F310988

General Info

Members Datasets Scaffolds Average Seq Length
203 149 406 320

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100052953|Ga0068855_1000529532
Length 368
Sequence VGPAPAVAAVRSAVRAVLSSHPVVLVACSGGADSLALAAAVAFEAPRAGVRAGLVTVDHGLQAGSSVIAARVAALGYELGFDPVKIVPVTVGTSGGLEAAARAARYEALDAAAFALDAAVLLGHTLDDQAETVLLGLGRGSGPRSVAGMRVVDGRYLRPLLGLRRSVTAAACAALGLEPWDDPHNTDPAFQRARIRGEVLPLLEDVLQGGVVEALARTATLLQDDLDALDAWAAASSPVINSPVATPEGGHGRVDHSDAGREGAVGHADPSPAAGREEGDGGTTAVLDVAGLAELPRAVRSRVLRAWASAAGADPLTAERTAALESLVTAWRGQAPIQLSGGVSVRRVSGRLVLESGAGERAQSIGEP

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
41 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
42 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
63 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
64 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
65 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
66 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
67 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
68 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
69 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
70 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
71 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
72 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
73 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
74 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
75 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
76 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
77 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
78 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
79 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
80 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
83 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
84 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
85 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
86 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
87 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
88 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
89 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
90 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
91 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
92 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
93 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
94 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
95 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
96 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
97 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
98 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
99 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
100 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
101 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
102 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
103 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
104 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
105 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
106 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
107 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
108 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
109 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
110 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
111 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
112 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
113 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
114 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
125 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
126 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
127 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
128 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
129 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
130 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
131 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
132 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
133 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
134 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
135 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
136 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
137 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
138 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
139 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
140 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
141 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
142 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
143 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
144 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
145 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
146 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
147 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
148 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
149 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.64
Metatranscriptomes 0.49
Isolates 8.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.48
Nodule 0
Rhizoplane 9.85
Rhizosphere 72.91
Stem 0
Stem Tuber 0.49
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100052953 3300005563 Bacteria 4776
2 Ga0070683_100341620 3300005329 Bacteria 1426
3 Ga0070690_100074635 3300005330 Bacteria 2209
4 Ga0068869_100231432 3300005334 Bacteria 1468
5 Ga0070666_10038464 3300005335 Bacteria 3184
6 Ga0070682_100031698 3300005337 Bacteria 3198
7 Ga0068868_100062505 3300005338 Bacteria 2951
8 Ga0070668_100001481 3300005347 Bacteria 16955
9 Ga0070668_100032377 3300005347 Bacteria 3979
10 Ga0070671_100050804 3300005355 Bacteria 3449
11 Ga0070667_100006849 3300005367 Bacteria 9466
12 Ga0070714_100000010 3300005435 Bacteria 262871
13 Ga0070714_100019347 3300005435 Bacteria 5545
14 Ga0070714_100065554 3300005435 Bacteria 3128
15 Ga0070705_100006931 3300005440 Bacteria 5567
16 Ga0070679_100156570 3300005530 Bacteria 2253
17 Ga0068853_100033848 3300005539 Bacteria 4335
18 Ga0070695_100019682 3300005545 Bacteria 4113
19 Ga0070665_100000401 3300005548 Bacteria 63343
20 Ga0068855_100053027 3300005563 Bacteria 4772
21 Ga0068856_100552757 3300005614 Bacteria 1172
22 Ga0070702_100033446 3300005615 Bacteria 2827
23 Ga0068852_100047974 3300005616 Bacteria 3647
24 Ga0068859_100056498 3300005617 Bacteria 3951
25 Ga0068861_100027531 3300005719 Bacteria 4141
26 Ga0068870_10071736 3300005840 Bacteria 1891
27 Ga0068863_100004961 3300005841 Bacteria 13117
28 Ga0068863_100300499 3300005841 Bacteria 1557
29 Ga0068863_100394874 3300005841 Bacteria 1352
30 Ga0068858_100055736 3300005842 Bacteria 3654
31 Ga0068858_100143807 3300005842 Bacteria 2239
32 Ga0068860_100000114 3300005843 Bacteria 128789
33 Ga0081455_10019005 3300005937 Bacteria 6516
34 Ga0081540_1002329 3300005983 Bacteria 15548
35 Ga0070717_10039200 3300006028 Bacteria 3854
36 Ga0075362_10077098 3300006177 Bacteria 1531
37 Ga0075434_100146737 3300006871 Bacteria 2379
38 Ga0068865_100119963 3300006881 Bacteria 1954
39 Ga0097620_100056498 3300006931 Bacteria 3951
40 Ga0105245_10037004 3300009098 Bacteria 4337
41 Ga0105245_10075906 3300009098 Bacteria 3061
42 Ga0105237_10027545 3300009545 Bacteria 5799
43 Ga0105239_10123884 3300010375 Bacteria 2872
44 Ga0157370_10073971 3300013104 Bacteria 3215
45 Ga0157370_10084351 3300013104 Bacteria 2986
46 Ga0157372_10000024 3300013307 Bacteria 197716
47 Ga0157379_10001395 3300014968 Bacteria 19784
48 Ga0157379_10041941 3300014968 Bacteria 4085
49 Ga0206353_11564446 3300020082 Bacteria 1843
50 Ga0213876_10048214 3300021384 Bacteria 2251
51 Ga0213875_10000123 3300021388 Bacteria 86889
52 Ga0213875_10002214 3300021388 Bacteria 11832
53 Ga0207671_10110529 3300025914 Bacteria 2091
54 Ga0207687_10061618 3300025927 Bacteria 2650
55 Ga0207664_10000009 3300025929 Bacteria 299246
56 Ga0207664_10023494 3300025929 Bacteria 4621
57 Ga0207664_10117757 3300025929 Bacteria 2218
58 Ga0207706_10022503 3300025933 Bacteria 5656
59 Ga0207670_10028276 3300025936 Bacteria 3557
60 Ga0207704_10050872 3300025938 Bacteria 2502
61 Ga0207661_10414385 3300025944 Bacteria 1223
62 Ga0207679_10180957 3300025945 Bacteria 1744
63 Ga0207679_10417287 3300025945 Bacteria 1184
64 Ga0207668_10005146 3300025972 Bacteria 7695
65 Ga0207668_10035712 3300025972 Bacteria 3312
66 Ga0207668_10064411 3300025972 Bacteria 2590
67 Ga0207658_10005173 3300025986 Bacteria 8987
68 Ga0207677_10019512 3300026023 Bacteria 4095
69 Ga0207677_10255016 3300026023 Bacteria 1427
70 Ga0207703_10146336 3300026035 Bacteria 2055
71 Ga0207639_10107305 3300026041 Bacteria 2268
72 Ga0207678_10000782 3300026067 Bacteria 29044
73 Ga0207708_10105890 3300026075 Bacteria 2180
74 Ga0207641_10004666 3300026088 Bacteria 11822
75 Ga0207641_10354261 3300026088 Bacteria 1399
76 Ga0207675_100021175 3300026118 Bacteria 6057
77 Ga0207698_10014583 3300026142 Bacteria 5231
78 Ga0268266_10006459 3300028379 Bacteria 10734
79 Ga0268266_10110530 3300028379 Bacteria 2435
80 Ga0268264_10000147 3300028381 Bacteria 164790
81 Ga0307513_10010554 3300031456 Bacteria 11563
82 Ga0307509_10033372 3300031507 Bacteria 5666
83 Ga0307405_10134286 3300031731 Bacteria 1715
84 Ga0307405_10198755 3300031731 Bacteria 1454
85 Ga0307518_10026675 3300031838 Bacteria 4165
86 Ga0307406_10213941 3300031901 Bacteria 1428
87 Ga0307406_10278512 3300031901 Bacteria 1274
88 Ga0307407_10119439 3300031903 Bacteria 1669
89 Ga0307416_100440064 3300032002 Bacteria 1353
90 Ga0307411_10053076 3300032005 Bacteria 2654
91 Ga0307411_10174986 3300032005 Bacteria 1623
92 Ga0307411_10243348 3300032005 Bacteria 1410
93 Ga0307415_100017297 3300032126 Bacteria 4321
94 Ga0307415_100156655 3300032126 Bacteria 1760
95 Ga0307415_100230186 3300032126 Bacteria 1492
96 Ga0307507_10009941 3300033179 Bacteria 12498
97 Ga0307507_10081116 3300033179 Bacteria 2854
98 Ga0307507_10164235 3300033179 Bacteria 1632
99 Ga0307510_10044792 3300033180 Bacteria 4786
100 Ga0373950_0018771 3300034818 Bacteria 1203
101 Ga0373940_0037786 3300035088 Bacteria 1316
102 Ga0373951_0039464 3300035091 Bacteria 1135
103 Ga0373952_0003785 3300035092 Bacteria 2737
104 Ga0373956_0004776 3300035119 Bacteria 5420
105 Ga0373931_0010498 3300035691 Bacteria 4452
106 Ga0373927_0058542 3300035695 Bacteria 2492
107 Ga0436364_0207977 3300037853 Bacteria 46460
108 Ga0436364_0661798 3300037853 Bacteria 86818
109 Ga0395901_0613221 3300038443 Bacteria 1096
110 Ga0436365_0453742 3300039437 Bacteria 5307
111 Ga0439459_0005346 3300042438 Bacteria 2107
112 Ga0466972_0013577 3300044658 Bacteria 4087
113 Ga0466965_0005524 3300044683 Bacteria 5700
114 Ga0466966_0007533 3300044684 Bacteria 7211
115 Ga0466966_0010020 3300044684 Bacteria 6280
116 Ga0466961_0202358 3300044693 Bacteria 1228
117 Ga0466963_0015086 3300044694 Bacteria 4777
118 Ga0466963_0031671 3300044694 Bacteria 3420
119 Ga0466963_0036035 3300044694 Bacteria 3224
120 Ga0466971_0005194 3300044719 Bacteria 5636
121 Ga0466968_0069846 3300044735 Bacteria 1527
122 Ga0466957_0046312 3300044842 Bacteria 2640
123 Ga0466960_0066297 3300044901 Bacteria 1785
124 Ga0466959_0009431 3300045049 Bacteria 6941
125 Ga0466959_0011879 3300045049 Bacteria 6272
126 Ga0466967_0009952 3300045976 Bacteria 7099
127 Ga0466967_0010347 3300045976 Bacteria 6992
128 Ga0466967_0010732 3300045976 Bacteria 6887
129 Ga0466967_0019236 3300045976 Bacteria 5486
130 Ga0466967_0049407 3300045976 Bacteria 3678
131 Ga0466967_0074757 3300045976 Bacteria 3044
132 Ga0466967_0117161 3300045976 Bacteria 2455
133 Ga0495641_0016091 3300046461 Bacteria 3953
134 Ga0496100_0001193 3300048903 Bacteria 12611
135 Ga0496101_0016639 3300048904 Bacteria 4974
136 Ga0496101_0022284 3300048904 Bacteria 4359
137 Ga0496102_0000029 3300048905 Bacteria 222195
138 Ga0496102_0000155 3300048905 Bacteria 92990
139 Ga0496102_0000263 3300048905 Bacteria 67095
140 Ga0496102_0012447 3300048905 Bacteria 7362
141 Ga0496103_0000080 3300048906 Bacteria 110513
142 Ga0496103_0000202 3300048906 Bacteria 59622
143 Ga0496103_0040382 3300048906 Bacteria 2867
144 Ga0496104_0194906 3300048907 Bacteria 1938
145 Ga0496108_0012886 3300048911 Bacteria 6812
146 Ga0496108_0355757 3300048911 Bacteria 1278
147 Ga0496109_0025603 3300048912 Bacteria 5259
148 Ga0496109_0145559 3300048912 Bacteria 2217
149 Ga0496109_0172420 3300048912 Bacteria 2030
150 Ga0496110_0006072 3300048913 Bacteria 9521
151 Ga0496113_0122098 3300048916 Bacteria 2037
152 Ga0496113_0148288 3300048916 Bacteria 1849
153 Ga0496115_0120261 3300048918 Bacteria 2161
154 Ga0496116_0000241 3300048919 Bacteria 100186
155 Ga0496117_0000529 3300048920 Bacteria 62772
156 Ga0496118_0000265 3300048921 Bacteria 91869
157 Ga0496118_0013226 3300048921 Bacteria 7827
158 Ga0496119_0000456 3300048922 Bacteria 56083
159 Ga0496121_0052644 3300048924 Bacteria 3416
160 Ga0496121_0078010 3300048924 Bacteria 2635
161 Ga0496124_0016585 3300048927 Bacteria 6990
162 Ga0496125_0074336 3300048928 Bacteria 2635
163 Ga0496126_0000381 3300048929 Bacteria 91810
164 Ga0501031_0046426 3300049568 Bacteria 2832
165 Ga0501032_0060917 3300049569 Bacteria 2531
166 Ga0501034_0041140 3300049571 Bacteria 4676
167 Ga0501034_0159358 3300049571 Bacteria 2229
168 Ga0501036_0146744 3300049572 Bacteria 1990
169 Ga0501037_0045593 3300049573 Bacteria 3219
170 Ga0501038_0021533 3300049574 Bacteria 5785
171 Ga0501043_0006957 3300049579 Bacteria 9013
172 Ga0501046_0102262 3300049580 Bacteria 2197
173 Ga0501047_0022342 3300049581 Bacteria 6076
174 Ga0501047_0165586 3300049581 Bacteria 2081
175 Ga0501048_0001413 3300049582 Bacteria 18167
176 Ga0501070_0008356 3300049586 Bacteria 8748
177 Ga0501035_0097146 3300049822 Bacteria 2587
178 Ga0501035_0122863 3300049822 Bacteria 2268
179 nmdc:mga06r32_141_c6 3300050510 Bacteria 4405
180 nmdc:mga0a205_349251_c1 3300050515 Bacteria 1347
181 Ga0495619_0025345 3300053085 Bacteria 3808
182 Ga0500559_0004191 3300053136 Bacteria 6912
183 Ga0500616_0000175 3300053153 Bacteria 106718
184 Ga0466962_0001664 3300061719 Bacteria 10426
185 Ga0466962_0006456 3300061719 Bacteria 5629
186 2558911694 2558860112 Bacteria 9931328
187 2644455729 2643221681 Bacteria 3707866
188 2795793827 2795385472 Bacteria 6627535
189 2863069480 2863067949 Bacteria 8541735
190 2866557403 2866552031 Bacteria 5824618
191 2866612507 2866612099 Bacteria 7543886
192 2891328441 2891326441 Bacteria 6439512
193 2899374559 2899370129 Bacteria 6781179
194 2904767911 2904765812 Bacteria 5369154
195 2904774312 2904770941 Bacteria 5580202
196 2908813557 2908811453 Bacteria 5478616
197 2919423660 2919420072 Bacteria 5390363
198 2919436268 2919432681 Bacteria 5390474
199 2932400271 2932398195 Bacteria 3847976
200 8003315349 8003314358 Bacteria 10575343
201 8047719773 8047710418 Bacteria 11023148
202 8054473678 8054472261 Bacteria 7464355
203 8056209742 8056207758 Bacteria 8639239
204 Ga0068855_100052953
205 Ga0070683_100341620
206 Ga0070690_100074635
207 Ga0068869_100231432
208 Ga0070666_10038464
209 Ga0070682_100031698
210 Ga0068868_100062505
211 Ga0070668_100001481
212 Ga0070668_100032377
213 Ga0070671_100050804
214 Ga0070667_100006849
215 Ga0070714_100000010
216 Ga0070714_100019347
217 Ga0070714_100065554
218 Ga0070705_100006931
219 Ga0070679_100156570
220 Ga0068853_100033848
221 Ga0070695_100019682
222 Ga0070665_100000401
223 Ga0068855_100053027
224 Ga0068856_100552757
225 Ga0070702_100033446
226 Ga0068852_100047974
227 Ga0068859_100056498
228 Ga0068861_100027531
229 Ga0068870_10071736
230 Ga0068863_100004961
231 Ga0068863_100300499
232 Ga0068863_100394874
233 Ga0068858_100055736
234 Ga0068858_100143807
235 Ga0068860_100000114
236 Ga0081455_10019005
237 Ga0081540_1002329
238 Ga0070717_10039200
239 Ga0075362_10077098
240 Ga0075434_100146737
241 Ga0068865_100119963
242 Ga0097620_100056498
243 Ga0105245_10037004
244 Ga0105245_10075906
245 Ga0105237_10027545
246 Ga0105239_10123884
247 Ga0157370_10073971
248 Ga0157370_10084351
249 Ga0157372_10000024
250 Ga0157379_10001395
251 Ga0157379_10041941
252 Ga0206353_11564446
253 Ga0213876_10048214
254 Ga0213875_10000123
255 Ga0213875_10002214
256 Ga0207671_10110529
257 Ga0207687_10061618
258 Ga0207664_10000009
259 Ga0207664_10023494
260 Ga0207664_10117757
261 Ga0207706_10022503
262 Ga0207670_10028276
263 Ga0207704_10050872
264 Ga0207661_10414385
265 Ga0207679_10180957
266 Ga0207679_10417287
267 Ga0207668_10005146
268 Ga0207668_10035712
269 Ga0207668_10064411
270 Ga0207658_10005173
271 Ga0207677_10019512
272 Ga0207677_10255016
273 Ga0207703_10146336
274 Ga0207639_10107305
275 Ga0207678_10000782
276 Ga0207708_10105890
277 Ga0207641_10004666
278 Ga0207641_10354261
279 Ga0207675_100021175
280 Ga0207698_10014583
281 Ga0268266_10006459
282 Ga0268266_10110530
283 Ga0268264_10000147
284 Ga0307513_10010554
285 Ga0307509_10033372
286 Ga0307405_10134286
287 Ga0307405_10198755
288 Ga0307518_10026675
289 Ga0307406_10213941
290 Ga0307406_10278512
291 Ga0307407_10119439
292 Ga0307416_100440064
293 Ga0307411_10053076
294 Ga0307411_10174986
295 Ga0307411_10243348
296 Ga0307415_100017297
297 Ga0307415_100156655
298 Ga0307415_100230186
299 Ga0307507_10009941
300 Ga0307507_10081116
301 Ga0307507_10164235
302 Ga0307510_10044792
303 Ga0373950_0018771
304 Ga0373940_0037786
305 Ga0373951_0039464
306 Ga0373952_0003785
307 Ga0373956_0004776
308 Ga0373931_0010498
309 Ga0373927_0058542
310 Ga0436364_0207977
311 Ga0436364_0661798
312 Ga0395901_0613221
313 Ga0436365_0453742
314 Ga0439459_0005346
315 Ga0466972_0013577
316 Ga0466965_0005524
317 Ga0466966_0007533
318 Ga0466966_0010020
319 Ga0466961_0202358
320 Ga0466963_0015086
321 Ga0466963_0031671
322 Ga0466963_0036035
323 Ga0466971_0005194
324 Ga0466968_0069846
325 Ga0466957_0046312
326 Ga0466960_0066297
327 Ga0466959_0009431
328 Ga0466959_0011879
329 Ga0466967_0009952
330 Ga0466967_0010347
331 Ga0466967_0010732
332 Ga0466967_0019236
333 Ga0466967_0049407
334 Ga0466967_0074757
335 Ga0466967_0117161
336 Ga0495641_0016091
337 Ga0496100_0001193
338 Ga0496101_0016639
339 Ga0496101_0022284
340 Ga0496102_0000029
341 Ga0496102_0000155
342 Ga0496102_0000263
343 Ga0496102_0012447
344 Ga0496103_0000080
345 Ga0496103_0000202
346 Ga0496103_0040382
347 Ga0496104_0194906
348 Ga0496108_0012886
349 Ga0496108_0355757
350 Ga0496109_0025603
351 Ga0496109_0145559
352 Ga0496109_0172420
353 Ga0496110_0006072
354 Ga0496113_0122098
355 Ga0496113_0148288
356 Ga0496115_0120261
357 Ga0496116_0000241
358 Ga0496117_0000529
359 Ga0496118_0000265
360 Ga0496118_0013226
361 Ga0496119_0000456
362 Ga0496121_0052644
363 Ga0496121_0078010
364 Ga0496124_0016585
365 Ga0496125_0074336
366 Ga0496126_0000381
367 Ga0501031_0046426
368 Ga0501032_0060917
369 Ga0501034_0041140
370 Ga0501034_0159358
371 Ga0501036_0146744
372 Ga0501037_0045593
373 Ga0501038_0021533
374 Ga0501043_0006957
375 Ga0501046_0102262
376 Ga0501047_0022342
377 Ga0501047_0165586
378 Ga0501048_0001413
379 Ga0501070_0008356
380 Ga0501035_0097146
381 Ga0501035_0122863
382 nmdc:mga06r32_141_c6
383 nmdc:mga0a205_349251_c1
384 Ga0495619_0025345
385 Ga0500559_0004191
386 Ga0500616_0000175
387 Ga0466962_0001664
388 Ga0466962_0006456
389 2558911694
390 2644455729
391 2795793827
392 2863069480
393 2866557403
394 2866612507
395 2891328441
396 2899374559
397 2904767911
398 2904774312
399 2908813557
400 2919423660
401 2919436268
402 2932400271
403 8003315349
404 8047719773
405 8054473678
406 8056209742

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09179

TilS

TilS substrate binding domain

287

353

0.97

PF01171

ATP_bind_3

PP-loop family

23

198

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mkp-assembly1.cif.gz_A non redox thiolation in transfer rnas occuring via sulfur activation by a [4fe-4s] cluster 0.8126 7 222
5mko-assembly1.cif.gz_A [2fe-2s] cluster containing ttua in complex with amp. 0.8119 7 222
6scy-assembly1.cif.gz_A u34-trna thiolase ncsa from methanococcus maripaludis with its [4fe-4s] cluster 0.8012 7 222
3vrh-assembly1.cif.gz_A-2 crystal structure of ph0300 0.8008 7 222
5mkq-assembly1.cif.gz_A ttua enzyme containing a [4fe-4s] 0.7978 7 222
ID Description Score Start End Superfamily
af_P9WG53_6_202_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9193 8 210 3.40.50.620
af_P9WG53_6_202_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8925 8 210 3.40.50.620
af_K7LES9_77_324_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8862 16 233 3.40.50.620
1ni5A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8808 24 233 3.40.50.620
af_Q10441_8_228_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8787 11 209 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A7C3Q0E3-F1-model_v4 tRNA(Ile)-lysidine synthetase (EC 6.3.4.19) 0.9491 123 229 GO:0005524
GO:0006400
GO:0032267
AF-A0A1J5D7A6-F1-model_v4 tRNA(Ile)-lysidine synthetase (EC 6.3.4.19) 0.9338 9 204 GO:0005524
GO:0005737
GO:0006400
GO:0032267
AF-A0A258GN85-F1-model_v4 tRNA(Ile)-lysidine synthetase (EC 6.3.4.19) 0.9311 28 232 GO:0005524
GO:0005737
GO:0006400
GO:0032267
AF-A0A2S5Y0Z2-F1-model_v4 tRNA(Ile)-lysidine synthetase (EC 6.3.4.19) 0.9301 4 237 GO:0005524
GO:0005737
GO:0006400
GO:0032267
AF-A0A7X9GG25-F1-model_v4 tRNA(Ile)-lysidine synthetase (EC 6.3.4.19) 0.9237 1 210 GO:0005524
GO:0005737
GO:0006400
GO:0032267

Map