F310077

General Info

Members Datasets Scaffolds Average Seq Length
202 102 404 95

Family's Representative Sequence

Representative Sequence 3300031911|Ga0307412_12215378|Ga0307412_122153781
Length 95
Sequence MATDTKSKSHTTTDHDEIRRWVEEHDGKPVLVKGTESGDGGVLRIDFPGGAGEESFERVSWDEWFRIFDERSLAFLYQEQKASGEDSTFFKLVNR

Samples

Sample ID Description Type Environment
1 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
6 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
7 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
9 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
10 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
11 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
12 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
13 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
14 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
15 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
16 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
17 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
18 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
20 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
21 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
22 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
23 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
26 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
27 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
28 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
29 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
30 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
31 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
32 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
33 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
34 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
35 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
36 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
37 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
38 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
39 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
40 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
41 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
42 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
43 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
44 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
45 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
46 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
47 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
48 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
49 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
50 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
51 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
52 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
53 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
54 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
55 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
56 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
57 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
58 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
59 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
60 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
61 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
62 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
63 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
64 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
65 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
66 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
67 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
68 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
69 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
70 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
71 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
74 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
75 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
76 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
77 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
78 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
79 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
80 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
81 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
82 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
83 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
84 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
85 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
86 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
87 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
91 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
92 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
93 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
94 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
95 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
96 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
97 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
98 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
99 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
100 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
101 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
102 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.51
Metatranscriptomes 0.5
Isolates 0.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.49
Rhizosphere 96.53
Stem 0
Stem Tuber 0
Unclassified 12.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307412_12215378 3300031911 Unclassified 512
2 LJQas_1004811 3300000549 Bacteria 1739
3 LJQas_1031791 3300000549 Bacteria 618
4 LJQas_1050252 3300000549 Bacteria 500
5 JGI25407J50210_10190654 3300003373 Unclassified 505
6 Ga0070714_100002558 3300005435 Bacteria 13396
7 Ga0070681_10687385 3300005458 Bacteria 939
8 Ga0070679_100255422 3300005530 Bacteria 1708
9 Ga0081455_10005045 3300005937 Bacteria 14584
10 Ga0081538_10038443 3300005981 Bacteria 3087
11 Ga0075432_10010817 3300006058 Bacteria 3100
12 Ga0075432_10113871 3300006058 Bacteria 1010
13 Ga0075428_100885145 3300006844 Bacteria 947
14 Ga0075428_100959960 3300006844 Unclassified 906
15 Ga0075430_100677715 3300006846 Unclassified 850
16 Ga0075431_101248328 3300006847 Bacteria 705
17 Ga0075433_10000490 3300006852 Bacteria 25807
18 Ga0075433_10103133 3300006852 Bacteria 2526
19 Ga0075433_10261778 3300006852 Unclassified 1533
20 Ga0075434_100000850 3300006871 Bacteria 24312
21 Ga0075434_100293983 3300006871 Bacteria 1644
22 Ga0075429_100750119 3300006880 Unclassified 855
23 Ga0075436_100018146 3300006914 Plasmid 4819
24 Ga0075436_100535834 3300006914 Bacteria 859
25 Ga0075435_100068083 3300007076 Unclassified 2899
26 Ga0075435_100126374 3300007076 Bacteria 2137
27 Ga0111539_10022689 3300009094 Bacteria 7708
28 Ga0111539_10062787 3300009094 Bacteria 4396
29 Ga0157372_10344452 3300013307 Bacteria 1736
30 Ga0182007_10048869 3300015262 Bacteria 1398
31 Ga0183369_1014 3300015685 Bacteria 194173
32 Ga0206356_11480952 3300020070 Bacteria 757
33 Ga0207660_11034183 3300025917 Bacteria 670
34 Ga0207664_10102265 3300025929 Bacteria 2369
35 Ga0207428_10102257 3300027907 Bacteria 2213
36 Ga0207428_10121692 3300027907 Bacteria 2001
37 Ga0207428_10398003 3300027907 Unclassified 1009
38 Ga0316176_1074525 3300030732 Unclassified 585
39 Ga0316179_1077232 3300030734 Bacteria 727
40 Ga0316181_1286193 3300030744 Bacteria 919
41 Ga0307408_100007102 3300031548 Bacteria 7413
42 Ga0307408_100086355 3300031548 Bacteria 2358
43 Ga0307408_100575075 3300031548 Bacteria 997
44 Ga0307408_100762992 3300031548 Bacteria 875
45 Ga0307408_101568467 3300031548 Bacteria 624
46 Ga0307405_10078277 3300031731 Bacteria 2151
47 Ga0307405_10643735 3300031731 Bacteria 871
48 Ga0307413_10028105 3300031824 Bacteria 3126
49 Ga0307413_10033699 3300031824 Bacteria 2919
50 Ga0307413_10587443 3300031824 Bacteria 909
51 Ga0307410_10000494 3300031852 Bacteria 16018
52 Ga0307410_10031064 3300031852 Bacteria 3422
53 Ga0307410_10075074 3300031852 Bacteria 2356
54 Ga0307410_10767734 3300031852 Bacteria 817
55 Ga0307410_10932410 3300031852 Bacteria 745
56 Ga0307410_11735654 3300031852 Unclassified 554
57 Ga0307406_10000092 3300031901 Bacteria 50968
58 Ga0307406_10025049 3300031901 Bacteria 3568
59 Ga0307406_10534842 3300031901 Unclassified 956
60 Ga0307407_10027001 3300031903 Bacteria 3048
61 Ga0307407_10060805 3300031903 Bacteria 2206
62 Ga0307407_10129711 3300031903 Bacteria 1611
63 Ga0307407_10584283 3300031903 Bacteria 830
64 Ga0307412_10143317 3300031911 Bacteria 1753
65 Ga0307412_10393018 3300031911 Bacteria 1126
66 Ga0307412_10778243 3300031911 Bacteria 829
67 Ga0307409_100002455 3300031995 Bacteria 9701
68 Ga0307409_100020296 3300031995 Bacteria 4524
69 Ga0307409_100020427 3300031995 Bacteria 4513
70 Ga0307409_100314277 3300031995 Bacteria 1463
71 Ga0307409_100553055 3300031995 Bacteria 1130
72 Ga0307409_100586873 3300031995 Bacteria 1099
73 Ga0307409_100841769 3300031995 Unclassified 928
74 Ga0307409_102293966 3300031995 Unclassified 569
75 Ga0307416_100000069 3300032002 Bacteria 84159
76 Ga0307416_100006371 3300032002 Bacteria 7382
77 Ga0307416_100017767 3300032002 Bacteria 4988
78 Ga0307416_100026997 3300032002 Bacteria 4243
79 Ga0307416_100117332 3300032002 Bacteria 2362
80 Ga0307416_100211607 3300032002 Bacteria 1850
81 Ga0307416_100280627 3300032002 Bacteria 1642
82 Ga0307416_101118739 3300032002 Bacteria 892
83 Ga0307416_101206517 3300032002 Bacteria 862
84 Ga0307416_101735170 3300032002 Bacteria 729
85 Ga0307416_103425393 3300032002 Bacteria 531
86 Ga0307416_103738018 3300032002 Unclassified 509
87 Ga0307414_10021554 3300032004 Bacteria 4047
88 Ga0307414_10292686 3300032004 Bacteria 1373
89 Ga0307414_10974778 3300032004 Bacteria 780
90 Ga0307414_11017255 3300032004 Bacteria 763
91 Ga0307411_10007498 3300032005 Bacteria 5566
92 Ga0307411_10010431 3300032005 Bacteria 4953
93 Ga0307411_10152876 3300032005 Unclassified 1717
94 Ga0307411_10701288 3300032005 Bacteria 882
95 Ga0307411_11262115 3300032005 Bacteria 672
96 Ga0307415_100021550 3300032126 Bacteria 3963
97 Ga0307415_100088708 3300032126 Bacteria 2232
98 Ga0307415_100159888 3300032126 Bacteria 1745
99 Ga0307415_100574960 3300032126 Unclassified 998
100 Ga0307415_101326357 3300032126 Bacteria 682
101 Ga0307415_101701351 3300032126 Bacteria 608
102 Ga0307415_101711368 3300032126 Bacteria 607
103 Ga0451795_0882176 3300041456 Bacteria 588
104 Ga0451835_0960828 3300041492 Bacteria 616
105 Ga0451853_1991637 3300041512 Bacteria 690
106 Ga0466972_0011404 3300044658 Bacteria 4461
107 Ga0466972_0052044 3300044658 Bacteria 1974
108 Ga0466972_0127131 3300044658 Bacteria 1201
109 Ga0466965_0050189 3300044683 Bacteria 2068
110 Ga0466965_0052309 3300044683 Bacteria 2028
111 Ga0466965_0488673 3300044683 Bacteria 689
112 Ga0466966_0256114 3300044684 Bacteria 1054
113 Ga0466966_0298071 3300044684 Bacteria 969
114 Ga0466961_0049202 3300044693 Bacteria 2694
115 Ga0466961_0328169 3300044693 Bacteria 933
116 Ga0466963_0111959 3300044694 Bacteria 1874
117 Ga0466964_0036292 3300044706 Bacteria 1976
118 Ga0466971_0060741 3300044719 Bacteria 1708
119 Ga0466968_0048406 3300044735 Bacteria 1809
120 Ga0466970_0010814 3300044765 Bacteria 4640
121 Ga0466970_0111731 3300044765 Bacteria 1492
122 Ga0466970_0701272 3300044765 Bacteria 590
123 Ga0466957_0020387 3300044842 Bacteria 3900
124 Ga0466957_0061610 3300044842 Bacteria 2303
125 Ga0466960_0315163 3300044901 Bacteria 885
126 Ga0466959_0812775 3300045049 Bacteria 625
127 Ga0466958_0009840 3300045836 Bacteria 5336
128 Ga0466958_0180940 3300045836 Bacteria 1338
129 Ga0466967_0004325 3300045976 Bacteria 9551
130 Ga0466967_0060122 3300045976 Bacteria 3366
131 Ga0466967_0065837 3300045976 Bacteria 3227
132 Ga0466967_0136656 3300045976 Bacteria 2280
133 Ga0466967_0290934 3300045976 Bacteria 1569
134 Ga0466967_0348317 3300045976 Bacteria 1433
135 Ga0466967_0368573 3300045976 Bacteria 1393
136 Ga0466967_0409718 3300045976 Bacteria 1320
137 Ga0466967_2116240 3300045976 Bacteria 559
138 Ga0495611_0308021 3300046648 Bacteria 730
139 Ga0495670_0563505 3300046691 Unclassified 620
140 Ga0495677_0097869 3300047445 Bacteria 1109
141 Ga0496110_0059895 3300048913 Bacteria 3357
142 Ga0496111_0016239 3300048914 Bacteria 5130
143 Ga0501299_058664 3300049522 Archaea 811
144 Ga0501031_0811308 3300049568 Bacteria 600
145 Ga0501032_0041144 3300049569 Bacteria 3140
146 Ga0501033_0146824 3300049570 Bacteria 1703
147 Ga0501034_0021673 3300049571 Bacteria 6546
148 Ga0501034_0070591 3300049571 Bacteria 3504
149 Ga0501034_0200209 3300049571 Bacteria 1956
150 Ga0501036_0118540 3300049572 Bacteria 2235
151 Ga0501037_0101522 3300049573 Bacteria 2076
152 Ga0501037_0220421 3300049573 Bacteria 1335
153 Ga0501038_0052886 3300049574 Bacteria 3499
154 Ga0501039_0234446 3300049575 Bacteria 1443
155 Ga0501043_0046152 3300049579 Bacteria 3426
156 Ga0501046_0022811 3300049580 Bacteria 5155
157 Ga0501046_0218816 3300049580 Bacteria 1411
158 Ga0501046_0386964 3300049580 Bacteria 1011
159 Ga0501047_0187096 3300049581 Bacteria 1935
160 Ga0501048_0190996 3300049582 Bacteria 1451
161 Ga0501072_0560885 3300049588 Bacteria 902
162 Ga0501073_0470735 3300049589 Bacteria 869
163 Ga0501208_067214 3300049655 Bacteria 714
164 Ga0501211_036008 3300049658 Unclassified 575
165 Ga0501217_152877 3300049661 Bacteria 691
166 Ga0501243_032608 3300049675 Bacteria 894
167 Ga0501256_018533 3300049685 Unclassified 717
168 Ga0501259_040752 3300049688 Unclassified 912
169 Ga0501221_151391 3300049704 Unclassified 615
170 Ga0501225_0082808 3300049705 Archaea 923
171 Ga0501083_0391878 3300049744 Bacteria 904
172 Ga0501083_0779944 3300049744 Bacteria 622
173 Ga0501279_092505 3300049775 Unclassified 535
174 Ga0501035_0055000 3300049822 Bacteria 3554
175 Ga0501035_0383163 3300049822 Bacteria 1172
176 Ga0501044_0025444 3300049823 Bacteria 6273
177 Ga0501044_0214960 3300049823 Bacteria 1875
178 Ga0501044_0796798 3300049823 Bacteria 824
179 Ga0501044_0814499 3300049823 Bacteria 812
180 Ga0501045_0159388 3300049824 Bacteria 1679
181 Ga0501212_012020 3300049851 Bacteria 1255
182 nmdc:mga05p37_527223_c1 3300050507 Unclassified 1350
183 nmdc:mga05p37_887318_c1 3300050507 Bacteria 963
184 nmdc:mga09592_1007956_c1 3300050508 Unclassified 696
185 nmdc:mga08y16_36718_c1 3300050511 Bacteria 5146
186 nmdc:mga08y16_381318_c1 3300050511 Unclassified 1445
187 nmdc:mga08y16_60038_c1 3300050511 Bacteria 3972
188 nmdc:mga0n895_11804_c1 3300050512 Bacteria 7811
189 nmdc:mga0n895_144081_c1 3300050512 Bacteria 2412
190 nmdc:mga0rr50_323243_c1 3300050513 Bacteria 1294
191 nmdc:mga0rr50_37975_c1 3300050513 Bacteria 3481
192 nmdc:mga08x19_429372_c1 3300050514 Bacteria 929
193 nmdc:mga08x19_77424_c1 3300050514 Bacteria 2178
194 nmdc:mga0a205_15074_c1 3300050515 Bacteria 7218
195 nmdc:mga0a205_1537741_c1 3300050515 Unclassified 514
196 nmdc:mga0a205_65186_c1 3300050515 Bacteria 3519
197 Ga0501084_0000418 3300054114 Bacteria 32906
198 Ga0590075_148378 3300059424 Bacteria 618
199 Ga0466962_0006966 3300061719 Bacteria 5418
200 Ga0466962_0210227 3300061719 Bacteria 952
201 2857485569 2857481737 Bacteria 4761446
202 8056581429 8056579771 Bacteria 5840325
203 Ga0307412_12215378
204 LJQas_1004811
205 LJQas_1031791
206 LJQas_1050252
207 JGI25407J50210_10190654
208 Ga0070714_100002558
209 Ga0070681_10687385
210 Ga0070679_100255422
211 Ga0081455_10005045
212 Ga0081538_10038443
213 Ga0075432_10010817
214 Ga0075432_10113871
215 Ga0075428_100885145
216 Ga0075428_100959960
217 Ga0075430_100677715
218 Ga0075431_101248328
219 Ga0075433_10000490
220 Ga0075433_10103133
221 Ga0075433_10261778
222 Ga0075434_100000850
223 Ga0075434_100293983
224 Ga0075429_100750119
225 Ga0075436_100018146
226 Ga0075436_100535834
227 Ga0075435_100068083
228 Ga0075435_100126374
229 Ga0111539_10022689
230 Ga0111539_10062787
231 Ga0157372_10344452
232 Ga0182007_10048869
233 Ga0183369_1014
234 Ga0206356_11480952
235 Ga0207660_11034183
236 Ga0207664_10102265
237 Ga0207428_10102257
238 Ga0207428_10121692
239 Ga0207428_10398003
240 Ga0316176_1074525
241 Ga0316179_1077232
242 Ga0316181_1286193
243 Ga0307408_100007102
244 Ga0307408_100086355
245 Ga0307408_100575075
246 Ga0307408_100762992
247 Ga0307408_101568467
248 Ga0307405_10078277
249 Ga0307405_10643735
250 Ga0307413_10028105
251 Ga0307413_10033699
252 Ga0307413_10587443
253 Ga0307410_10000494
254 Ga0307410_10031064
255 Ga0307410_10075074
256 Ga0307410_10767734
257 Ga0307410_10932410
258 Ga0307410_11735654
259 Ga0307406_10000092
260 Ga0307406_10025049
261 Ga0307406_10534842
262 Ga0307407_10027001
263 Ga0307407_10060805
264 Ga0307407_10129711
265 Ga0307407_10584283
266 Ga0307412_10143317
267 Ga0307412_10393018
268 Ga0307412_10778243
269 Ga0307409_100002455
270 Ga0307409_100020296
271 Ga0307409_100020427
272 Ga0307409_100314277
273 Ga0307409_100553055
274 Ga0307409_100586873
275 Ga0307409_100841769
276 Ga0307409_102293966
277 Ga0307416_100000069
278 Ga0307416_100006371
279 Ga0307416_100017767
280 Ga0307416_100026997
281 Ga0307416_100117332
282 Ga0307416_100211607
283 Ga0307416_100280627
284 Ga0307416_101118739
285 Ga0307416_101206517
286 Ga0307416_101735170
287 Ga0307416_103425393
288 Ga0307416_103738018
289 Ga0307414_10021554
290 Ga0307414_10292686
291 Ga0307414_10974778
292 Ga0307414_11017255
293 Ga0307411_10007498
294 Ga0307411_10010431
295 Ga0307411_10152876
296 Ga0307411_10701288
297 Ga0307411_11262115
298 Ga0307415_100021550
299 Ga0307415_100088708
300 Ga0307415_100159888
301 Ga0307415_100574960
302 Ga0307415_101326357
303 Ga0307415_101701351
304 Ga0307415_101711368
305 Ga0451795_0882176
306 Ga0451835_0960828
307 Ga0451853_1991637
308 Ga0466972_0011404
309 Ga0466972_0052044
310 Ga0466972_0127131
311 Ga0466965_0050189
312 Ga0466965_0052309
313 Ga0466965_0488673
314 Ga0466966_0256114
315 Ga0466966_0298071
316 Ga0466961_0049202
317 Ga0466961_0328169
318 Ga0466963_0111959
319 Ga0466964_0036292
320 Ga0466971_0060741
321 Ga0466968_0048406
322 Ga0466970_0010814
323 Ga0466970_0111731
324 Ga0466970_0701272
325 Ga0466957_0020387
326 Ga0466957_0061610
327 Ga0466960_0315163
328 Ga0466959_0812775
329 Ga0466958_0009840
330 Ga0466958_0180940
331 Ga0466967_0004325
332 Ga0466967_0060122
333 Ga0466967_0065837
334 Ga0466967_0136656
335 Ga0466967_0290934
336 Ga0466967_0348317
337 Ga0466967_0368573
338 Ga0466967_0409718
339 Ga0466967_2116240
340 Ga0495611_0308021
341 Ga0495670_0563505
342 Ga0495677_0097869
343 Ga0496110_0059895
344 Ga0496111_0016239
345 Ga0501299_058664
346 Ga0501031_0811308
347 Ga0501032_0041144
348 Ga0501033_0146824
349 Ga0501034_0021673
350 Ga0501034_0070591
351 Ga0501034_0200209
352 Ga0501036_0118540
353 Ga0501037_0101522
354 Ga0501037_0220421
355 Ga0501038_0052886
356 Ga0501039_0234446
357 Ga0501043_0046152
358 Ga0501046_0022811
359 Ga0501046_0218816
360 Ga0501046_0386964
361 Ga0501047_0187096
362 Ga0501048_0190996
363 Ga0501072_0560885
364 Ga0501073_0470735
365 Ga0501208_067214
366 Ga0501211_036008
367 Ga0501217_152877
368 Ga0501243_032608
369 Ga0501256_018533
370 Ga0501259_040752
371 Ga0501221_151391
372 Ga0501225_0082808
373 Ga0501083_0391878
374 Ga0501083_0779944
375 Ga0501279_092505
376 Ga0501035_0055000
377 Ga0501035_0383163
378 Ga0501044_0025444
379 Ga0501044_0214960
380 Ga0501044_0796798
381 Ga0501044_0814499
382 Ga0501045_0159388
383 Ga0501212_012020
384 nmdc:mga05p37_527223_c1
385 nmdc:mga05p37_887318_c1
386 nmdc:mga09592_1007956_c1
387 nmdc:mga08y16_36718_c1
388 nmdc:mga08y16_381318_c1
389 nmdc:mga08y16_60038_c1
390 nmdc:mga0n895_11804_c1
391 nmdc:mga0n895_144081_c1
392 nmdc:mga0rr50_323243_c1
393 nmdc:mga0rr50_37975_c1
394 nmdc:mga08x19_429372_c1
395 nmdc:mga08x19_77424_c1
396 nmdc:mga0a205_15074_c1
397 nmdc:mga0a205_1537741_c1
398 nmdc:mga0a205_65186_c1
399 Ga0501084_0000418
400 Ga0590075_148378
401 Ga0466962_0006966
402 Ga0466962_0210227
403 2857485569
404 8056581429

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1glv-assembly1.cif.gz_A three-dimensional structure of the glutathione synthetase from escherichia coli b at 2.0 angstroms resolution 0.4914 3 67
5zq3-assembly1.cif.gz_A pde-ubiquitin 0.4775 18 67
2glt-assembly1.cif.gz_A structure of escherichia coli glutathione synthetase at ph 6.0. 0.4709 3 48
1gos-assembly1.cif.gz_B human monoamine oxidase b 0.4558 4 29
3orr-assembly1.cif.gz_B crystal structure of n5-carboxyaminoimidazole synthetase from staphylococcus aureus 0.4492 3 66
ID Description Score Start End Superfamily
af_P9WQL3_282_354_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.6052 69 91 2.40.50.100
af_Q9Y817_1_363_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.5704 68 92 2.130.10.10
af_P00393_5_413_3.50.50.100 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; 0.5533 67 91 3.50.50.100
2cvhB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.4843 69 91 3.40.50.300
af_O55230_66_320_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.4836 68 90 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A521S1S1-F1-model_v4 1,4-alpha-glucan branching enzyme 0.9692 3 92
AF-A0A1H6T2M9-F1-model_v4 1,4-alpha-glucan branching enzyme 0.945 3 92
AF-A0A2P6WJC2-F1-model_v4 1,4-alpha-glucan branching enzyme 0.944 6 91
AF-A0A1Q8CXU1-F1-model_v4 Rho termination factor-like N-terminal domain-containing protein 0.9434 3 91 GO:0006353
AF-Q2IPC2-F1-model_v4 1,4-alpha-glucan branching enzyme 0.9428 1 92

Map