F310988
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 203 | 149 | 406 | 320 |
Family's Representative Sequence
| Representative Sequence | 3300005563|Ga0068855_100052953|Ga0068855_1000529532 |
| Length | 368 |
| Sequence | VGPAPAVAAVRSAVRAVLSSHPVVLVACSGGADSLALAAAVAFEAPRAGVRAGLVTVDHGLQAGSSVIAARVAALGYELGFDPVKIVPVTVGTSGGLEAAARAARYEALDAAAFALDAAVLLGHTLDDQAETVLLGLGRGSGPRSVAGMRVVDGRYLRPLLGLRRSVTAAACAALGLEPWDDPHNTDPAFQRARIRGEVLPLLEDVLQGGVVEALARTATLLQDDLDALDAWAAASSPVINSPVATPEGGHGRVDHSDAGREGAVGHADPSPAAGREEGDGGTTAVLDVAGLAELPRAVRSRVLRAWASAAGADPLTAERTAALESLVTAWRGQAPIQLSGGVSVRRVSGRLVLESGAGERAQSIGEP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 15 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 18 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 20 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 21 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 22 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 23 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 24 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 25 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 26 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 27 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 28 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 30 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 31 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 32 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 40 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 41 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 42 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 63 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 64 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 65 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 66 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 67 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 68 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 69 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 70 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 71 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 72 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 73 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 74 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 75 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 76 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 77 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 78 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 79 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 80 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 81 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 82 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 83 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 84 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 85 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 86 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 87 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 88 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 89 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 90 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 91 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 92 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 93 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 94 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 95 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 97 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 98 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 99 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 100 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 101 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 102 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 103 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 104 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 105 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 106 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 107 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 108 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 109 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 110 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 111 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 112 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 113 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 114 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 115 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 116 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 117 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 118 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 119 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 120 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 121 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 122 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 123 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 124 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 125 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 126 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 127 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 128 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 130 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 131 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 132 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 133 | 2643221681 | Aeromicrobium sp. Root472D3 | Isolate | Unclassified |
| 134 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 135 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 136 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 137 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 138 | 2891326441 | Actinokineospora pegani TRM65233 | Isolate | Unclassified |
| 139 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 140 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 141 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 142 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 143 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 144 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 145 | 2932398195 | Dietzia sp. 2505 | Isolate | Rhizosphere |
| 146 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 147 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 148 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 149 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.64 |
| Metatranscriptomes | 0.49 |
| Isolates | 8.87 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.48 |
| Nodule | 0 |
| Rhizoplane | 9.85 |
| Rhizosphere | 72.91 |
| Stem | 0 |
| Stem Tuber | 0.49 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068855_100052953 | 3300005563 | Bacteria | 4776 |
| 2 | Ga0070683_100341620 | 3300005329 | Bacteria | 1426 |
| 3 | Ga0070690_100074635 | 3300005330 | Bacteria | 2209 |
| 4 | Ga0068869_100231432 | 3300005334 | Bacteria | 1468 |
| 5 | Ga0070666_10038464 | 3300005335 | Bacteria | 3184 |
| 6 | Ga0070682_100031698 | 3300005337 | Bacteria | 3198 |
| 7 | Ga0068868_100062505 | 3300005338 | Bacteria | 2951 |
| 8 | Ga0070668_100001481 | 3300005347 | Bacteria | 16955 |
| 9 | Ga0070668_100032377 | 3300005347 | Bacteria | 3979 |
| 10 | Ga0070671_100050804 | 3300005355 | Bacteria | 3449 |
| 11 | Ga0070667_100006849 | 3300005367 | Bacteria | 9466 |
| 12 | Ga0070714_100000010 | 3300005435 | Bacteria | 262871 |
| 13 | Ga0070714_100019347 | 3300005435 | Bacteria | 5545 |
| 14 | Ga0070714_100065554 | 3300005435 | Bacteria | 3128 |
| 15 | Ga0070705_100006931 | 3300005440 | Bacteria | 5567 |
| 16 | Ga0070679_100156570 | 3300005530 | Bacteria | 2253 |
| 17 | Ga0068853_100033848 | 3300005539 | Bacteria | 4335 |
| 18 | Ga0070695_100019682 | 3300005545 | Bacteria | 4113 |
| 19 | Ga0070665_100000401 | 3300005548 | Bacteria | 63343 |
| 20 | Ga0068855_100053027 | 3300005563 | Bacteria | 4772 |
| 21 | Ga0068856_100552757 | 3300005614 | Bacteria | 1172 |
| 22 | Ga0070702_100033446 | 3300005615 | Bacteria | 2827 |
| 23 | Ga0068852_100047974 | 3300005616 | Bacteria | 3647 |
| 24 | Ga0068859_100056498 | 3300005617 | Bacteria | 3951 |
| 25 | Ga0068861_100027531 | 3300005719 | Bacteria | 4141 |
| 26 | Ga0068870_10071736 | 3300005840 | Bacteria | 1891 |
| 27 | Ga0068863_100004961 | 3300005841 | Bacteria | 13117 |
| 28 | Ga0068863_100300499 | 3300005841 | Bacteria | 1557 |
| 29 | Ga0068863_100394874 | 3300005841 | Bacteria | 1352 |
| 30 | Ga0068858_100055736 | 3300005842 | Bacteria | 3654 |
| 31 | Ga0068858_100143807 | 3300005842 | Bacteria | 2239 |
| 32 | Ga0068860_100000114 | 3300005843 | Bacteria | 128789 |
| 33 | Ga0081455_10019005 | 3300005937 | Bacteria | 6516 |
| 34 | Ga0081540_1002329 | 3300005983 | Bacteria | 15548 |
| 35 | Ga0070717_10039200 | 3300006028 | Bacteria | 3854 |
| 36 | Ga0075362_10077098 | 3300006177 | Bacteria | 1531 |
| 37 | Ga0075434_100146737 | 3300006871 | Bacteria | 2379 |
| 38 | Ga0068865_100119963 | 3300006881 | Bacteria | 1954 |
| 39 | Ga0097620_100056498 | 3300006931 | Bacteria | 3951 |
| 40 | Ga0105245_10037004 | 3300009098 | Bacteria | 4337 |
| 41 | Ga0105245_10075906 | 3300009098 | Bacteria | 3061 |
| 42 | Ga0105237_10027545 | 3300009545 | Bacteria | 5799 |
| 43 | Ga0105239_10123884 | 3300010375 | Bacteria | 2872 |
| 44 | Ga0157370_10073971 | 3300013104 | Bacteria | 3215 |
| 45 | Ga0157370_10084351 | 3300013104 | Bacteria | 2986 |
| 46 | Ga0157372_10000024 | 3300013307 | Bacteria | 197716 |
| 47 | Ga0157379_10001395 | 3300014968 | Bacteria | 19784 |
| 48 | Ga0157379_10041941 | 3300014968 | Bacteria | 4085 |
| 49 | Ga0206353_11564446 | 3300020082 | Bacteria | 1843 |
| 50 | Ga0213876_10048214 | 3300021384 | Bacteria | 2251 |
| 51 | Ga0213875_10000123 | 3300021388 | Bacteria | 86889 |
| 52 | Ga0213875_10002214 | 3300021388 | Bacteria | 11832 |
| 53 | Ga0207671_10110529 | 3300025914 | Bacteria | 2091 |
| 54 | Ga0207687_10061618 | 3300025927 | Bacteria | 2650 |
| 55 | Ga0207664_10000009 | 3300025929 | Bacteria | 299246 |
| 56 | Ga0207664_10023494 | 3300025929 | Bacteria | 4621 |
| 57 | Ga0207664_10117757 | 3300025929 | Bacteria | 2218 |
| 58 | Ga0207706_10022503 | 3300025933 | Bacteria | 5656 |
| 59 | Ga0207670_10028276 | 3300025936 | Bacteria | 3557 |
| 60 | Ga0207704_10050872 | 3300025938 | Bacteria | 2502 |
| 61 | Ga0207661_10414385 | 3300025944 | Bacteria | 1223 |
| 62 | Ga0207679_10180957 | 3300025945 | Bacteria | 1744 |
| 63 | Ga0207679_10417287 | 3300025945 | Bacteria | 1184 |
| 64 | Ga0207668_10005146 | 3300025972 | Bacteria | 7695 |
| 65 | Ga0207668_10035712 | 3300025972 | Bacteria | 3312 |
| 66 | Ga0207668_10064411 | 3300025972 | Bacteria | 2590 |
| 67 | Ga0207658_10005173 | 3300025986 | Bacteria | 8987 |
| 68 | Ga0207677_10019512 | 3300026023 | Bacteria | 4095 |
| 69 | Ga0207677_10255016 | 3300026023 | Bacteria | 1427 |
| 70 | Ga0207703_10146336 | 3300026035 | Bacteria | 2055 |
| 71 | Ga0207639_10107305 | 3300026041 | Bacteria | 2268 |
| 72 | Ga0207678_10000782 | 3300026067 | Bacteria | 29044 |
| 73 | Ga0207708_10105890 | 3300026075 | Bacteria | 2180 |
| 74 | Ga0207641_10004666 | 3300026088 | Bacteria | 11822 |
| 75 | Ga0207641_10354261 | 3300026088 | Bacteria | 1399 |
| 76 | Ga0207675_100021175 | 3300026118 | Bacteria | 6057 |
| 77 | Ga0207698_10014583 | 3300026142 | Bacteria | 5231 |
| 78 | Ga0268266_10006459 | 3300028379 | Bacteria | 10734 |
| 79 | Ga0268266_10110530 | 3300028379 | Bacteria | 2435 |
| 80 | Ga0268264_10000147 | 3300028381 | Bacteria | 164790 |
| 81 | Ga0307513_10010554 | 3300031456 | Bacteria | 11563 |
| 82 | Ga0307509_10033372 | 3300031507 | Bacteria | 5666 |
| 83 | Ga0307405_10134286 | 3300031731 | Bacteria | 1715 |
| 84 | Ga0307405_10198755 | 3300031731 | Bacteria | 1454 |
| 85 | Ga0307518_10026675 | 3300031838 | Bacteria | 4165 |
| 86 | Ga0307406_10213941 | 3300031901 | Bacteria | 1428 |
| 87 | Ga0307406_10278512 | 3300031901 | Bacteria | 1274 |
| 88 | Ga0307407_10119439 | 3300031903 | Bacteria | 1669 |
| 89 | Ga0307416_100440064 | 3300032002 | Bacteria | 1353 |
| 90 | Ga0307411_10053076 | 3300032005 | Bacteria | 2654 |
| 91 | Ga0307411_10174986 | 3300032005 | Bacteria | 1623 |
| 92 | Ga0307411_10243348 | 3300032005 | Bacteria | 1410 |
| 93 | Ga0307415_100017297 | 3300032126 | Bacteria | 4321 |
| 94 | Ga0307415_100156655 | 3300032126 | Bacteria | 1760 |
| 95 | Ga0307415_100230186 | 3300032126 | Bacteria | 1492 |
| 96 | Ga0307507_10009941 | 3300033179 | Bacteria | 12498 |
| 97 | Ga0307507_10081116 | 3300033179 | Bacteria | 2854 |
| 98 | Ga0307507_10164235 | 3300033179 | Bacteria | 1632 |
| 99 | Ga0307510_10044792 | 3300033180 | Bacteria | 4786 |
| 100 | Ga0373950_0018771 | 3300034818 | Bacteria | 1203 |
| 101 | Ga0373940_0037786 | 3300035088 | Bacteria | 1316 |
| 102 | Ga0373951_0039464 | 3300035091 | Bacteria | 1135 |
| 103 | Ga0373952_0003785 | 3300035092 | Bacteria | 2737 |
| 104 | Ga0373956_0004776 | 3300035119 | Bacteria | 5420 |
| 105 | Ga0373931_0010498 | 3300035691 | Bacteria | 4452 |
| 106 | Ga0373927_0058542 | 3300035695 | Bacteria | 2492 |
| 107 | Ga0436364_0207977 | 3300037853 | Bacteria | 46460 |
| 108 | Ga0436364_0661798 | 3300037853 | Bacteria | 86818 |
| 109 | Ga0395901_0613221 | 3300038443 | Bacteria | 1096 |
| 110 | Ga0436365_0453742 | 3300039437 | Bacteria | 5307 |
| 111 | Ga0439459_0005346 | 3300042438 | Bacteria | 2107 |
| 112 | Ga0466972_0013577 | 3300044658 | Bacteria | 4087 |
| 113 | Ga0466965_0005524 | 3300044683 | Bacteria | 5700 |
| 114 | Ga0466966_0007533 | 3300044684 | Bacteria | 7211 |
| 115 | Ga0466966_0010020 | 3300044684 | Bacteria | 6280 |
| 116 | Ga0466961_0202358 | 3300044693 | Bacteria | 1228 |
| 117 | Ga0466963_0015086 | 3300044694 | Bacteria | 4777 |
| 118 | Ga0466963_0031671 | 3300044694 | Bacteria | 3420 |
| 119 | Ga0466963_0036035 | 3300044694 | Bacteria | 3224 |
| 120 | Ga0466971_0005194 | 3300044719 | Bacteria | 5636 |
| 121 | Ga0466968_0069846 | 3300044735 | Bacteria | 1527 |
| 122 | Ga0466957_0046312 | 3300044842 | Bacteria | 2640 |
| 123 | Ga0466960_0066297 | 3300044901 | Bacteria | 1785 |
| 124 | Ga0466959_0009431 | 3300045049 | Bacteria | 6941 |
| 125 | Ga0466959_0011879 | 3300045049 | Bacteria | 6272 |
| 126 | Ga0466967_0009952 | 3300045976 | Bacteria | 7099 |
| 127 | Ga0466967_0010347 | 3300045976 | Bacteria | 6992 |
| 128 | Ga0466967_0010732 | 3300045976 | Bacteria | 6887 |
| 129 | Ga0466967_0019236 | 3300045976 | Bacteria | 5486 |
| 130 | Ga0466967_0049407 | 3300045976 | Bacteria | 3678 |
| 131 | Ga0466967_0074757 | 3300045976 | Bacteria | 3044 |
| 132 | Ga0466967_0117161 | 3300045976 | Bacteria | 2455 |
| 133 | Ga0495641_0016091 | 3300046461 | Bacteria | 3953 |
| 134 | Ga0496100_0001193 | 3300048903 | Bacteria | 12611 |
| 135 | Ga0496101_0016639 | 3300048904 | Bacteria | 4974 |
| 136 | Ga0496101_0022284 | 3300048904 | Bacteria | 4359 |
| 137 | Ga0496102_0000029 | 3300048905 | Bacteria | 222195 |
| 138 | Ga0496102_0000155 | 3300048905 | Bacteria | 92990 |
| 139 | Ga0496102_0000263 | 3300048905 | Bacteria | 67095 |
| 140 | Ga0496102_0012447 | 3300048905 | Bacteria | 7362 |
| 141 | Ga0496103_0000080 | 3300048906 | Bacteria | 110513 |
| 142 | Ga0496103_0000202 | 3300048906 | Bacteria | 59622 |
| 143 | Ga0496103_0040382 | 3300048906 | Bacteria | 2867 |
| 144 | Ga0496104_0194906 | 3300048907 | Bacteria | 1938 |
| 145 | Ga0496108_0012886 | 3300048911 | Bacteria | 6812 |
| 146 | Ga0496108_0355757 | 3300048911 | Bacteria | 1278 |
| 147 | Ga0496109_0025603 | 3300048912 | Bacteria | 5259 |
| 148 | Ga0496109_0145559 | 3300048912 | Bacteria | 2217 |
| 149 | Ga0496109_0172420 | 3300048912 | Bacteria | 2030 |
| 150 | Ga0496110_0006072 | 3300048913 | Bacteria | 9521 |
| 151 | Ga0496113_0122098 | 3300048916 | Bacteria | 2037 |
| 152 | Ga0496113_0148288 | 3300048916 | Bacteria | 1849 |
| 153 | Ga0496115_0120261 | 3300048918 | Bacteria | 2161 |
| 154 | Ga0496116_0000241 | 3300048919 | Bacteria | 100186 |
| 155 | Ga0496117_0000529 | 3300048920 | Bacteria | 62772 |
| 156 | Ga0496118_0000265 | 3300048921 | Bacteria | 91869 |
| 157 | Ga0496118_0013226 | 3300048921 | Bacteria | 7827 |
| 158 | Ga0496119_0000456 | 3300048922 | Bacteria | 56083 |
| 159 | Ga0496121_0052644 | 3300048924 | Bacteria | 3416 |
| 160 | Ga0496121_0078010 | 3300048924 | Bacteria | 2635 |
| 161 | Ga0496124_0016585 | 3300048927 | Bacteria | 6990 |
| 162 | Ga0496125_0074336 | 3300048928 | Bacteria | 2635 |
| 163 | Ga0496126_0000381 | 3300048929 | Bacteria | 91810 |
| 164 | Ga0501031_0046426 | 3300049568 | Bacteria | 2832 |
| 165 | Ga0501032_0060917 | 3300049569 | Bacteria | 2531 |
| 166 | Ga0501034_0041140 | 3300049571 | Bacteria | 4676 |
| 167 | Ga0501034_0159358 | 3300049571 | Bacteria | 2229 |
| 168 | Ga0501036_0146744 | 3300049572 | Bacteria | 1990 |
| 169 | Ga0501037_0045593 | 3300049573 | Bacteria | 3219 |
| 170 | Ga0501038_0021533 | 3300049574 | Bacteria | 5785 |
| 171 | Ga0501043_0006957 | 3300049579 | Bacteria | 9013 |
| 172 | Ga0501046_0102262 | 3300049580 | Bacteria | 2197 |
| 173 | Ga0501047_0022342 | 3300049581 | Bacteria | 6076 |
| 174 | Ga0501047_0165586 | 3300049581 | Bacteria | 2081 |
| 175 | Ga0501048_0001413 | 3300049582 | Bacteria | 18167 |
| 176 | Ga0501070_0008356 | 3300049586 | Bacteria | 8748 |
| 177 | Ga0501035_0097146 | 3300049822 | Bacteria | 2587 |
| 178 | Ga0501035_0122863 | 3300049822 | Bacteria | 2268 |
| 179 | nmdc:mga06r32_141_c6 | 3300050510 | Bacteria | 4405 |
| 180 | nmdc:mga0a205_349251_c1 | 3300050515 | Bacteria | 1347 |
| 181 | Ga0495619_0025345 | 3300053085 | Bacteria | 3808 |
| 182 | Ga0500559_0004191 | 3300053136 | Bacteria | 6912 |
| 183 | Ga0500616_0000175 | 3300053153 | Bacteria | 106718 |
| 184 | Ga0466962_0001664 | 3300061719 | Bacteria | 10426 |
| 185 | Ga0466962_0006456 | 3300061719 | Bacteria | 5629 |
| 186 | 2558911694 | 2558860112 | Bacteria | 9931328 |
| 187 | 2644455729 | 2643221681 | Bacteria | 3707866 |
| 188 | 2795793827 | 2795385472 | Bacteria | 6627535 |
| 189 | 2863069480 | 2863067949 | Bacteria | 8541735 |
| 190 | 2866557403 | 2866552031 | Bacteria | 5824618 |
| 191 | 2866612507 | 2866612099 | Bacteria | 7543886 |
| 192 | 2891328441 | 2891326441 | Bacteria | 6439512 |
| 193 | 2899374559 | 2899370129 | Bacteria | 6781179 |
| 194 | 2904767911 | 2904765812 | Bacteria | 5369154 |
| 195 | 2904774312 | 2904770941 | Bacteria | 5580202 |
| 196 | 2908813557 | 2908811453 | Bacteria | 5478616 |
| 197 | 2919423660 | 2919420072 | Bacteria | 5390363 |
| 198 | 2919436268 | 2919432681 | Bacteria | 5390474 |
| 199 | 2932400271 | 2932398195 | Bacteria | 3847976 |
| 200 | 8003315349 | 8003314358 | Bacteria | 10575343 |
| 201 | 8047719773 | 8047710418 | Bacteria | 11023148 |
| 202 | 8054473678 | 8054472261 | Bacteria | 7464355 |
| 203 | 8056209742 | 8056207758 | Bacteria | 8639239 |
| 204 | Ga0068855_100052953 | |||
| 205 | Ga0070683_100341620 | |||
| 206 | Ga0070690_100074635 | |||
| 207 | Ga0068869_100231432 | |||
| 208 | Ga0070666_10038464 | |||
| 209 | Ga0070682_100031698 | |||
| 210 | Ga0068868_100062505 | |||
| 211 | Ga0070668_100001481 | |||
| 212 | Ga0070668_100032377 | |||
| 213 | Ga0070671_100050804 | |||
| 214 | Ga0070667_100006849 | |||
| 215 | Ga0070714_100000010 | |||
| 216 | Ga0070714_100019347 | |||
| 217 | Ga0070714_100065554 | |||
| 218 | Ga0070705_100006931 | |||
| 219 | Ga0070679_100156570 | |||
| 220 | Ga0068853_100033848 | |||
| 221 | Ga0070695_100019682 | |||
| 222 | Ga0070665_100000401 | |||
| 223 | Ga0068855_100053027 | |||
| 224 | Ga0068856_100552757 | |||
| 225 | Ga0070702_100033446 | |||
| 226 | Ga0068852_100047974 | |||
| 227 | Ga0068859_100056498 | |||
| 228 | Ga0068861_100027531 | |||
| 229 | Ga0068870_10071736 | |||
| 230 | Ga0068863_100004961 | |||
| 231 | Ga0068863_100300499 | |||
| 232 | Ga0068863_100394874 | |||
| 233 | Ga0068858_100055736 | |||
| 234 | Ga0068858_100143807 | |||
| 235 | Ga0068860_100000114 | |||
| 236 | Ga0081455_10019005 | |||
| 237 | Ga0081540_1002329 | |||
| 238 | Ga0070717_10039200 | |||
| 239 | Ga0075362_10077098 | |||
| 240 | Ga0075434_100146737 | |||
| 241 | Ga0068865_100119963 | |||
| 242 | Ga0097620_100056498 | |||
| 243 | Ga0105245_10037004 | |||
| 244 | Ga0105245_10075906 | |||
| 245 | Ga0105237_10027545 | |||
| 246 | Ga0105239_10123884 | |||
| 247 | Ga0157370_10073971 | |||
| 248 | Ga0157370_10084351 | |||
| 249 | Ga0157372_10000024 | |||
| 250 | Ga0157379_10001395 | |||
| 251 | Ga0157379_10041941 | |||
| 252 | Ga0206353_11564446 | |||
| 253 | Ga0213876_10048214 | |||
| 254 | Ga0213875_10000123 | |||
| 255 | Ga0213875_10002214 | |||
| 256 | Ga0207671_10110529 | |||
| 257 | Ga0207687_10061618 | |||
| 258 | Ga0207664_10000009 | |||
| 259 | Ga0207664_10023494 | |||
| 260 | Ga0207664_10117757 | |||
| 261 | Ga0207706_10022503 | |||
| 262 | Ga0207670_10028276 | |||
| 263 | Ga0207704_10050872 | |||
| 264 | Ga0207661_10414385 | |||
| 265 | Ga0207679_10180957 | |||
| 266 | Ga0207679_10417287 | |||
| 267 | Ga0207668_10005146 | |||
| 268 | Ga0207668_10035712 | |||
| 269 | Ga0207668_10064411 | |||
| 270 | Ga0207658_10005173 | |||
| 271 | Ga0207677_10019512 | |||
| 272 | Ga0207677_10255016 | |||
| 273 | Ga0207703_10146336 | |||
| 274 | Ga0207639_10107305 | |||
| 275 | Ga0207678_10000782 | |||
| 276 | Ga0207708_10105890 | |||
| 277 | Ga0207641_10004666 | |||
| 278 | Ga0207641_10354261 | |||
| 279 | Ga0207675_100021175 | |||
| 280 | Ga0207698_10014583 | |||
| 281 | Ga0268266_10006459 | |||
| 282 | Ga0268266_10110530 | |||
| 283 | Ga0268264_10000147 | |||
| 284 | Ga0307513_10010554 | |||
| 285 | Ga0307509_10033372 | |||
| 286 | Ga0307405_10134286 | |||
| 287 | Ga0307405_10198755 | |||
| 288 | Ga0307518_10026675 | |||
| 289 | Ga0307406_10213941 | |||
| 290 | Ga0307406_10278512 | |||
| 291 | Ga0307407_10119439 | |||
| 292 | Ga0307416_100440064 | |||
| 293 | Ga0307411_10053076 | |||
| 294 | Ga0307411_10174986 | |||
| 295 | Ga0307411_10243348 | |||
| 296 | Ga0307415_100017297 | |||
| 297 | Ga0307415_100156655 | |||
| 298 | Ga0307415_100230186 | |||
| 299 | Ga0307507_10009941 | |||
| 300 | Ga0307507_10081116 | |||
| 301 | Ga0307507_10164235 | |||
| 302 | Ga0307510_10044792 | |||
| 303 | Ga0373950_0018771 | |||
| 304 | Ga0373940_0037786 | |||
| 305 | Ga0373951_0039464 | |||
| 306 | Ga0373952_0003785 | |||
| 307 | Ga0373956_0004776 | |||
| 308 | Ga0373931_0010498 | |||
| 309 | Ga0373927_0058542 | |||
| 310 | Ga0436364_0207977 | |||
| 311 | Ga0436364_0661798 | |||
| 312 | Ga0395901_0613221 | |||
| 313 | Ga0436365_0453742 | |||
| 314 | Ga0439459_0005346 | |||
| 315 | Ga0466972_0013577 | |||
| 316 | Ga0466965_0005524 | |||
| 317 | Ga0466966_0007533 | |||
| 318 | Ga0466966_0010020 | |||
| 319 | Ga0466961_0202358 | |||
| 320 | Ga0466963_0015086 | |||
| 321 | Ga0466963_0031671 | |||
| 322 | Ga0466963_0036035 | |||
| 323 | Ga0466971_0005194 | |||
| 324 | Ga0466968_0069846 | |||
| 325 | Ga0466957_0046312 | |||
| 326 | Ga0466960_0066297 | |||
| 327 | Ga0466959_0009431 | |||
| 328 | Ga0466959_0011879 | |||
| 329 | Ga0466967_0009952 | |||
| 330 | Ga0466967_0010347 | |||
| 331 | Ga0466967_0010732 | |||
| 332 | Ga0466967_0019236 | |||
| 333 | Ga0466967_0049407 | |||
| 334 | Ga0466967_0074757 | |||
| 335 | Ga0466967_0117161 | |||
| 336 | Ga0495641_0016091 | |||
| 337 | Ga0496100_0001193 | |||
| 338 | Ga0496101_0016639 | |||
| 339 | Ga0496101_0022284 | |||
| 340 | Ga0496102_0000029 | |||
| 341 | Ga0496102_0000155 | |||
| 342 | Ga0496102_0000263 | |||
| 343 | Ga0496102_0012447 | |||
| 344 | Ga0496103_0000080 | |||
| 345 | Ga0496103_0000202 | |||
| 346 | Ga0496103_0040382 | |||
| 347 | Ga0496104_0194906 | |||
| 348 | Ga0496108_0012886 | |||
| 349 | Ga0496108_0355757 | |||
| 350 | Ga0496109_0025603 | |||
| 351 | Ga0496109_0145559 | |||
| 352 | Ga0496109_0172420 | |||
| 353 | Ga0496110_0006072 | |||
| 354 | Ga0496113_0122098 | |||
| 355 | Ga0496113_0148288 | |||
| 356 | Ga0496115_0120261 | |||
| 357 | Ga0496116_0000241 | |||
| 358 | Ga0496117_0000529 | |||
| 359 | Ga0496118_0000265 | |||
| 360 | Ga0496118_0013226 | |||
| 361 | Ga0496119_0000456 | |||
| 362 | Ga0496121_0052644 | |||
| 363 | Ga0496121_0078010 | |||
| 364 | Ga0496124_0016585 | |||
| 365 | Ga0496125_0074336 | |||
| 366 | Ga0496126_0000381 | |||
| 367 | Ga0501031_0046426 | |||
| 368 | Ga0501032_0060917 | |||
| 369 | Ga0501034_0041140 | |||
| 370 | Ga0501034_0159358 | |||
| 371 | Ga0501036_0146744 | |||
| 372 | Ga0501037_0045593 | |||
| 373 | Ga0501038_0021533 | |||
| 374 | Ga0501043_0006957 | |||
| 375 | Ga0501046_0102262 | |||
| 376 | Ga0501047_0022342 | |||
| 377 | Ga0501047_0165586 | |||
| 378 | Ga0501048_0001413 | |||
| 379 | Ga0501070_0008356 | |||
| 380 | Ga0501035_0097146 | |||
| 381 | Ga0501035_0122863 | |||
| 382 | nmdc:mga06r32_141_c6 | |||
| 383 | nmdc:mga0a205_349251_c1 | |||
| 384 | Ga0495619_0025345 | |||
| 385 | Ga0500559_0004191 | |||
| 386 | Ga0500616_0000175 | |||
| 387 | Ga0466962_0001664 | |||
| 388 | Ga0466962_0006456 | |||
| 389 | 2558911694 | |||
| 390 | 2644455729 | |||
| 391 | 2795793827 | |||
| 392 | 2863069480 | |||
| 393 | 2866557403 | |||
| 394 | 2866612507 | |||
| 395 | 2891328441 | |||
| 396 | 2899374559 | |||
| 397 | 2904767911 | |||
| 398 | 2904774312 | |||
| 399 | 2908813557 | |||
| 400 | 2919423660 | |||
| 401 | 2919436268 | |||
| 402 | 2932400271 | |||
| 403 | 8003315349 | |||
| 404 | 8047719773 | |||
| 405 | 8054473678 | |||
| 406 | 8056209742 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5mkp-assembly1.cif.gz_A | non redox thiolation in transfer rnas occuring via sulfur activation by a [4fe-4s] cluster | 0.8126 | 7 | 222 |
| 5mko-assembly1.cif.gz_A | [2fe-2s] cluster containing ttua in complex with amp. | 0.8119 | 7 | 222 |
| 6scy-assembly1.cif.gz_A | u34-trna thiolase ncsa from methanococcus maripaludis with its [4fe-4s] cluster | 0.8012 | 7 | 222 |
| 3vrh-assembly1.cif.gz_A-2 | crystal structure of ph0300 | 0.8008 | 7 | 222 |
| 5mkq-assembly1.cif.gz_A | ttua enzyme containing a [4fe-4s] | 0.7978 | 7 | 222 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WG53_6_202_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9193 | 8 | 210 | 3.40.50.620 |
| af_P9WG53_6_202_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8925 | 8 | 210 | 3.40.50.620 |
| af_K7LES9_77_324_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8862 | 16 | 233 | 3.40.50.620 |
| 1ni5A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8808 | 24 | 233 | 3.40.50.620 |
| af_Q10441_8_228_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8787 | 11 | 209 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C3Q0E3-F1-model_v4 | tRNA(Ile)-lysidine synthetase (EC 6.3.4.19) | 0.9491 | 123 | 229 |
GO:0005524
GO:0006400 GO:0032267 |
| AF-A0A1J5D7A6-F1-model_v4 | tRNA(Ile)-lysidine synthetase (EC 6.3.4.19) | 0.9338 | 9 | 204 |
GO:0005524
GO:0005737 GO:0006400 GO:0032267 |
| AF-A0A258GN85-F1-model_v4 | tRNA(Ile)-lysidine synthetase (EC 6.3.4.19) | 0.9311 | 28 | 232 |
GO:0005524
GO:0005737 GO:0006400 GO:0032267 |
| AF-A0A2S5Y0Z2-F1-model_v4 | tRNA(Ile)-lysidine synthetase (EC 6.3.4.19) | 0.9301 | 4 | 237 |
GO:0005524
GO:0005737 GO:0006400 GO:0032267 |
| AF-A0A7X9GG25-F1-model_v4 | tRNA(Ile)-lysidine synthetase (EC 6.3.4.19) | 0.9237 | 1 | 210 |
GO:0005524
GO:0005737 GO:0006400 GO:0032267 |