F309989

General Info

Members Datasets Scaffolds Average Seq Length
202 139 405 242

Family's Representative Sequence

Representative Sequence 3300026118|Ga0207675_100161123|Ga0207675_1001611233
Length 256
Sequence VGEMLRGKVAVVTGAGRGXXXXVALELADQGAKVVVNDYGVSLDGRDPTSEHAEAVVAEIRAAGGEAHALAADMGRQEDMLPLAGAAAALVGPIDLVVHNASTLGKVPLPLLLDTECEDFLRVLEVNLVGPFRLTKALAGSMQLRGRGLVVAVSSDAAVTPYEGWGAYGVSKAALDHLVRIWAAELGRSGVRVLSVDPGEMDTDMHAEAMPGADRAALAAPADVAARLADLIEAADGIESGSRLEVISWGRAALAS

Samples

Sample ID Description Type Environment
1 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
93 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
94 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
95 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
96 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
97 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
98 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
99 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
100 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
101 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
102 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
103 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
104 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
105 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
106 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
107 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
108 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
109 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
110 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
116 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
117 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
118 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
119 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
120 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
121 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
122 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
123 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
126 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
127 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
128 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
130 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
131 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
132 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
133 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
134 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
135 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
136 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
137 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
138 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
139 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.48
Nodule 0
Rhizoplane 0.5
Rhizosphere 90.59
Stem 0
Stem Tuber 0
Unclassified 4.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207675_100161123 3300026118 Bacteria 2140
2 rootH2_10046991 3300003320 Bacteria 15569
3 rootH1_10010216 3300003323 Bacteria 7941
4 rootH1_10032403 3300003316 Bacteria 6429
5 rootH1_10032403 3300003323 Bacteria 6436
6 rootH1_10115061 3300003323 Bacteria 3297
7 rootH1_10151139 3300003323 Bacteria 6888
8 Ga0065715_10211723 3300005293 Unclassified 1311
9 Ga0070658_10001296 3300005327 Bacteria 21338
10 Ga0070670_100298312 3300005331 Bacteria 1409
11 Ga0068869_100041612 3300005334 Bacteria 3292
12 Ga0068869_100866528 3300005334 Unclassified 780
13 Ga0070682_100002820 3300005337 Bacteria 9634
14 Ga0070682_100014919 3300005337 Bacteria 4498
15 Ga0070689_100253047 3300005340 Bacteria 1454
16 Ga0070669_100258091 3300005353 Bacteria 1390
17 Ga0070675_100000405 3300005354 Bacteria 29326
18 Ga0070675_100005520 3300005354 Bacteria 9678
19 Ga0070671_100012702 3300005355 Bacteria 6788
20 Ga0070673_100002699 3300005364 Bacteria 10874
21 Ga0070673_100035822 3300005364 Bacteria 3767
22 Ga0070688_100295364 3300005365 Bacteria 1169
23 Ga0070688_100316314 3300005365 Bacteria 1133
24 Ga0070659_100097316 3300005366 Bacteria 2365
25 Ga0070667_100020801 3300005367 Bacteria 5450
26 Ga0070705_100275182 3300005440 Bacteria 1194
27 Ga0070694_100117050 3300005444 Bacteria 1907
28 Ga0070694_100289656 3300005444 Unclassified 1251
29 Ga0070708_100033887 3300005445 Bacteria 4438
30 Ga0070662_100147017 3300005457 Bacteria 1832
31 Ga0070685_10002353 3300005466 Bacteria 9744
32 Ga0070706_100024662 3300005467 Bacteria 5537
33 Ga0070707_100026000 3300005468 Bacteria 5555
34 Ga0070707_100224424 3300005468 Bacteria 1829
35 Ga0070698_100629882 3300005471 Bacteria 1013
36 Ga0070699_100385020 3300005518 Bacteria 1266
37 Ga0070679_100238314 3300005530 Bacteria 1777
38 Ga0068853_100124864 3300005539 Bacteria 2298
39 Ga0070672_100191839 3300005543 Unclassified 1706
40 Ga0070686_100088566 3300005544 Bacteria 2066
41 Ga0070686_100233130 3300005544 Bacteria 1336
42 Ga0070695_100739721 3300005545 Bacteria 784
43 Ga0068855_100017970 3300005563 Bacteria 8498
44 Ga0068855_100140827 3300005563 Bacteria 2750
45 Ga0068855_100238369 3300005563 Bacteria 2033
46 Ga0068856_100015060 3300005614 Bacteria 7470
47 Ga0068856_100328794 3300005614 Bacteria 1546
48 Ga0068859_100001141 3300005617 Bacteria 27059
49 Ga0068859_100013719 3300005617 Bacteria 8125
50 Ga0068859_100014293 3300005617 Bacteria 7962
51 Ga0068859_100371889 3300005617 Bacteria 1525
52 Ga0068864_100105548 3300005618 Bacteria 2504
53 Ga0068861_100044426 3300005719 Bacteria 3341
54 Ga0068861_100050962 3300005719 Bacteria 3141
55 Ga0068863_100000310 3300005841 Bacteria 49704
56 Ga0068863_100049853 3300005841 Bacteria 3970
57 Ga0068863_100579873 3300005841 Bacteria 1109
58 Ga0068858_100005656 3300005842 Bacteria 12222
59 Ga0068858_100316383 3300005842 Bacteria 1491
60 Ga0068860_100003353 3300005843 Bacteria 16493
61 Ga0068860_100281034 3300005843 Bacteria 1627
62 Ga0068860_100363485 3300005843 Bacteria 1426
63 Ga0068862_100153924 3300005844 Bacteria 2048
64 Ga0081455_10176646 3300005937 Bacteria 1621
65 Ga0097621_100013102 3300006237 Bacteria 6167
66 Ga0068871_100130014 3300006358 Bacteria 2134
67 Ga0075431_100184956 3300006847 Bacteria 2137
68 Ga0075431_100216988 3300006847 Bacteria 1952
69 Ga0075429_100090044 3300006880 Bacteria 2675
70 Ga0075429_100436220 3300006880 Bacteria 1148
71 Ga0068865_100136641 3300006881 Bacteria 1843
72 Ga0068865_100196637 3300006881 Bacteria 1563
73 Ga0097620_100001141 3300006931 Bacteria 27059
74 Ga0097620_100013719 3300006931 Bacteria 8125
75 Ga0097620_100014293 3300006931 Bacteria 7962
76 Ga0097620_100371892 3300006931 Bacteria 1525
77 Ga0105240_10000514 3300009093 Bacteria 71226
78 Ga0111539_10105924 3300009094 Bacteria 3299
79 Ga0105245_10164475 3300009098 Bacteria 2108
80 Ga0105241_10542828 3300009174 Bacteria 1043
81 Ga0105242_10251755 3300009176 Bacteria 1592
82 Ga0105248_10000121 3300009177 Bacteria 89807
83 Ga0105237_10000360 3300009545 Bacteria 64290
84 Ga0105238_10002455 3300009551 Bacteria 18580
85 Ga0105238_10015454 3300009551 Bacteria 7725
86 Ga0105238_10436101 3300009551 Bacteria 1306
87 Ga0105239_10154688 3300010375 Bacteria 2561
88 Ga0105239_10398385 3300010375 Bacteria 1558
89 Ga0157374_10133332 3300013296 Unclassified 2405
90 Ga0157375_10000251 3300013308 Bacteria 48728
91 Ga0163163_10002116 3300014325 Bacteria 16762
92 Ga0157380_10029479 3300014326 Bacteria 4194
93 Ga0157379_10000267 3300014968 Bacteria 41149
94 Ga0157379_10015814 3300014968 Bacteria 6630
95 Ga0207680_10124416 3300025903 Unclassified 1691
96 Ga0207643_10242955 3300025908 Bacteria 1107
97 Ga0207705_10016466 3300025909 Bacteria 5297
98 Ga0207684_10190698 3300025910 Bacteria 1768
99 Ga0207695_10003025 3300025913 Bacteria 24152
100 Ga0207671_10000213 3300025914 Bacteria 87854
101 Ga0207652_10070541 3300025921 Bacteria 3034
102 Ga0207652_10356078 3300025921 Bacteria 1321
103 Ga0207681_10247634 3300025923 Bacteria 1390
104 Ga0207694_10010102 3300025924 Bacteria 7113
105 Ga0207650_10257432 3300025925 Bacteria 1415
106 Ga0207659_10001671 3300025926 Bacteria 13184
107 Ga0207659_10019160 3300025926 Bacteria 4497
108 Ga0207687_10044278 3300025927 Bacteria 3070
109 Ga0207644_10026866 3300025931 Unclassified 3973
110 Ga0207690_10135269 3300025932 Bacteria 1809
111 Ga0207706_10145022 3300025933 Bacteria 2088
112 Ga0207670_10106822 3300025936 Bacteria 2009
113 Ga0207670_10116545 3300025936 Bacteria 1934
114 Ga0207670_10116797 3300025936 Bacteria 1932
115 Ga0207670_10269013 3300025936 Bacteria 1324
116 Ga0207704_10226458 3300025938 Bacteria 1387
117 Ga0207691_10200865 3300025940 Unclassified 1735
118 Ga0207711_10001024 3300025941 Bacteria 26745
119 Ga0207689_10042012 3300025942 Bacteria 3784
120 Ga0207667_10000469 3300025949 Bacteria 53939
121 Ga0207667_10124842 3300025949 Bacteria 2651
122 Ga0207667_10129634 3300025949 Bacteria 2598
123 Ga0207651_10004945 3300025960 Bacteria 6799
124 Ga0207658_10041000 3300025986 Bacteria 3350
125 Ga0207703_10306130 3300026035 Bacteria 1451
126 Ga0207639_10038274 3300026041 Bacteria 3567
127 Ga0207702_10365354 3300026078 Bacteria 1384
128 Ga0207641_10006262 3300026088 Bacteria 10068
129 Ga0207641_10033232 3300026088 Bacteria 4286
130 Ga0207641_10417072 3300026088 Bacteria 1292
131 Ga0207641_10553638 3300026088 Bacteria 1122
132 Ga0207676_10090424 3300026095 Bacteria 2512
133 Ga0207674_10262677 3300026116 Bacteria 1674
134 Ga0207675_100022488 3300026118 Bacteria 5871
135 Ga0207675_100176235 3300026118 Bacteria 2046
136 Ga0268265_10350859 3300028380 Bacteria 1347
137 Ga0268264_10114733 3300028381 Bacteria 2365
138 Ga0268264_10227854 3300028381 Bacteria 1719
139 Ga0268264_10287371 3300028381 Bacteria 1543
140 Ga0265334_10019565 3300028573 Bacteria 2783
141 Ga0265336_10007647 3300028666 Bacteria 3836
142 Ga0307517_10125177 3300028786 Bacteria 1878
143 Ga0307515_10022008 3300028794 Bacteria 11262
144 Ga0265338_10075600 3300028800 Bacteria 2857
145 Ga0265328_10079154 3300031239 Bacteria 1211
146 Ga0265320_10005098 3300031240 Bacteria 8487
147 Ga0265320_10008201 3300031240 Bacteria 6411
148 Ga0265320_10066481 3300031240 Bacteria 1708
149 Ga0265339_10010174 3300031249 Bacteria 5856
150 Ga0265339_10017463 3300031249 Bacteria 4250
151 Ga0265339_10081068 3300031249 Bacteria 1715
152 Ga0265331_10058647 3300031250 Bacteria 1822
153 Ga0307513_10045084 3300031456 Bacteria 4822
154 Ga0307509_10003148 3300031507 Bacteria 25568
155 Ga0307509_10053236 3300031507 Bacteria 4317
156 Ga0307509_10232063 3300031507 Bacteria 1647
157 Ga0265313_10007448 3300031595 Bacteria 7480
158 Ga0265313_10045778 3300031595 Bacteria 2128
159 Ga0265313_10157901 3300031595 Bacteria 965
160 Ga0265314_10005726 3300031711 Bacteria 11143
161 Ga0265314_10009783 3300031711 Bacteria 8055
162 Ga0265314_10009995 3300031711 Bacteria 7958
163 Ga0265342_10001941 3300031712 Bacteria 18514
164 Ga0307516_10033800 3300031730 Bacteria 5144
165 Ga0307516_10242342 3300031730 Bacteria 1501
166 Ga0307406_10006110 3300031901 Bacteria 6617
167 Ga0307406_10320426 3300031901 Bacteria 1199
168 Ga0373949_0000963 3300035090 Bacteria 8936
169 Ga0373957_0073136 3300035120 Bacteria 1344
170 Ga0373947_0003281 3300035725 Bacteria 9593
171 Ga0373937_0203160 3300036401 Bacteria 1863
172 Ga0373937_0450351 3300036401 Bacteria 1222
173 Ga0373925_0404102 3300037068 Bacteria 1114
174 Ga0395899_0007813 3300037312 Bacteria 8249
175 Ga0395900_0042052 3300037418 Bacteria 4707
176 Ga0439458_0023111 3300042157 Bacteria 1448
177 Ga0466969_0000903 3300044656 Bacteria 16044
178 Ga0466970_0064889 3300044765 Bacteria 1959
179 Ga0466960_0046993 3300044901 Bacteria 2069
180 Ga0466959_0021222 3300045049 Bacteria 4789
181 Ga0495590_0030200 3300046457 Bacteria 1899
182 Ga0495596_0106654 3300046500 Unclassified 1088
183 Ga0496110_0175295 3300048913 Unclassified 1946
184 Ga0501034_0147308 3300049571 Bacteria 2331
185 Ga0501047_0023078 3300049581 Bacteria 5972
186 Ga0501047_0232292 3300049581 Bacteria 1697
187 Ga0501070_0020343 3300049586 Bacteria 5568
188 Ga0501070_0051909 3300049586 Bacteria 3403
189 Ga0501070_0460310 3300049586 Bacteria 1025
190 Ga0501072_0155645 3300049588 Bacteria 1823
191 Ga0501217_024683 3300049661 Bacteria 1440
192 Ga0501035_0131266 3300049822 Bacteria 2184
193 Ga0501044_0023775 3300049823 Bacteria 6516
194 nmdc:mga09592_39575_c1 3300050508 Bacteria 3960
195 nmdc:mga0qj67_91461_c1 3300050509 Bacteria 2445
196 nmdc:mga06r32_274902_c1 3300050510 Bacteria 1672
197 nmdc:mga08y16_176060_c1 3300050511 Bacteria 2221
198 Ga0500566_0003447 3300053094 Bacteria 9435
199 Ga0500614_041790 3300053123 Bacteria 1169
200 Ga0500564_157832 3300053138 Bacteria 962
201 Ga0500590_108107 3300053148 Bacteria 1325
202 Ga0500620_042202 3300053155 Bacteria 1502
203 Ga0466962_0036460 3300061719 Bacteria 2354
204 Ga0207675_100161123
205 rootH2_10046991
206 rootH1_10010216
207 rootH1_10032403
208 rootH1_10115061
209 rootH1_10151139
210 Ga0065715_10211723
211 Ga0070658_10001296
212 Ga0070670_100298312
213 Ga0068869_100041612
214 Ga0068869_100866528
215 Ga0070682_100002820
216 Ga0070682_100014919
217 Ga0070689_100253047
218 Ga0070669_100258091
219 Ga0070675_100000405
220 Ga0070675_100005520
221 Ga0070671_100012702
222 Ga0070673_100002699
223 Ga0070673_100035822
224 Ga0070688_100295364
225 Ga0070688_100316314
226 Ga0070659_100097316
227 Ga0070667_100020801
228 Ga0070705_100275182
229 Ga0070694_100117050
230 Ga0070694_100289656
231 Ga0070708_100033887
232 Ga0070662_100147017
233 Ga0070685_10002353
234 Ga0070706_100024662
235 Ga0070707_100026000
236 Ga0070707_100224424
237 Ga0070698_100629882
238 Ga0070699_100385020
239 Ga0070679_100238314
240 Ga0068853_100124864
241 Ga0070672_100191839
242 Ga0070686_100088566
243 Ga0070686_100233130
244 Ga0070695_100739721
245 Ga0068855_100017970
246 Ga0068855_100140827
247 Ga0068855_100238369
248 Ga0068856_100015060
249 Ga0068856_100328794
250 Ga0068859_100001141
251 Ga0068859_100013719
252 Ga0068859_100014293
253 Ga0068859_100371889
254 Ga0068864_100105548
255 Ga0068861_100044426
256 Ga0068861_100050962
257 Ga0068863_100000310
258 Ga0068863_100049853
259 Ga0068863_100579873
260 Ga0068858_100005656
261 Ga0068858_100316383
262 Ga0068860_100003353
263 Ga0068860_100281034
264 Ga0068860_100363485
265 Ga0068862_100153924
266 Ga0081455_10176646
267 Ga0097621_100013102
268 Ga0068871_100130014
269 Ga0075431_100184956
270 Ga0075431_100216988
271 Ga0075429_100090044
272 Ga0075429_100436220
273 Ga0068865_100136641
274 Ga0068865_100196637
275 Ga0097620_100001141
276 Ga0097620_100013719
277 Ga0097620_100014293
278 Ga0097620_100371892
279 Ga0105240_10000514
280 Ga0111539_10105924
281 Ga0105245_10164475
282 Ga0105241_10542828
283 Ga0105242_10251755
284 Ga0105248_10000121
285 Ga0105237_10000360
286 Ga0105238_10002455
287 Ga0105238_10015454
288 Ga0105238_10436101
289 Ga0105239_10154688
290 Ga0105239_10398385
291 Ga0157374_10133332
292 Ga0157375_10000251
293 Ga0163163_10002116
294 Ga0157380_10029479
295 Ga0157379_10000267
296 Ga0157379_10015814
297 Ga0207680_10124416
298 Ga0207643_10242955
299 Ga0207705_10016466
300 Ga0207684_10190698
301 Ga0207695_10003025
302 Ga0207671_10000213
303 Ga0207652_10070541
304 Ga0207652_10356078
305 Ga0207681_10247634
306 Ga0207694_10010102
307 Ga0207650_10257432
308 Ga0207659_10001671
309 Ga0207659_10019160
310 Ga0207687_10044278
311 Ga0207644_10026866
312 Ga0207690_10135269
313 Ga0207706_10145022
314 Ga0207670_10106822
315 Ga0207670_10116545
316 Ga0207670_10116797
317 Ga0207670_10269013
318 Ga0207704_10226458
319 Ga0207691_10200865
320 Ga0207711_10001024
321 Ga0207689_10042012
322 Ga0207667_10000469
323 Ga0207667_10124842
324 Ga0207667_10129634
325 Ga0207651_10004945
326 Ga0207658_10041000
327 Ga0207703_10306130
328 Ga0207639_10038274
329 Ga0207702_10365354
330 Ga0207641_10006262
331 Ga0207641_10033232
332 Ga0207641_10417072
333 Ga0207641_10553638
334 Ga0207676_10090424
335 Ga0207674_10262677
336 Ga0207675_100022488
337 Ga0207675_100176235
338 Ga0268265_10350859
339 Ga0268264_10114733
340 Ga0268264_10227854
341 Ga0268264_10287371
342 Ga0265334_10019565
343 Ga0265336_10007647
344 Ga0307517_10125177
345 Ga0307515_10022008
346 Ga0265338_10075600
347 Ga0265328_10079154
348 Ga0265320_10005098
349 Ga0265320_10008201
350 Ga0265320_10066481
351 Ga0265339_10010174
352 Ga0265339_10017463
353 Ga0265339_10081068
354 Ga0265331_10058647
355 Ga0307513_10045084
356 Ga0307509_10003148
357 Ga0307509_10053236
358 Ga0307509_10232063
359 Ga0265313_10007448
360 Ga0265313_10045778
361 Ga0265313_10157901
362 Ga0265314_10005726
363 Ga0265314_10009783
364 Ga0265314_10009995
365 Ga0265342_10001941
366 Ga0307516_10033800
367 Ga0307516_10242342
368 Ga0307406_10006110
369 Ga0307406_10320426
370 Ga0373949_0000963
371 Ga0373957_0073136
372 Ga0373947_0003281
373 Ga0373937_0203160
374 Ga0373937_0450351
375 Ga0373925_0404102
376 Ga0395899_0007813
377 Ga0395900_0042052
378 Ga0439458_0023111
379 Ga0466969_0000903
380 Ga0466970_0064889
381 Ga0466960_0046993
382 Ga0466959_0021222
383 Ga0495590_0030200
384 Ga0495596_0106654
385 Ga0496110_0175295
386 Ga0501034_0147308
387 Ga0501047_0023078
388 Ga0501047_0232292
389 Ga0501070_0020343
390 Ga0501070_0051909
391 Ga0501070_0460310
392 Ga0501072_0155645
393 Ga0501217_024683
394 Ga0501035_0131266
395 Ga0501044_0023775
396 nmdc:mga09592_39575_c1
397 nmdc:mga0qj67_91461_c1
398 nmdc:mga06r32_274902_c1
399 nmdc:mga08y16_176060_c1
400 Ga0500566_0003447
401 Ga0500614_041790
402 Ga0500564_157832
403 Ga0500590_108107
404 Ga0500620_042202
405 Ga0466962_0036460

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

8

214

0.91

PF08659

KR

KR domain

9

202

0.85

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

14

236

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tfo-assembly1.cif.gz_D crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9361 5 233
7djs-assembly1.cif.gz_C crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad 0.921 6 233
2ehd-assembly1.cif.gz_A crystal structure analysis of oxidoreductase 0.9156 5 233
2ehd-assembly1.cif.gz_B crystal structure analysis of oxidoreductase 0.9138 5 233
3csd-assembly1.cif.gz_B actinorhodin polyketide ketoreductase mutant p94l bound to nadph and the inhibitor emodin 0.913 6 233
ID Description Score Start End Superfamily
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9524 3 80 3.40.50.720
af_A0A0R0HUJ2_8_65_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9477 6 52 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9384 90 193 3.40.50.720
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9344 6 184 3.40.50.720
af_Q0JEC9_1_74_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9308 2 61 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3A8KKF0-F1-model_v4 SDR family oxidoreductase 0.9611 1 240 GO:0016020
GO:0016491
AF-A0A3A8KKF0-F1-model_v4 SDR family oxidoreductase 0.9572 1 240 GO:0016020
GO:0016491
AF-A0A085W4Z7-F1-model_v4 Oxidoreductase, short chain dehydrogenase/reductase family protein 0.9566 1 240 GO:0016020
GO:0016491
AF-A0A4P2QW15-F1-model_v4 Oxidoreductase (EC 1.-.-.-) 0.9561 6 241 GO:0016020
GO:0016491
AF-A0A2W5V304-F1-model_v4 Short-chain dehydrogenase 0.9528 1 223 GO:0016020
GO:0016491

Map