739 3300006847 Bacteria 2064
44 Ga0111539_10000589 3300009094 Bacteria 46837
45 Ga0111539_10128159 3300009094 Bacteria 2972
46 Ga0114129_10406669 3300009147 Bacteria 1793
47 Ga0105243_10051519 3300009148 Unclassified 3256
48 Ga0105248_10310531 3300009177 Bacteria 1776
49 Ga0105237_10204047 3300009545 Bacteria 1977
50 Ga0105249_10006821 3300009553 Bacteria 9956
51 Ga0157369_10014227 3300013105 Bacteria 8989
52 Ga0171462_1022 3300013250 Bacteria 141292
53 Ga0157374_10060965 3300013296 Bacteria 3532
54 Ga0163162_10286474 3300013306 Bacteria 1779
55 Ga0157372_10037423 3300013307 Bacteria 5353
56 Ga0157375_10125520 3300013308 Unclassified 2681
57 Ga0163163_10059178 3300014325 Bacteria 3789
58 Ga0157380_10209309 3300014326 Bacteria 1736
59 Ga0157379_10027333 3300014968 Bacteria 5080
60 Ga0157376_10161116 3300014969 Bacteria 2034
61 Ga0157376_10237086 3300014969 Bacteria 1698
62 Ga0207697_10005071 3300025315 Bacteria 6169
63 Ga0207682_10001762 3300025893 Bacteria 9938
64 Ga0207688_10012038 3300025901 Bacteria 4706
65 Ga0207643_10015147 3300025908 Bacteria 4194
66 Ga0207684_10036955 3300025910 Bacteria 4146
67 Ga0207707_10059711 3300025912 Bacteria 3318
68 Ga0207662_10000460 3300025918 Bacteria 18119
69 Ga0207652_10028932 3300025921 Bacteria 4626
70 Ga0207652_10029780 3300025921 Bacteria 4568
71 Ga0207650_10004713 3300025925 Bacteria 9318
72 Ga0207687_10007496 3300025927 Bacteria 7175
73 Ga0207700_10341171 3300025928 Bacteria 1303
74 Ga0207706_10003647 3300025933 Bacteria 14710
75 Ga0207670_10041178 3300025936 Unclassified 3036
76 Ga0207691_10005400 3300025940 Bacteria 12340
77 Ga0207689_10314878 3300025942 Bacteria 1298
78 Ga0207679_10013268 3300025945 Bacteria 5400
79 Ga0207679_10107478 3300025945 Bacteria 2195
80 Ga0207651_10279427 3300025960 Bacteria 1379
81 Ga0207712_10103173 3300025961 Bacteria 2125
82 Ga0207640_10150611 3300025981 Bacteria 1709
83 Ga0207658_10178104 3300025986 Bacteria 1757
84 Ga0207677_10137979 3300026023 Bacteria 1862
85 Ga0207703_10232546 3300026035 Bacteria 1653
86 Ga0207708_10002167 3300026075 Bacteria 14493
87 Ga0207702_10021023 3300026078 Bacteria 5400
88 Ga0207641_10081177 3300026088 Unclassified 2816
89 Ga0207676_10007676 3300026095 Bacteria 7660
90 Ga0207676_10035402 3300026095 Unclassified 3789
91 Ga0207674_10054267 3300026116 Bacteria 4080
92 Ga0207674_10077147 3300026116 Bacteria 3338
93 Ga0207683_10035319 3300026121 Bacteria 4346
94 Ga0207683_10046013 3300026121 Unclassified 3817
95 Ga0207683_10242789 3300026121 Bacteria 1643
96 Ga0207698_10051303 3300026142 Bacteria 3153
97 Ga0209974_10003726 3300027876 Bacteria 5469
98 Ga0207428_10018684 3300027907 Bacteria 5917
99 Ga0268265_10244882 3300028380 Bacteria 1584
100 Ga0265330_10009360 3300031235 Bacteria 4658
101 Ga0265332_10017461 3300031238 Bacteria 3167
102 Ga0265328_10002045 3300031239 Bacteria 9119
103 Ga0265329_10003912 3300031242 Bacteria 6373
104 Ga0265316_10042066 3300031344 Bacteria 3653
105 Ga0307408_100113278 3300031548 Bacteria 2088
106 Ga0307408_100165923 3300031548 Bacteria 1759
107 Ga0265314_10002102 3300031711 Bacteria 20958
108 Ga0265342_10122604 3300031712 Bacteria 1462
109 Ga0316576_10018834 3300031727 Bacteria 4721
110 Ga0307410_10043612 3300031852 Unclassified 2974
111 Ga0307416_100057445 3300032002 Bacteria 3148
112 Ga0307411_10069865 3300032005 Unclassified 2374
113 Ga0316592_1020702 3300033524 Bacteria 1398
114 Ga0316588_1018065 3300033528 Bacteria 1576
115 Ga0316596_1020966 3300033541 Bacteria 1664
116 Ga0373953_0020785 3300035117 Bacteria 2456
117 Ga0373954_0012399 3300035118 Bacteria 3790
118 Ga0373955_0184089 3300035172 Bacteria 1240
119 Ga0373927_0123747 3300035695 Bacteria 1688
120 Ga0373933_0125534 3300035724 Bacteria 1610
121 Ga0373937_0003462 3300036401 Bacteria 13264
122 Ga0316584_0151849 3300036712 Bacteria 1724
123 Ga0373925_0016887 3300037068 Bacteria 5284
124 Ga0395900_0249270 3300037418 Bacteria 1778
125 Ga0400484_40815 3300038725 Unclassified 3149
126 Ga0400484_41297 3300038725 Unclassified 2496
127 Ga0400490_20836 3300038726 Unclassified 2263
128 Ga0400490_29230 3300038726 Bacteria 2931
129 Ga0400490_52536 3300038726 Bacteria 18575
130 Ga0400490_56074 3300038726 Bacteria 16677
131 Ga0400490_57299 3300038726 Bacteria 4937
132 Ga0400488_20156 3300038741 Bacteria 21785
133 Ga0400488_46782 3300038741 Bacteria 4255
134 Ga0400486_32929 3300038742 Bacteria 6361
135 Ga0400489_10337 3300039093 Bacteria 52043
136 Ga0400489_84177 3300039093 Bacteria 2953
137 Ga0400487_50236 3300039110 Bacteria 22343
138 Ga0400487_53519 3300039110 Bacteria 1770
139 Ga0436361_0495328 3300039447 Bacteria 2099
140 Ga0451853_2507565 3300041512 Bacteria 1941
141 Ga0439464_0037943 3300042439 Bacteria 1368
142 Ga0453684_0467524 3300044712 Bacteria 1401
143 Ga0466960_0095820 3300044901 Bacteria 1520
144 Ga0466967_0393156 3300045976 Bacteria 1348
145 Ga0495592_0155908 3300046454 Bacteria 1575
146 Ga0495638_0007973 3300046460 Bacteria 7553
147 Ga0495651_0005876 3300046462 Bacteria 9359
148 Ga0495653_0119228 3300046463 Bacteria 1884
149 Ga0495605_0049304 3300046474 Bacteria 2058
150 Ga0495664_0000942 3300046477 Bacteria 14982
151 Ga0495608_0019021 3300046511 Bacteria 4733
152 Ga0495608_0020316 3300046511 Bacteria 4565
153 Ga0495642_0016859 3300046528 Bacteria 2850
154 Ga0495642_0032309 3300046528 Bacteria 2100
155 Ga0495652_0221321 3300046529 Bacteria 1422
156 Ga0495587_0003128 3300046536 Bacteria 11069
157 Ga0495667_0005507 3300046559 Bacteria 8556
158 Ga0495667_0146218 3300046559 Bacteria 1522
159 Ga0495635_0123054 3300046663 Bacteria 1769
160 Ga0495657_0072600 3300046675 Bacteria 2244
161 Ga0495599_0136153 3300046678 Bacteria 1524
162 Ga0495646_0010505 3300046680 Bacteria 5881
163 Ga0495658_0084760 3300046683 Bacteria 1866
164 Ga0495604_0103540 3300047317 Bacteria 2088
165 Ga0495674_0012366 3300047319 Bacteria 8040
166 Ga0495680_0032073 3300047322 Bacteria 4269
167 Ga0495680_0042479 3300047322 Bacteria 3607
168 Ga0495675_0026647 3300047444 Bacteria 3686
169 Ga0495675_0030961 3300047444 Bacteria 3415
170 Ga0495684_0164259 3300047471 Bacteria 1655
171 Ga0495602_0013919 3300048088 Bacteria 8197
172 Ga0495602_0114315 3300048088 Bacteria 2186
173 Ga0496110_0000210 3300048913 Bacteria 37459
174 Ga0496111_0227606 3300048914 Bacteria 1385
175 Ga0496112_0021880 3300048915 Bacteria 6085
176 Ga0496121_0011348 3300048924 Bacteria 9906
177 Ga0496121_0012654 3300048924 Bacteria 9165
178 Ga0496124_0000005 3300048927 Bacteria 922323
179 Ga0496126_0015210 3300048929 Bacteria 7748
180 Ga0501034_0000119 3300049571 Bacteria 144440
181 Ga0501034_0000243 3300049571 Bacteria 100637
182 Ga0501036_0125495 3300049572 Bacteria 2168
183 Ga0501041_0013121 3300049577 Bacteria 4909
184 Ga0501047_0263758 3300049581 Bacteria 1570
185 Ga0501070_0011336 3300049586 Bacteria 7533
186 Ga0501070_0158722 3300049586 Bacteria 1865
187 Ga0501071_0223965 3300049587 Bacteria 1416
188 Ga0501072_0223125 3300049588 Bacteria 1502
189 Ga0501080_0088981 3300049742 Bacteria 2868
190 Ga0501081_0093901 3300049743 Bacteria 2113
191 nmdc:mga00v17_145650_c1 3300050491 Unclassified 1520
192 nmdc:mga00v17_196865_c1 3300050491 Bacteria 1302
193 nmdc:mga0yw44_197_c1 3300050492 Bacteria 21340
194 nmdc:mga0qj67_7313_c1 3300050509 Bacteria 8161
195 nmdc:mga06r32_24858_c1 3300050510 Bacteria 5566
196 nmdc:mga06r32_40196_c1 3300050510 Bacteria 4439
197 nmdc:mga08y16_157849_c1 3300050511 Bacteria 2357
198 Ga0495601_0001533 3300053077 Bacteria 12756
199 Ga0495612_0001037 3300053078 Bacteria 11385
200 Ga0495619_0006193 3300053085 Bacteria 7580
201 Ga0501084_0051153 3300054114 Bacteria 3458

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048929 Ga0496126_0015210 Ga0496126_0015210_4172_5158 318
2 3300049581 Ga0501047_0263758 Ga0501047_0263758_41_1075 334
3 3300049571 Ga0501034_0000243 Ga0501034_0000243_50714_51865 348
4 3300047471 Ga0495684_0164259 Ga0495684_0164259_23_1105 349
5 3300031548 Ga0307408_100113278 Ga0307408_1001132782 352
6 3300047322 Ga0495680_0032073 Ga0495680_0032073_1901_2965 352
7 3300009147 Ga0114129_10406669 Ga0114129_104066691 355
8 3300048913 Ga0496110_0000210 Ga0496110_0000210_2362_3471 356
9 3300048914 Ga0496111_0227606 Ga0496111_0227606_249_1358 356
10 3300048927 Ga0496124_0000005 Ga0496124_0000005_48880_49989 356
11 3300035695 Ga0373927_0123747 Ga0373927_0123747_561_1670 358
12 3300042439 Ga0439464_0037943 Ga0439464_0037943_188_1345 359
13 3300044712 Ga0453684_0467524 Ga0453684_0467524_29_1138 359
14 3300046460 Ga0495638_0007973 Ga0495638_0007973_482_1612 359
15 3300013250 Ga0171462_1022 Ga0171462_102210 360
16 3300049571 Ga0501034_0000119 Ga0501034_0000119_28293_29417 361
17 3300050509 nmdc:mga0qj67_7313_c1 nmdc:mga0qj67_7313_c1_6740_7867 361
18 3300050491 nmdc:mga00v17_196865_c1 nmdc:mga00v17_196865_c1_168_1286 362
19 3300049588 Ga0501072_0223125 Ga0501072_0223125_127_1371 363
20 3300006846 Ga0075430_100017972 Ga0075430_1000179725 364
21 3300006847 Ga0075431_100016252 Ga0075431_1000162527 364
22 3300033528 Ga0316588_1018065 Ga0316588_10180651 364
23 3300005614 Ga0068856_100020512 Ga0068856_1000205122 365
24 3300026078 Ga0207702_10021023 Ga0207702_100210232 365
25 3300038741 Ga0400488_20156 Ga0400488_20156_17257_18387 365
26 3300054114 Ga0501084_0051153 Ga0501084_0051153_1090_2220 365
27 3300006038 Ga0075365_10001585 Ga0075365_100015852 366
28 3300006051 Ga0075364_10086730 Ga0075364_100867302 366
29 3300038725 Ga0400484_41297 Ga0400484_41297_331_1464 366
30 3300038741 Ga0400488_46782 Ga0400488_46782_2205_3338 366
31 3300050491 nmdc:mga00v17_145650_c1 nmdc:mga00v17_145650_c1_235_1395 366
32 3300050492 nmdc:mga0yw44_197_c1 nmdc:mga0yw44_197_c1_7837_8997 366
33 3300005436 Ga0070713_100036175 Ga0070713_1000361752 368
34 3300005436 Ga0070713_100166850 Ga0070713_1001668502 368
35 3300005614 Ga0068856_100086659 Ga0068856_1000866592 368
36 3300005614 Ga0068856_100165146 Ga0068856_1001651462 368
37 3300006847 Ga0075431_100196739 Ga0075431_1001967391 368
38 3300014969 Ga0157376_10161116 Ga0157376_101611162 368
39 3300025928 Ga0207700_10341171 Ga0207700_103411711 368
40 3300035117 Ga0373953_0020785 Ga0373953_0020785_1123_2262 368
41 3300035118 Ga0373954_0012399 Ga0373954_0012399_219_1358 368
42 3300035172 Ga0373955_0184089 Ga0373955_0184089_27_1166 368
43 3300035724 Ga0373933_0125534 Ga0373933_0125534_366_1505 368
44 3300036401 Ga0373937_0003462 Ga0373937_0003462_1772_2911 368
45 3300037068 Ga0373925_0016887 Ga0373925_0016887_862_2001 368
46 3300039447 Ga0436361_0495328 Ga0436361_0495328_209_1345 368
47 3300045976 Ga0466967_0393156 Ga0466967_0393156_147_1283 368
48 3300046454 Ga0495592_0155908 Ga0495592_0155908_403_1542 368
49 3300046462 Ga0495651_0005876 Ga0495651_0005876_5741_6880 368
50 3300046463 Ga0495653_0119228 Ga0495653_0119228_24_1163 368
51 3300046477 Ga0495664_0000942 Ga0495664_0000942_10103_11242 368
52 3300046511 Ga0495608_0019021 Ga0495608_0019021_2206_3345 368
53 3300046511 Ga0495608_0020316 Ga0495608_0020316_726_1865 368
54 3300046529 Ga0495652_0221321 Ga0495652_0221321_216_1355 368
55 3300046536 Ga0495587_0003128 Ga0495587_0003128_3439_4578 368
56 3300046559 Ga0495667_0005507 Ga0495667_0005507_5845_6984 368
57 3300046559 Ga0495667_0146218 Ga0495667_0146218_107_1246 368
58 3300046663 Ga0495635_0123054 Ga0495635_0123054_176_1315 368
59 3300046675 Ga0495657_0072600 Ga0495657_0072600_95_1234 368
60 3300046678 Ga0495599_0136153 Ga0495599_0136153_48_1187 368
61 3300046680 Ga0495646_0010505 Ga0495646_0010505_1677_2816 368
62 3300046683 Ga0495658_0084760 Ga0495658_0084760_16_1155 368
63 3300047317 Ga0495604_0103540 Ga0495604_0103540_446_1585 368
64 3300047319 Ga0495674_0012366 Ga0495674_0012366_1558_2697 368
65 3300047322 Ga0495680_0042479 Ga0495680_0042479_1568_2707 368
66 3300047444 Ga0495675_0026647 Ga0495675_0026647_26_1165 368
67 3300047444 Ga0495675_0030961 Ga0495675_0030961_64_1203 368
68 3300048088 Ga0495602_0013919 Ga0495602_0013919_3557_4696 368
69 3300048088 Ga0495602_0114315 Ga0495602_0114315_516_1655 368
70 3300049586 Ga0501070_0158722 Ga0501070_0158722_545_1696 368
71 3300050510 nmdc:mga06r32_24858_c1 nmdc:mga06r32_24858_c1_2073_3215 368
72 3300053077 Ga0495601_0001533 Ga0495601_0001533_2731_3870 368
73 3300053078 Ga0495612_0001037 Ga0495612_0001037_3907_5046 368
74 3300053085 Ga0495619_0006193 Ga0495619_0006193_4643_5782 368
75 3300026121 Ga0207683_10242789 Ga0207683_102427892 369
76 3300005336 Ga0070680_100020575 Ga0070680_1000205755 371
77 3300005530 Ga0070679_100022009 Ga0070679_1000220095 371
78 3300005535 Ga0070684_100003486 Ga0070684_1000034865 371
79 3300005577 Ga0068857_100080866 Ga0068857_1000808662 371
80 3300009545 Ga0105237_10204047 Ga0105237_102040473 371
81 3300013105 Ga0157369_10014227 Ga0157369_100142273 371
82 3300013307 Ga0157372_10037423 Ga0157372_100374232 371
83 3300025921 Ga0207652_10028932 Ga0207652_100289323 371
84 3300026116 Ga0207674_10054267 Ga0207674_100542674 371
85 3300038726 Ga0400490_57299 Ga0400490_57299_3122_4282 371
86 3300048924 Ga0496121_0011348 Ga0496121_0011348_7406_8551 371
87 3300006051 Ga0075364_10155711 Ga0075364_101557112 372
88 3300031548 Ga0307408_100165923 Ga0307408_1001659232 372
89 3300038726 Ga0400490_20836 Ga0400490_20836_369_1520 372
90 3300038742 Ga0400486_32929 Ga0400486_32929_1941_3092 372
91 3300039110 Ga0400487_50236 Ga0400487_50236_13363_14514 372
92 iso_pu_bacteria 2889306138 2889308573 372
93 iso_pu_bacteria 2902330777 2902331160 372
94 3300005445 Ga0070708_100123372 Ga0070708_1001233722 373
95 3300005530 Ga0070679_100033869 Ga0070679_1000338694 373
96 3300025921 Ga0207652_10029780 Ga0207652_100297803 373
97 3300031727 Ga0316576_10018834 Ga0316576_100188342 373
98 3300033524 Ga0316592_1020702 Ga0316592_10207021 373
99 3300033541 Ga0316596_1020966 Ga0316596_10209662 373
100 3300038726 Ga0400490_52536 Ga0400490_52536_2832_3986 373
101 3300038726 Ga0400490_56074 Ga0400490_56074_10593_11747 373
102 3300036712 Ga0316584_0151849 Ga0316584_0151849_472_1644 374
103 3300037418 Ga0395900_0249270 Ga0395900_0249270_376_1542 374
104 3300039110 Ga0400487_53519 Ga0400487_53519_54_1223 374
105 3300044901 Ga0466960_0095820 Ga0466960_0095820_135_1301 374
106 3300046474 Ga0495605_0049304 Ga0495605_0049304_563_1762 374
107 3300048924 Ga0496121_0012654 Ga0496121_0012654_7725_8933 374
108 3300005458 Ga0070681_10004772 Ga0070681_1000477211 375
109 3300005467 Ga0070706_100017053 Ga0070706_1000170533 375
110 3300005536 Ga0070697_100095342 Ga0070697_1000953422 375
111 3300025910 Ga0207684_10036955 Ga0207684_100369552 375
112 3300025912 Ga0207707_10059711 Ga0207707_100597113 375
113 3300038726 Ga0400490_29230 Ga0400490_29230_97_1269 375
114 3300039093 Ga0400489_84177 Ga0400489_84177_782_1942 375
115 3300048915 Ga0496112_0021880 Ga0496112_0021880_3394_4590 375
116 3300031235 Ga0265330_10009360 Ga0265330_100093603 376
117 3300031238 Ga0265332_10017461 Ga0265332_100174612 376
118 3300031239 Ga0265328_10002045 Ga0265328_100020457 376
119 3300031242 Ga0265329_10003912 Ga0265329_100039125 376
120 3300031344 Ga0265316_10042066 Ga0265316_100420663 376
121 3300031711 Ga0265314_10002102 Ga0265314_1000210215 376
122 3300031712 Ga0265342_10122604 Ga0265342_101226042 376
123 3300039093 Ga0400489_10337 Ga0400489_10337_39487_40665 376
124 3300046528 Ga0495642_0032309 Ga0495642_0032309_472_1668 376
125 3300005364 Ga0070673_100277734 Ga0070673_1002777341 378
126 3300031852 Ga0307410_10043612 Ga0307410_100436122 378
127 3300032005 Ga0307411_10069865 Ga0307411_100698652 378
128 3300050510 nmdc:mga06r32_40196_c1 nmdc:mga06r32_40196_c1_2148_3320 378
129 3300006844 Ga0075428_100003302 Ga0075428_10000330212 380
130 3300009094 Ga0111539_10000589 Ga0111539_1000058928 380
131 3300027907 Ga0207428_10018684 Ga0207428_100186842 380
132 3300038725 Ga0400484_40815 Ga0400484_40815_889_2085 380
133 3300014968 Ga0157379_10027333 Ga0157379_100273334 385
134 3300005543 Ga0070672_100038978 Ga0070672_1000389782 386
135 3300013296 Ga0157374_10060965 Ga0157374_100609652 386
136 3300013308 Ga0157375_10125520 Ga0157375_101255202 386
137 3300025940 Ga0207691_10005400 Ga0207691_100054005 386
138 3300026142 Ga0207698_10051303 Ga0207698_100513032 386
139 3300009094 Ga0111539_10128159 Ga0111539_101281592 387
140 3300005331 Ga0070670_100030971 Ga0070670_1000309714 388
141 3300005344 Ga0070661_100026344 Ga0070661_1000263444 388
142 3300005347 Ga0070668_100028988 Ga0070668_1000289884 388
143 3300005354 Ga0070675_100111689 Ga0070675_1001116892 388
144 3300005355 Ga0070671_100072650 Ga0070671_1000726502 388
145 3300005365 Ga0070688_100063460 Ga0070688_1000634601 388
146 3300005438 Ga0070701_10026543 Ga0070701_100265432 388
147 3300005444 Ga0070694_100053731 Ga0070694_1000537312 388
148 3300005457 Ga0070662_100080682 Ga0070662_1000806822 388
149 3300005549 Ga0070704_100007050 Ga0070704_1000070502 388
150 3300005578 Ga0068854_100153759 Ga0068854_1001537592 388
151 3300005618 Ga0068864_100074949 Ga0068864_1000749493 388
152 3300005618 Ga0068864_100111677 Ga0068864_1001116772 388
153 3300005834 Ga0068851_10021846 Ga0068851_100218461 388
154 3300005841 Ga0068863_100138755 Ga0068863_1001387551 388
155 3300005842 Ga0068858_100007860 Ga0068858_1000078603 388
156 3300005844 Ga0068862_100014691 Ga0068862_1000146915 388
157 3300006237 Ga0097621_100037922 Ga0097621_1000379223 388
158 3300006358 Ga0068871_100041898 Ga0068871_1000418983 388
159 3300006847 Ga0075431_100019085 Ga0075431_1000190856 388
160 3300009148 Ga0105243_10051519 Ga0105243_100515192 388
161 3300009177 Ga0105248_10310531 Ga0105248_103105312 388
162 3300009553 Ga0105249_10006821 Ga0105249_100068219 388
163 3300013306 Ga0163162_10286474 Ga0163162_102864742 388
164 3300014325 Ga0163163_10059178 Ga0163163_100591784 388
165 3300014326 Ga0157380_10209309 Ga0157380_102093092 388
166 3300014969 Ga0157376_10237086 Ga0157376_102370862 388
167 3300025315 Ga0207697_10005071 Ga0207697_100050715 388
168 3300025893 Ga0207682_10001762 Ga0207682_100017626 388
169 3300025901 Ga0207688_10012038 Ga0207688_100120384 388
170 3300025908 Ga0207643_10015147 Ga0207643_100151473 388
171 3300025918 Ga0207662_10000460 Ga0207662_1000046011 388
172 3300025925 Ga0207650_10004713 Ga0207650_100047137 388
173 3300025927 Ga0207687_10007496 Ga0207687_100074962 388
174 3300025933 Ga0207706_10003647 Ga0207706_100036473 388
175 3300025936 Ga0207670_10041178 Ga0207670_100411783 388
176 3300025942 Ga0207689_10314878 Ga0207689_103148781 388
177 3300025945 Ga0207679_10013268 Ga0207679_100132682 388
178 3300025945 Ga0207679_10107478 Ga0207679_101074782 388
179 3300025960 Ga0207651_10279427 Ga0207651_102794271 388
180 3300025961 Ga0207712_10103173 Ga0207712_101031732 388
181 3300025981 Ga0207640_10150611 Ga0207640_101506112 388
182 3300025986 Ga0207658_10178104 Ga0207658_101781041 388
183 3300026023 Ga0207677_10137979 Ga0207677_101379792 388
184 3300026035 Ga0207703_10232546 Ga0207703_102325462 388
185 3300026075 Ga0207708_10002167 Ga0207708_100021673 388
186 3300026088 Ga0207641_10081177 Ga0207641_100811772 388
187 3300026095 Ga0207676_10007676 Ga0207676_100076765 388
188 3300026095 Ga0207676_10035402 Ga0207676_100354023 388
189 3300026116 Ga0207674_10077147 Ga0207674_100771472 388
190 3300026121 Ga0207683_10035319 Ga0207683_100353194 388
191 3300026121 Ga0207683_10046013 Ga0207683_100460133 388
192 3300027876 Ga0209974_10003726 Ga0209974_100037264 388
193 3300028380 Ga0268265_10244882 Ga0268265_102448822 388
194 3300032002 Ga0307416_100057445 Ga0307416_1000574452 388
195 3300041512 Ga0451853_2507565 Ga0451853_2507565_56_1252 388
196 3300046528 Ga0495642_0016859 Ga0495642_0016859_426_1622 388
197 3300049572 Ga0501036_0125495 Ga0501036_0125495_825_2024 388
198 3300049577 Ga0501041_0013121 Ga0501041_0013121_1130_2329 388
199 3300049586 Ga0501070_0011336 Ga0501070_0011336_3622_4827 388
200 3300049587 Ga0501071_0223965 Ga0501071_0223965_145_1344 388
201 3300049742 Ga0501080_0088981 Ga0501080_0088981_1472_2671 388
202 3300049743 Ga0501081_0093901 Ga0501081_0093901_176_1375 388
203 3300050511 nmdc:mga08y16_157849_c1 nmdc:mga08y16_157849_c1_299_1495 388

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04303

PrpF

PrpF protein

21

398

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5k87-assembly1.cif.gz_A crystal structure of malonate bound to methylaconitate isomerase prpf from shewanella oneidensis 0.921 3 369
5k87-assembly1.cif.gz_B crystal structure of malonate bound to methylaconitate isomerase prpf from shewanella oneidensis 0.9183 3 370
2pvz-assembly1.cif.gz_B crystal structure of methylaconitate isomerase prpf from shewanella oneidensis 0.9159 3 369
2pw0-assembly1.cif.gz_A crystal structure of trans-aconitate bound to methylaconitate isomerase prpf from shewanella oneidensis 0.9069 3 369
6p3h-assembly1.cif.gz_A crystal structure of ligu(k66m) bound to substrate 0.9061 4 370
ID Description Score Start End Superfamily
3g7kB02 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.964 166 343 3.10.310.10
2h9fA02 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9478 166 350 3.10.310.10
3g7kB02 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9432 166 343 3.10.310.10
2pw0B02 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9293 168 348 3.10.310.10
2h9fA02 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9132 166 350 3.10.310.10
ID Description Score Start End GO Terms
AF-A0A0B7KQD7-F1-model_v4 PrpF protein 0.9985 6 101 GO:0016853
AF-A0A2E8VW72-F1-model_v4 PrpF family protein 0.9984 1 86 GO:0016853
AF-A0A2E8VW72-F1-model_v4 PrpF family protein 0.9869 1 86 GO:0016853
AF-A0A7S1HJN4-F1-model_v4 Uncharacterized protein 0.9837 188 298 GO:0016853
AF-A0A2X2E079-F1-model_v4 deleted 0.9823 50 111

Feature Viewer

pLDDT pTM Quality
91.64 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map