F310073

General Info

Members Datasets Scaffolds Average Seq Length
202 126 202 77

Family's Representative Sequence

Representative Sequence 3300031852|Ga0307410_10301380|Ga0307410_103013802
Length 77
Sequence MKLVQVYNTFSSADANLVCSSLQSAGIAAQVTNELSSLSLDGYALASGGIRVMVPEEQFAEARAIIDQANETPPETE

Samples

Sample ID Description Type Environment
1 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
85 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
86 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
87 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
88 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
89 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
90 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
91 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
95 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
96 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
97 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
98 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
99 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
100 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
101 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
102 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
103 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
104 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
105 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
106 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
107 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
108 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
109 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
110 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
111 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
112 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
113 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
114 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
115 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
116 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
117 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
118 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
119 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
120 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
121 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
122 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
123 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
124 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
125 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
126 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0.5
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.5
Stem 0
Stem Tuber 0
Unclassified 0.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058860_11533711 3300004801 Bacteria 715
2 Ga0065707_10021777 3300005295 Bacteria 1361
3 Ga0070658_10836046 3300005327 Unclassified 800
4 Ga0070683_100708460 3300005329 Unclassified 964
5 Ga0070683_100777023 3300005329 Unclassified 918
6 Ga0070690_100063477 3300005330 Bacteria 2384
7 Ga0070690_100738966 3300005330 Bacteria 759
8 Ga0070690_101129286 3300005330 Bacteria 623
9 Ga0070690_101351548 3300005330 Unclassified 572
10 Ga0070690_101386747 3300005330 Unclassified 565
11 Ga0070690_101598954 3300005330 Unclassified 528
12 Ga0070670_101127625 3300005331 Unclassified 716
13 Ga0070680_101071590 3300005336 Unclassified 696
14 Ga0068868_102173993 3300005338 Bacteria 528
15 Ga0070689_100009494 3300005340 Bacteria 6898
16 Ga0070689_100079703 3300005340 Bacteria 2569
17 Ga0070689_100105257 3300005340 Bacteria 2238
18 Ga0070689_100148382 3300005340 Bacteria 1890
19 Ga0070689_100252786 3300005340 Unclassified 1455
20 Ga0070689_101608271 3300005340 Unclassified 590
21 Ga0070691_10681217 3300005341 Bacteria 615
22 Ga0070673_102362962 3300005364 Bacteria 505
23 Ga0070688_100246360 3300005365 Bacteria 1271
24 Ga0070688_100294587 3300005365 Bacteria 1171
25 Ga0070688_101609104 3300005365 Unclassified 530
26 Ga0070701_10939620 3300005438 Unclassified 599
27 Ga0070711_100901338 3300005439 Unclassified 755
28 Ga0070711_101105129 3300005439 Unclassified 683
29 Ga0070705_100559300 3300005440 Bacteria 878
30 Ga0070694_101668207 3300005444 Unclassified 542
31 Ga0070694_101854618 3300005444 Unclassified 514
32 Ga0070694_101900252 3300005444 Unclassified 508
33 Ga0070708_100077665 3300005445 Bacteria 3000
34 Ga0070681_10110308 3300005458 Unclassified 2691
35 Ga0068867_100631794 3300005459 Bacteria 937
36 Ga0068867_101187628 3300005459 Unclassified 700
37 Ga0070685_10290410 3300005466 Bacteria 1098
38 Ga0070685_10505550 3300005466 Unclassified 856
39 Ga0070685_11196072 3300005466 Unclassified 577
40 Ga0070707_100250066 3300005468 Bacteria 1725
41 Ga0070699_101126303 3300005518 Bacteria 720
42 Ga0070679_101565741 3300005530 Unclassified 606
43 Ga0070684_101803393 3300005535 Unclassified 577
44 Ga0070704_100165304 3300005549 Bacteria 1754
45 Ga0070704_100808547 3300005549 Bacteria 838
46 Ga0068855_100208076 3300005563 Bacteria 2200
47 Ga0068855_100516764 3300005563 Bacteria 1296
48 Ga0068856_100079071 3300005614 Bacteria 3261
49 Ga0070702_100186903 3300005615 Bacteria 1360
50 Ga0068859_100052334 3300005617 Bacteria 4105
51 Ga0068859_100052629 3300005617 Unclassified 4094
52 Ga0068859_100829359 3300005617 Bacteria 1011
53 Ga0068859_101304368 3300005617 Bacteria 800
54 Ga0068859_101517231 3300005617 Unclassified 740
55 Ga0068864_102529642 3300005618 Unclassified 519
56 Ga0068864_102598887 3300005618 Unclassified 512
57 Ga0068861_101460737 3300005719 Bacteria 670
58 Ga0068863_100009412 3300005841 Bacteria 9537
59 Ga0068863_100996709 3300005841 Bacteria 840
60 Ga0068863_101030867 3300005841 Bacteria 826
61 Ga0068858_101162093 3300005842 Unclassified 758
62 Ga0068858_101306850 3300005842 Unclassified 714
63 Ga0068860_100421600 3300005843 Bacteria 1323
64 Ga0068860_102084578 3300005843 Unclassified 588
65 Ga0068862_100048391 3300005844 Bacteria 3630
66 Ga0081455_10593815 3300005937 Unclassified 723
67 Ga0070715_10913069 3300006163 Unclassified 541
68 Ga0097621_100228982 3300006237 Bacteria 1622
69 Ga0097621_101641881 3300006237 Unclassified 611
70 Ga0068871_101447593 3300006358 Bacteria 648
71 Ga0075428_100458061 3300006844 Bacteria 1366
72 Ga0075431_100028225 3300006847 Bacteria 5763
73 Ga0075434_100610918 3300006871 Unclassified 1109
74 Ga0075434_101128014 3300006871 Unclassified 797
75 Ga0075429_100154407 3300006880 Bacteria 2010
76 Ga0068865_100285233 3300006881 Unclassified 1316
77 Ga0097620_100052333 3300006931 Bacteria 4105
78 Ga0097620_100052630 3300006931 Unclassified 4094
79 Ga0097620_100829297 3300006931 Bacteria 1011
80 Ga0097620_101304557 3300006931 Bacteria 800
81 Ga0097620_101517398 3300006931 Unclassified 740
82 Ga0111539_10180195 3300009094 Bacteria 2468
83 Ga0111539_10306520 3300009094 Bacteria 1848
84 Ga0105245_11441266 3300009098 Unclassified 739
85 Ga0114129_12638518 3300009147 Unclassified 599
86 Ga0105241_10300532 3300009174 Bacteria 1377
87 Ga0105242_10439605 3300009176 Bacteria 1227
88 Ga0105238_10095239 3300009551 Bacteria 2964
89 Ga0105249_13417563 3300009553 Unclassified 511
90 Ga0105239_11213015 3300010375 Bacteria 869
91 Ga0105246_10813400 3300011119 Unclassified 830
92 Ga0157374_10050451 3300013296 Bacteria 3868
93 Ga0157374_10057714 3300013296 Bacteria 3626
94 Ga0157378_10479944 3300013297 Bacteria 1238
95 Ga0163162_11320384 3300013306 Unclassified 820
96 Ga0163162_11342603 3300013306 Unclassified 813
97 Ga0157375_10000006 3300013308 Bacteria 384086
98 Ga0157375_10345739 3300013308 Bacteria 1653
99 Ga0163163_10000147 3300014325 Bacteria 73154
100 Ga0163163_11004414 3300014325 Unclassified 898
101 Ga0157377_10703463 3300014745 Bacteria 734
102 Ga0157379_11990573 3300014968 Unclassified 574
103 Ga0157376_10969916 3300014969 Unclassified 871
104 Ga0157376_12197921 3300014969 Unclassified 590
105 Ga0207685_10714640 3300025905 Unclassified 546
106 Ga0207684_10748287 3300025910 Unclassified 829
107 Ga0207695_10078116 3300025913 Bacteria 3359
108 Ga0207663_11207430 3300025916 Unclassified 609
109 Ga0207660_11291117 3300025917 Unclassified 593
110 Ga0207646_11198472 3300025922 Bacteria 666
111 Ga0207694_10141584 3300025924 Unclassified 1934
112 Ga0207644_11648349 3300025931 Unclassified 538
113 Ga0207670_10013644 3300025936 Bacteria 4798
114 Ga0207670_10161357 3300025936 Bacteria 1673
115 Ga0207670_10234743 3300025936 Bacteria 1410
116 Ga0207670_10299913 3300025936 Bacteria 1258
117 Ga0207670_10611797 3300025936 Unclassified 895
118 Ga0207670_11387747 3300025936 Unclassified 596
119 Ga0207670_11440440 3300025936 Bacteria 585
120 Ga0207704_11309552 3300025938 Unclassified 619
121 Ga0207661_10661365 3300025944 Unclassified 960
122 Ga0207667_11482009 3300025949 Bacteria 650
123 Ga0207667_11939623 3300025949 Unclassified 550
124 Ga0207703_10701278 3300026035 Unclassified 963
125 Ga0207703_11502781 3300026035 Bacteria 648
126 Ga0207703_11775625 3300026035 Unclassified 593
127 Ga0207708_11234086 3300026075 Bacteria 654
128 Ga0207702_10582565 3300026078 Unclassified 1097
129 Ga0207702_12094919 3300026078 Unclassified 555
130 Ga0207641_10347732 3300026088 Bacteria 1412
131 Ga0207641_11094939 3300026088 Bacteria 795
132 Ga0207648_10133039 3300026089 Bacteria 2189
133 Ga0207648_10681430 3300026089 Bacteria 952
134 Ga0207676_12076654 3300026095 Unclassified 567
135 Ga0207675_101586281 3300026118 Bacteria 675
136 Ga0268265_10080288 3300028380 Bacteria 2572
137 Ga0268264_10449840 3300028381 Bacteria 1248
138 Ga0268264_11843485 3300028381 Unclassified 615
139 Ga0265323_10031950 3300028653 Bacteria 1954
140 Ga0265322_10172186 3300028654 Unclassified 619
141 Ga0265338_10020104 3300028800 Bacteria 7041
142 Ga0265338_10046845 3300028800 Bacteria 3956
143 Ga0265338_10479016 3300028800 Unclassified 878
144 Ga0265320_10138271 3300031240 Bacteria 1104
145 Ga0265316_10394754 3300031344 Bacteria 997
146 Ga0265316_10593956 3300031344 Unclassified 785
147 Ga0316577_10291295 3300031733 Bacteria 925
148 Ga0307410_10301380 3300031852 Unclassified 1265
149 Ga0307406_10808360 3300031901 Unclassified 792
150 Ga0307412_10407803 3300031911 Unclassified 1108
151 Ga0307416_100141653 3300032002 Bacteria 2187
152 Ga0307414_11390231 3300032004 Unclassified 652
153 Ga0316580_10135207 3300032139 Bacteria 756
154 Ga0373943_0205966 3300035170 Bacteria 1090
155 Ga0373946_0726485 3300035171 Unclassified 520
156 Ga0373931_0061859 3300035691 Bacteria 2020
157 Ga0373931_0709943 3300035691 Bacteria 665
158 Ga0373931_0954293 3300035691 Unclassified 578
159 Ga0373935_0167969 3300035692 Unclassified 1499
160 Ga0373927_0304757 3300035695 Bacteria 1048
161 Ga0373927_0994587 3300035695 Unclassified 553
162 Ga0373947_0313388 3300035725 Bacteria 1048
163 Ga0373937_0146604 3300036401 Bacteria 2210
164 Ga0316582_0202968 3300036647 Bacteria 1353
165 Ga0316584_0152663 3300036712 Bacteria 1719
166 Ga0373925_0255490 3300037068 Bacteria 1406
167 Ga0373925_0772949 3300037068 Unclassified 792
168 Ga0373925_0907123 3300037068 Bacteria 726
169 Ga0451577_0002655 3300042876 Bacteria 20946
170 Ga0451577_0837861 3300042876 Unclassified 830
171 Ga0451577_1090075 3300042876 Bacteria 715
172 Ga0451577_1990990 3300042876 Unclassified 508
173 Ga0453684_0031943 3300044712 Bacteria 7382
174 Ga0453684_0724499 3300044712 Bacteria 1079
175 Ga0451576_0211893 3300045051 Bacteria 2023
176 Ga0451576_0513827 3300045051 Bacteria 1258
177 Ga0451576_0589428 3300045051 Bacteria 1168
178 Ga0451576_1279821 3300045051 Unclassified 765
179 Ga0451576_1336318 3300045051 Bacteria 747
180 Ga0495594_0846207 3300046499 Bacteria 515
181 Ga0495630_0685821 3300046517 Unclassified 784
182 Ga0495630_0911404 3300046517 Bacteria 669
183 Ga0495666_0213794 3300046526 Unclassified 884
184 Ga0495586_0342132 3300046535 Unclassified 859
185 Ga0495621_0170236 3300046539 Bacteria 865
186 Ga0495656_0594211 3300046615 Unclassified 592
187 Ga0495588_0537849 3300046674 Unclassified 612
188 Ga0495658_0699901 3300046683 Bacteria 649
189 Ga0495613_0142357 3300046689 Bacteria 1713
190 Ga0495675_0239330 3300047444 Bacteria 1093
191 Ga0495684_0864684 3300047471 Unclassified 585
192 Ga0501250_048296 3300049680 Unclassified 646
193 nmdc:mga09592_72052_c1 3300050508 Bacteria 2933
194 nmdc:mga06r32_500052_c1 3300050510 Bacteria 1193
195 nmdc:mga08y16_230347_c1 3300050511 Bacteria 1916
196 nmdc:mga08y16_555914_c1 3300050511 Bacteria 1161
197 nmdc:mga08y16_735744_c1 3300050511 Bacteria 983
198 nmdc:mga0n895_899426_c1 3300050512 Unclassified 871
199 nmdc:mga0a205_1600075_c1 3300050515 Unclassified 500
200 nmdc:mga0a205_434825_c1 3300050515 Unclassified 871
201 nmdc:mga0a205_732693_c1 3300050515 Bacteria 837
202 Ga0590075_046521 3300059424 Unclassified 1112

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005365 Ga0070688_101609104 Ga0070688_1016091042 70
2 3300025936 Ga0207670_10611797 Ga0207670_106117972 70
3 3300005327 Ga0070658_10836046 Ga0070658_108360462 71
4 3300005329 Ga0070683_100708460 Ga0070683_1007084601 71
5 3300005330 Ga0070690_101386747 Ga0070690_1013867472 71
6 3300005341 Ga0070691_10681217 Ga0070691_106812172 71
7 3300005364 Ga0070673_102362962 Ga0070673_1023629622 71
8 3300005458 Ga0070681_10110308 Ga0070681_101103082 71
9 3300005563 Ga0068855_100208076 Ga0068855_1002080762 71
10 3300005563 Ga0068855_100516764 Ga0068855_1005167642 71
11 3300005614 Ga0068856_100079071 Ga0068856_1000790712 71
12 3300005842 Ga0068858_101306850 Ga0068858_1013068502 71
13 3300006237 Ga0097621_100228982 Ga0097621_1002289822 71
14 3300006237 Ga0097621_101641881 Ga0097621_1016418811 71
15 3300006358 Ga0068871_101447593 Ga0068871_1014475931 71
16 3300009094 Ga0111539_10306520 Ga0111539_103065202 71
17 3300009551 Ga0105238_10095239 Ga0105238_100952392 71
18 3300010375 Ga0105239_11213015 Ga0105239_112130152 71
19 3300013308 Ga0157375_10345739 Ga0157375_103457392 71
20 3300014325 Ga0163163_10000147 Ga0163163_100001476 71
21 3300025924 Ga0207694_10141584 Ga0207694_101415842 71
22 3300025944 Ga0207661_10661365 Ga0207661_106613652 71
23 3300025949 Ga0207667_11482009 Ga0207667_114820092 71
24 3300025949 Ga0207667_11939623 Ga0207667_119396232 71
25 3300026035 Ga0207703_11775625 Ga0207703_117756252 71
26 3300026078 Ga0207702_10582565 Ga0207702_105825652 71
27 3300050511 nmdc:mga08y16_555914_c1 nmdc:mga08y16_555914_c1_644_862 71
28 3300050515 nmdc:mga0a205_1600075_c1 nmdc:mga0a205_1600075_c1_64_303 71
29 3300005468 Ga0070707_100250066 Ga0070707_1002500662 72
30 3300006871 Ga0075434_101128014 Ga0075434_1011280142 72
31 3300009553 Ga0105249_13417563 Ga0105249_134175632 72
32 3300025922 Ga0207646_11198472 Ga0207646_111984721 72
33 3300036401 Ga0373937_0146604 Ga0373937_0146604_282_521 72
34 3300037068 Ga0373925_0772949 Ga0373925_0772949_308_547 72
35 3300042876 Ga0451577_1090075 Ga0451577_1090075_146_379 72
36 3300046517 Ga0495630_0685821 Ga0495630_0685821_427_645 72
37 3300047471 Ga0495684_0864684 Ga0495684_0864684_207_446 72
38 3300005329 Ga0070683_100777023 Ga0070683_1007770232 73
39 3300005330 Ga0070690_101351548 Ga0070690_1013515482 73
40 3300005330 Ga0070690_101598954 Ga0070690_1015989541 73
41 3300005331 Ga0070670_101127625 Ga0070670_1011276252 73
42 3300005336 Ga0070680_101071590 Ga0070680_1010715902 73
43 3300005340 Ga0070689_100105257 Ga0070689_1001052572 73
44 3300005340 Ga0070689_100148382 Ga0070689_1001483823 73
45 3300005439 Ga0070711_100901338 Ga0070711_1009013382 73
46 3300005439 Ga0070711_101105129 Ga0070711_1011051291 73
47 3300005444 Ga0070694_101668207 Ga0070694_1016682071 73
48 3300005444 Ga0070694_101854618 Ga0070694_1018546181 73
49 3300005444 Ga0070694_101900252 Ga0070694_1019002521 73
50 3300005459 Ga0068867_100631794 Ga0068867_1006317942 73
51 3300005466 Ga0070685_10290410 Ga0070685_102904102 73
52 3300005466 Ga0070685_10505550 Ga0070685_105055502 73
53 3300005466 Ga0070685_11196072 Ga0070685_111960722 73
54 3300005530 Ga0070679_101565741 Ga0070679_1015657412 73
55 3300005535 Ga0070684_101803393 Ga0070684_1018033931 73
56 3300005549 Ga0070704_100165304 Ga0070704_1001653042 73
57 3300005617 Ga0068859_100052334 Ga0068859_1000523344 73
58 3300005617 Ga0068859_100052629 Ga0068859_1000526292 73
59 3300005617 Ga0068859_101304368 Ga0068859_1013043682 73
60 3300005618 Ga0068864_102529642 Ga0068864_1025296422 73
61 3300005618 Ga0068864_102598887 Ga0068864_1025988872 73
62 3300005719 Ga0068861_101460737 Ga0068861_1014607372 73
63 3300005841 Ga0068863_101030867 Ga0068863_1010308672 73
64 3300005842 Ga0068858_101162093 Ga0068858_1011620932 73
65 3300005843 Ga0068860_100421600 Ga0068860_1004216002 73
66 3300005843 Ga0068860_102084578 Ga0068860_1020845782 73
67 3300005844 Ga0068862_100048391 Ga0068862_1000483912 73
68 3300005937 Ga0081455_10593815 Ga0081455_105938152 73
69 3300006163 Ga0070715_10913069 Ga0070715_109130692 73
70 3300006931 Ga0097620_100052333 Ga0097620_1000523333 73
71 3300006931 Ga0097620_100052630 Ga0097620_1000526302 73
72 3300006931 Ga0097620_101304557 Ga0097620_1013045572 73
73 3300009098 Ga0105245_11441266 Ga0105245_114412661 73
74 3300009176 Ga0105242_10439605 Ga0105242_104396051 73
75 3300011119 Ga0105246_10813400 Ga0105246_108134002 73
76 3300013296 Ga0157374_10050451 Ga0157374_100504512 73
77 3300013296 Ga0157374_10057714 Ga0157374_100577145 73
78 3300013297 Ga0157378_10479944 Ga0157378_104799441 73
79 3300013306 Ga0163162_11320384 Ga0163162_113203842 73
80 3300013308 Ga0157375_10000006 Ga0157375_10000006314 73
81 3300014325 Ga0163163_11004414 Ga0163163_110044142 73
82 3300014745 Ga0157377_10703463 Ga0157377_107034631 73
83 3300014968 Ga0157379_11990573 Ga0157379_119905732 73
84 3300014969 Ga0157376_10969916 Ga0157376_109699162 73
85 3300014969 Ga0157376_12197921 Ga0157376_121979212 73
86 3300025905 Ga0207685_10714640 Ga0207685_107146402 73
87 3300025910 Ga0207684_10748287 Ga0207684_107482872 73
88 3300025913 Ga0207695_10078116 Ga0207695_100781162 73
89 3300025916 Ga0207663_11207430 Ga0207663_112074302 73
90 3300025917 Ga0207660_11291117 Ga0207660_112911172 73
91 3300025931 Ga0207644_11648349 Ga0207644_116483492 73
92 3300025936 Ga0207670_10161357 Ga0207670_101613572 73
93 3300025936 Ga0207670_10299913 Ga0207670_102999132 73
94 3300026035 Ga0207703_10701278 Ga0207703_107012782 73
95 3300026035 Ga0207703_11502781 Ga0207703_115027811 73
96 3300026088 Ga0207641_11094939 Ga0207641_110949392 73
97 3300026089 Ga0207648_10681430 Ga0207648_106814302 73
98 3300026095 Ga0207676_12076654 Ga0207676_120766542 73
99 3300026118 Ga0207675_101586281 Ga0207675_1015862812 73
100 3300028380 Ga0268265_10080288 Ga0268265_100802882 73
101 3300028381 Ga0268264_10449840 Ga0268264_104498402 73
102 3300028381 Ga0268264_11843485 Ga0268264_118434852 73
103 3300028800 Ga0265338_10020104 Ga0265338_100201042 73
104 3300028800 Ga0265338_10046845 Ga0265338_100468455 73
105 3300031240 Ga0265320_10138271 Ga0265320_101382712 73
106 3300031344 Ga0265316_10593956 Ga0265316_105939562 73
107 3300031733 Ga0316577_10291295 Ga0316577_102912952 73
108 3300032139 Ga0316580_10135207 Ga0316580_101352072 73
109 3300035170 Ga0373943_0205966 Ga0373943_0205966_789_1034 73
110 3300035171 Ga0373946_0726485 Ga0373946_0726485_113_358 73
111 3300035691 Ga0373931_0061859 Ga0373931_0061859_1530_1790 73
112 3300035691 Ga0373931_0709943 Ga0373931_0709943_288_512 73
113 3300035691 Ga0373931_0954293 Ga0373931_0954293_77_298 73
114 3300035692 Ga0373935_0167969 Ga0373935_0167969_719_964 73
115 3300035695 Ga0373927_0304757 Ga0373927_0304757_205_450 73
116 3300035695 Ga0373927_0994587 Ga0373927_0994587_211_450 73
117 3300035725 Ga0373947_0313388 Ga0373947_0313388_753_998 73
118 3300036647 Ga0316582_0202968 Ga0316582_0202968_897_1133 73
119 3300036712 Ga0316584_0152663 Ga0316584_0152663_1384_1620 73
120 3300037068 Ga0373925_0255490 Ga0373925_0255490_472_717 73
121 3300042876 Ga0451577_0002655 Ga0451577_0002655_16461_16697 73
122 3300042876 Ga0451577_0837861 Ga0451577_0837861_251_475 73
123 3300042876 Ga0451577_1990990 Ga0451577_1990990_70_294 73
124 3300044712 Ga0453684_0031943 Ga0453684_0031943_190_426 73
125 3300044712 Ga0453684_0724499 Ga0453684_0724499_663_887 73
126 3300045051 Ga0451576_0513827 Ga0451576_0513827_467_709 73
127 3300045051 Ga0451576_1279821 Ga0451576_1279821_249_473 73
128 3300046499 Ga0495594_0846207 Ga0495594_0846207_168_401 73
129 3300046526 Ga0495666_0213794 Ga0495666_0213794_102_347 73
130 3300046535 Ga0495586_0342132 Ga0495586_0342132_271_495 73
131 3300046539 Ga0495621_0170236 Ga0495621_0170236_572_814 73
132 3300046615 Ga0495656_0594211 Ga0495656_0594211_97_339 73
133 3300046683 Ga0495658_0699901 Ga0495658_0699901_141_380 73
134 3300046689 Ga0495613_0142357 Ga0495613_0142357_1401_1637 73
135 3300047444 Ga0495675_0239330 Ga0495675_0239330_697_933 73
136 3300050511 nmdc:mga08y16_735744_c1 nmdc:mga08y16_735744_c1_414_656 73
137 3300050515 nmdc:mga0a205_434825_c1 nmdc:mga0a205_434825_c1_141_401 73
138 3300004801 Ga0058860_11533711 Ga0058860_115337112 74
139 3300005295 Ga0065707_10021777 Ga0065707_100217772 74
140 3300005330 Ga0070690_100063477 Ga0070690_1000634772 74
141 3300005330 Ga0070690_100738966 Ga0070690_1007389662 74
142 3300005330 Ga0070690_101129286 Ga0070690_1011292862 74
143 3300005338 Ga0068868_102173993 Ga0068868_1021739932 74
144 3300005340 Ga0070689_100009494 Ga0070689_1000094945 74
145 3300005340 Ga0070689_100079703 Ga0070689_1000797033 74
146 3300005340 Ga0070689_100252786 Ga0070689_1002527862 74
147 3300005340 Ga0070689_101608271 Ga0070689_1016082711 74
148 3300005365 Ga0070688_100246360 Ga0070688_1002463602 74
149 3300005365 Ga0070688_100294587 Ga0070688_1002945872 74
150 3300005438 Ga0070701_10939620 Ga0070701_109396202 74
151 3300005440 Ga0070705_100559300 Ga0070705_1005593002 74
152 3300005445 Ga0070708_100077665 Ga0070708_1000776653 74
153 3300005459 Ga0068867_101187628 Ga0068867_1011876282 74
154 3300005518 Ga0070699_101126303 Ga0070699_1011263032 74
155 3300005549 Ga0070704_100808547 Ga0070704_1008085472 74
156 3300005615 Ga0070702_100186903 Ga0070702_1001869032 74
157 3300005617 Ga0068859_100829359 Ga0068859_1008293592 74
158 3300005617 Ga0068859_101517231 Ga0068859_1015172312 74
159 3300005841 Ga0068863_100009412 Ga0068863_1000094122 74
160 3300005841 Ga0068863_100996709 Ga0068863_1009967092 74
161 3300006844 Ga0075428_100458061 Ga0075428_1004580612 74
162 3300006847 Ga0075431_100028225 Ga0075431_1000282257 74
163 3300006871 Ga0075434_100610918 Ga0075434_1006109182 74
164 3300006880 Ga0075429_100154407 Ga0075429_1001544073 74
165 3300006881 Ga0068865_100285233 Ga0068865_1002852332 74
166 3300006931 Ga0097620_100829297 Ga0097620_1008292972 74
167 3300006931 Ga0097620_101517398 Ga0097620_1015173982 74
168 3300009094 Ga0111539_10180195 Ga0111539_101801952 74
169 3300009147 Ga0114129_12638518 Ga0114129_126385182 74
170 3300009174 Ga0105241_10300532 Ga0105241_103005323 74
171 3300013306 Ga0163162_11342603 Ga0163162_113426032 74
172 3300025936 Ga0207670_10013644 Ga0207670_100136442 74
173 3300025936 Ga0207670_10234743 Ga0207670_102347432 74
174 3300025936 Ga0207670_11387747 Ga0207670_113877472 74
175 3300025936 Ga0207670_11440440 Ga0207670_114404401 74
176 3300025938 Ga0207704_11309552 Ga0207704_113095521 74
177 3300026075 Ga0207708_11234086 Ga0207708_112340862 74
178 3300026078 Ga0207702_12094919 Ga0207702_120949191 74
179 3300026088 Ga0207641_10347732 Ga0207641_103477322 74
180 3300026089 Ga0207648_10133039 Ga0207648_101330393 74
181 3300028653 Ga0265323_10031950 Ga0265323_100319502 74
182 3300028654 Ga0265322_10172186 Ga0265322_101721861 74
183 3300028800 Ga0265338_10479016 Ga0265338_104790162 74
184 3300031344 Ga0265316_10394754 Ga0265316_103947542 74
185 3300031852 Ga0307410_10301380 Ga0307410_103013802 74
186 3300031901 Ga0307406_10808360 Ga0307406_108083602 74
187 3300031911 Ga0307412_10407803 Ga0307412_104078032 74
188 3300032002 Ga0307416_100141653 Ga0307416_1001416533 74
189 3300032004 Ga0307414_11390231 Ga0307414_113902311 74
190 3300037068 Ga0373925_0907123 Ga0373925_0907123_398_628 74
191 3300045051 Ga0451576_0211893 Ga0451576_0211893_1024_1248 74
192 3300045051 Ga0451576_0589428 Ga0451576_0589428_232_468 74
193 3300045051 Ga0451576_1336318 Ga0451576_1336318_62_286 74
194 3300046517 Ga0495630_0911404 Ga0495630_0911404_343_585 74
195 3300046674 Ga0495588_0537849 Ga0495588_0537849_196_438 74
196 3300049680 Ga0501250_048296 Ga0501250_048296_294_527 74
197 3300050508 nmdc:mga09592_72052_c1 nmdc:mga09592_72052_c1_1312_1539 74
198 3300050510 nmdc:mga06r32_500052_c1 nmdc:mga06r32_500052_c1_21_248 74
199 3300050511 nmdc:mga08y16_230347_c1 nmdc:mga08y16_230347_c1_1328_1552 74
200 3300050512 nmdc:mga0n895_899426_c1 nmdc:mga0n895_899426_c1_25_270 74
201 3300050515 nmdc:mga0a205_732693_c1 nmdc:mga0a205_732693_c1_24_284 74
202 3300059424 Ga0590075_046521 Ga0590075_046521_214_447 74

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09413

DUF2007

Putative prokaryotic signal transducing protein

3

70

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4w4m-assembly10.cif.gz_J crystal structure of prgk 19-92 0.8938 2 70
8axn-assembly1.cif.gz_a inner membrane ring and secretin n0 n1 domains of the type 3 secretion system of shigella flexneri 0.8775 2 70
2y9j-assembly1.cif.gz_Y three-dimensional model of salmonella's needle complex at subnanometer resolution 0.8602 4 68
3j6d-assembly1.cif.gz_a model of the prgh-prgk periplasmic rings 0.8362 4 68
5dmu-assembly1.cif.gz_A structure of the nhej polymerase from methanocella paludicola 0.8356 10 55
ID Description Score Start End Superfamily
af_P0AD21_4_109_2.60.40.1130 Mainly Beta;Sandwich;Immunoglobulin-like;Rab geranylgeranyltransferase alpha-subunit, insert domain 0.8947 13 68 2.60.40.1130
2mkyA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Hypothetical protein rpa1041 0.7845 4 68 3.30.70.1530
af_Q57993_77_188_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.7675 10 31 3.30.300.20
2mkyA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Hypothetical protein rpa1041 0.7273 4 68 3.30.70.1530
1zhvA00 Alpha Beta;2-Layer Sandwich;VC0802-like;VC0802-like 0.7247 7 68 3.30.2130.10
ID Description Score Start End GO Terms
AF-A0A2D8UUH9-F1-model_v4 DUF2007 domain-containing protein 0.9394 1 71
AF-A0A7M3MDQ8-F1-model_v4 DUF2007 domain-containing protein 0.9327 1 74 GO:0016020
AF-A0A3N7HVU4-F1-model_v4 DUF2007 domain-containing protein 0.9321 2 72 GO:0016020
AF-A0A522RZB6-F1-model_v4 DUF2007 domain-containing protein 0.9318 2 71 GO:0016020
AF-A0A3R9XXT2-F1-model_v4 DUF2007 domain-containing protein 0.9313 1 67

Feature Viewer

pLDDT pTM Quality
86.05 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map