F309812
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 202 | 155 | 187 | 399 |
Family's Representative Sequence
| Representative Sequence | 3300009551|Ga0105238_10012938|Ga0105238_100129386 |
| Length | 418 |
| Sequence | MAPFYLSRFAVGKGWRMRGIGGSTAEAELAALKPWPNPAPAITAEDRGERLAKAQDLLADIGADAIIVGAGPSLRYFAGVAWNPTERLVAMLLPRHGQPKMICPRFELGSLQAGLGIAADIALWAEHESPYALTVAELAGMGAKTLAIDPALPFFVVNGLALAAPGLALVDGAPVIDGCRMIKSPAELALMAQAKAMTLEVHRRAARILADGITTTAVRRFIDQAHRALGADDGSSFCAVQFGVASAYPHGLPGEQSLKSGDVVLIDTGCKVQGYNSDITRTYVFGEPSAEVRRVWDVEKRAQAAAFAAVKPGVPCEQIDAVARAVLADAGFGPDYDLPGLPHRTGHGIGLSIHEAPYLVRGDKTPLAPGMCFSNEPMIVIPDAFGVRLEDHFHVTEEGAAWFTEPQPDLEEPFRPRN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 2 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 3 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 4 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 5 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 6 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 7 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 8 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 9 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 10 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 11 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 12 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 13 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 14 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 15 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 16 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 17 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 18 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 23 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 40 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 41 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 53 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 54 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 55 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 56 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 63 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 64 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 66 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 68 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 91 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 92 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 93 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 94 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 95 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 96 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 97 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 98 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 99 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 100 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 101 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 102 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 103 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 104 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 105 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 106 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 107 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 108 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 109 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 110 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 111 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 134 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 135 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 136 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 137 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 138 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 139 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 140 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 141 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 142 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 143 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 144 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 145 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 146 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 147 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 148 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 149 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 150 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 151 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 152 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 153 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 154 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 155 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.57 |
| Metatranscriptomes | 0 |
| Isolates | 7.43 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.5 |
| Bulb | 0 |
| Endosphere | 11.88 |
| Nodule | 0 |
| Rhizoplane | 2.48 |
| Rhizosphere | 70.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.85 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25162J39368_1000767 | 3300002737 | Bacteria | 21704 |
| 2 | JGI25157J39369_1000529 | 3300002741 | Bacteria | 23142 |
| 3 | JGI25163J39215_1000203 | 3300002771 | Bacteria | 23146 |
| 4 | JGI25164J39214_1000424 | 3300002772 | Bacteria | 23737 |
| 5 | JGI25165J46597_1000804 | 3300003214 | Bacteria | 23737 |
| 6 | Ga0055538_1001403 | 3300003751 | Bacteria | 4707 |
| 7 | Ga0055535_1000769 | 3300003761 | Bacteria | 23737 |
| 8 | Ga0055542_1000786 | 3300003762 | Bacteria | 23737 |
| 9 | Ga0055529_1000672 | 3300003763 | Bacteria | 23737 |
| 10 | Ga0058692_1000006 | 3300003856 | Bacteria | 398109 |
| 11 | Ga0065165_1001264 | 3300005262 | Bacteria | 28582 |
| 12 | Ga0070658_10093818 | 3300005327 | Bacteria | 2476 |
| 13 | Ga0070676_10072898 | 3300005328 | Bacteria | 2065 |
| 14 | Ga0070670_100008923 | 3300005331 | Bacteria | 8562 |
| 15 | Ga0070680_100003197 | 3300005336 | Bacteria | 12180 |
| 16 | Ga0070660_100023239 | 3300005339 | Bacteria | 4593 |
| 17 | Ga0070660_100040421 | 3300005339 | Bacteria | 3549 |
| 18 | Ga0070669_100080087 | 3300005353 | Bacteria | 2430 |
| 19 | Ga0070671_100135799 | 3300005355 | Bacteria | 2074 |
| 20 | Ga0070659_100001879 | 3300005366 | Bacteria | 15050 |
| 21 | Ga0070659_100006174 | 3300005366 | Bacteria | 8652 |
| 22 | Ga0070659_100054360 | 3300005366 | Bacteria | 3153 |
| 23 | Ga0070678_100127603 | 3300005456 | Bacteria | 2016 |
| 24 | Ga0070681_10007802 | 3300005458 | Bacteria | 10467 |
| 25 | Ga0070679_100021087 | 3300005530 | Bacteria | 6358 |
| 26 | Ga0070679_100041623 | 3300005530 | Bacteria | 4572 |
| 27 | Ga0068853_100031515 | 3300005539 | Bacteria | 4484 |
| 28 | Ga0068853_100048694 | 3300005539 | Bacteria | 3641 |
| 29 | Ga0068853_100240811 | 3300005539 | Bacteria | 1658 |
| 30 | Ga0070696_100017451 | 3300005546 | Bacteria | 4844 |
| 31 | Ga0070665_100000418 | 3300005548 | Bacteria | 62048 |
| 32 | Ga0070665_100092329 | 3300005548 | Bacteria | 3032 |
| 33 | Ga0068856_100005007 | 3300005614 | Bacteria | 13117 |
| 34 | Ga0068864_100134845 | 3300005618 | Bacteria | 2222 |
| 35 | Ga0068865_100003395 | 3300006881 | Bacteria | 9535 |
| 36 | Ga0105251_10000048 | 3300009011 | Bacteria | 110218 |
| 37 | Ga0105240_10003057 | 3300009093 | Bacteria | 26302 |
| 38 | Ga0105240_10049052 | 3300009093 | Bacteria | 5332 |
| 39 | Ga0105240_10069551 | 3300009093 | Bacteria | 4357 |
| 40 | Ga0105240_10231333 | 3300009093 | Bacteria | 2148 |
| 41 | Ga0105240_10247450 | 3300009093 | Bacteria | 2064 |
| 42 | Ga0105241_10153093 | 3300009174 | Bacteria | 1888 |
| 43 | Ga0105241_10225772 | 3300009174 | Bacteria | 1576 |
| 44 | Ga0105242_10062360 | 3300009176 | Bacteria | 3068 |
| 45 | Ga0105248_10000112 | 3300009177 | Bacteria | 91321 |
| 46 | Ga0105248_10453304 | 3300009177 | Bacteria | 1445 |
| 47 | Ga0105238_10003909 | 3300009551 | Bacteria | 14800 |
| 48 | Ga0105238_10012938 | 3300009551 | Bacteria | 8420 |
| 49 | Ga0105238_10035883 | 3300009551 | Bacteria | 5040 |
| 50 | Ga0157373_10000885 | 3300013100 | Bacteria | 23176 |
| 51 | Ga0157371_10007872 | 3300013102 | Bacteria | 8555 |
| 52 | Ga0157370_10327996 | 3300013104 | Bacteria | 1411 |
| 53 | Ga0157372_10013497 | 3300013307 | Bacteria | 8731 |
| 54 | Ga0163163_10166831 | 3300014325 | Bacteria | 2248 |
| 55 | Ga0182008_10002553 | 3300014497 | Bacteria | 11336 |
| 56 | Ga0182008_10088815 | 3300014497 | Bacteria | 1523 |
| 57 | Ga0182006_1001403 | 3300015261 | Bacteria | 14605 |
| 58 | Ga0182005_1001553 | 3300015265 | Bacteria | 9091 |
| 59 | Ga0182005_1002805 | 3300015265 | Bacteria | 6074 |
| 60 | Ga0183360_10002 | 3300015689 | Bacteria | 953821 |
| 61 | Ga0163161_10032048 | 3300017792 | Bacteria | 3750 |
| 62 | Ga0209760_100372 | 3300025207 | Bacteria | 11839 |
| 63 | Ga0209784_100332 | 3300025224 | Bacteria | 23717 |
| 64 | Ga0207427_100013 | 3300025231 | Bacteria | 581419 |
| 65 | Ga0209437_100015 | 3300025233 | Bacteria | 713457 |
| 66 | Ga0209258_100049 | 3300025242 | Bacteria | 358328 |
| 67 | Ga0209646_1000815 | 3300025246 | Bacteria | 10554 |
| 68 | Ga0209026_1000094 | 3300025250 | Bacteria | 169671 |
| 69 | Ga0209026_1000098 | 3300025250 | Bacteria | 161845 |
| 70 | Ga0209148_1000010 | 3300025254 | Bacteria | 1265567 |
| 71 | Ga0209759_1000499 | 3300025256 | Bacteria | 43165 |
| 72 | Ga0209759_1012813 | 3300025256 | Bacteria | 2302 |
| 73 | Ga0209233_1000009 | 3300025261 | Bacteria | 1265567 |
| 74 | Ga0209565_1002271 | 3300025263 | Bacteria | 7098 |
| 75 | Ga0209455_1000082 | 3300025272 | Bacteria | 257909 |
| 76 | Ga0207713_1002271 | 3300025735 | Bacteria | 14165 |
| 77 | Ga0207680_10187242 | 3300025903 | Bacteria | 1403 |
| 78 | Ga0207654_10135557 | 3300025911 | Bacteria | 1563 |
| 79 | Ga0207707_10033359 | 3300025912 | Bacteria | 4505 |
| 80 | Ga0207695_10000837 | 3300025913 | Bacteria | 56634 |
| 81 | Ga0207695_10001415 | 3300025913 | Bacteria | 40402 |
| 82 | Ga0207695_10017499 | 3300025913 | Bacteria | 8338 |
| 83 | Ga0207695_10045601 | 3300025913 | Bacteria | 4652 |
| 84 | Ga0207695_10072228 | 3300025913 | Bacteria | 3522 |
| 85 | Ga0207695_10259939 | 3300025913 | Bacteria | 1634 |
| 86 | Ga0207660_10007910 | 3300025917 | Bacteria | 6879 |
| 87 | Ga0207657_10014419 | 3300025919 | Bacteria | 7720 |
| 88 | Ga0207657_10036581 | 3300025919 | Bacteria | 4393 |
| 89 | Ga0207657_10049834 | 3300025919 | Bacteria | 3646 |
| 90 | Ga0207652_10006738 | 3300025921 | Bacteria | 9259 |
| 91 | Ga0207681_10057357 | 3300025923 | Bacteria | 2661 |
| 92 | Ga0207694_10015462 | 3300025924 | Bacteria | 5755 |
| 93 | Ga0207694_10067496 | 3300025924 | Bacteria | 2791 |
| 94 | Ga0207690_10000344 | 3300025932 | Bacteria | 31116 |
| 95 | Ga0207690_10024836 | 3300025932 | Bacteria | 3757 |
| 96 | Ga0207690_10092645 | 3300025932 | Bacteria | 2139 |
| 97 | Ga0207706_10001904 | 3300025933 | Bacteria | 20501 |
| 98 | Ga0207686_10004891 | 3300025934 | Bacteria | 7204 |
| 99 | Ga0207704_10025740 | 3300025938 | Bacteria | 3216 |
| 100 | Ga0207711_10000155 | 3300025941 | Bacteria | 73463 |
| 101 | Ga0207711_10127371 | 3300025941 | Bacteria | 2279 |
| 102 | Ga0207667_10024364 | 3300025949 | Bacteria | 6644 |
| 103 | Ga0207667_10051592 | 3300025949 | Bacteria | 4335 |
| 104 | Ga0207639_10332686 | 3300026041 | Bacteria | 1352 |
| 105 | Ga0207702_10003418 | 3300026078 | Bacteria | 14521 |
| 106 | Ga0207674_10166443 | 3300026116 | Bacteria | 2159 |
| 107 | Ga0209371_1000016 | 3300027312 | Bacteria | 646301 |
| 108 | Ga0268266_10000003 | 3300028379 | Bacteria | 1701703 |
| 109 | Ga0268266_10162559 | 3300028379 | Bacteria | 2021 |
| 110 | Ga0307517_10009887 | 3300028786 | Bacteria | 13439 |
| 111 | Ga0268256_1000015 | 3300030500 | Bacteria | 646300 |
| 112 | Ga0307513_10013179 | 3300031456 | Bacteria | 10158 |
| 113 | Ga0307509_10133418 | 3300031507 | Bacteria | 2434 |
| 114 | Ga0307508_10000812 | 3300031616 | Bacteria | 36575 |
| 115 | Ga0307412_10002161 | 3300031911 | Bacteria | 10904 |
| 116 | Ga0307414_10110716 | 3300032004 | Bacteria | 2089 |
| 117 | Ga0373936_0004759 | 3300035113 | Bacteria | 5128 |
| 118 | Ga0395899_0000052 | 3300037312 | Bacteria | 221643 |
| 119 | Ga0395900_0000002 | 3300037418 | Bacteria | 671103 |
| 120 | Ga0395898_0022753 | 3300037466 | Bacteria | 6343 |
| 121 | Ga0395898_0142073 | 3300037466 | Bacteria | 2298 |
| 122 | Ga0395905_0010469 | 3300037471 | Bacteria | 9022 |
| 123 | Ga0395905_0168071 | 3300037471 | Bacteria | 2061 |
| 124 | Ga0395901_0000013 | 3300038443 | Bacteria | 375733 |
| 125 | Ga0439436_0000184 | 3300041404 | Bacteria | 14746 |
| 126 | Ga0439461_0000026 | 3300041410 | Bacteria | 18847 |
| 127 | Ga0439465_0003115 | 3300041413 | Bacteria | 5420 |
| 128 | Ga0439465_0007445 | 3300041413 | Bacteria | 3480 |
| 129 | Ga0451800_0156804 | 3300041459 | Bacteria | 1910 |
| 130 | Ga0439431_0000609 | 3300041997 | Bacteria | 7584 |
| 131 | Ga0439445_0008403 | 3300042004 | Bacteria | 2415 |
| 132 | Ga0439432_000185 | 3300042006 | Bacteria | 22317 |
| 133 | Ga0439434_0001796 | 3300042435 | Bacteria | 6239 |
| 134 | Ga0495638_0078288 | 3300046460 | Bacteria | 2012 |
| 135 | Ga0495650_0057095 | 3300046471 | Bacteria | 1581 |
| 136 | Ga0495585_0135469 | 3300046492 | Bacteria | 1293 |
| 137 | Ga0495583_0002205 | 3300046506 | Bacteria | 17260 |
| 138 | Ga0495583_0006056 | 3300046506 | Bacteria | 8009 |
| 139 | Ga0495606_0000535 | 3300046507 | Bacteria | 61035 |
| 140 | Ga0495610_0000902 | 3300046512 | Bacteria | 27613 |
| 141 | Ga0495631_0023792 | 3300046518 | Bacteria | 2835 |
| 142 | Ga0495637_0006312 | 3300046520 | Bacteria | 5963 |
| 143 | Ga0495643_0007637 | 3300046522 | Bacteria | 6946 |
| 144 | Ga0495643_0011057 | 3300046522 | Bacteria | 5519 |
| 145 | Ga0495648_0000122 | 3300046524 | Bacteria | 93823 |
| 146 | Ga0495663_0000364 | 3300046525 | Bacteria | 16763 |
| 147 | Ga0495642_0000901 | 3300046528 | Bacteria | 13933 |
| 148 | Ga0495633_0000696 | 3300046558 | Bacteria | 30750 |
| 149 | Ga0495668_0000039 | 3300046616 | Bacteria | 231402 |
| 150 | Ga0495668_0026087 | 3300046616 | Bacteria | 3318 |
| 151 | Ga0495668_0035239 | 3300046616 | Bacteria | 2805 |
| 152 | Ga0495611_0036232 | 3300046648 | Bacteria | 2188 |
| 153 | Ga0495611_0045823 | 3300046648 | Bacteria | 1959 |
| 154 | Ga0495625_0000424 | 3300046660 | Bacteria | 63593 |
| 155 | Ga0495625_0016688 | 3300046660 | Bacteria | 5768 |
| 156 | Ga0495669_0000361 | 3300046684 | Bacteria | 23171 |
| 157 | Ga0495670_0004858 | 3300046691 | Bacteria | 6598 |
| 158 | Ga0495649_0009002 | 3300046694 | Bacteria | 5962 |
| 159 | Ga0495683_0000964 | 3300047323 | Bacteria | 20180 |
| 160 | Ga0495687_000089 | 3300047443 | Bacteria | 141448 |
| 161 | Ga0495677_0031636 | 3300047445 | Bacteria | 1926 |
| 162 | Ga0496101_0217975 | 3300048904 | Bacteria | 1480 |
| 163 | Ga0496109_0006363 | 3300048912 | Bacteria | 9947 |
| 164 | Ga0496115_0004311 | 3300048918 | Bacteria | 10295 |
| 165 | Ga0496115_0008015 | 3300048918 | Bacteria | 7795 |
| 166 | Ga0496117_0000785 | 3300048920 | Bacteria | 49837 |
| 167 | Ga0496118_0039135 | 3300048921 | Bacteria | 3788 |
| 168 | Ga0496119_0003604 | 3300048922 | Bacteria | 15938 |
| 169 | Ga0496119_0021791 | 3300048922 | Bacteria | 4614 |
| 170 | Ga0496120_0000276 | 3300048923 | Bacteria | 86130 |
| 171 | Ga0496121_0001413 | 3300048924 | Bacteria | 40691 |
| 172 | Ga0496122_0000355 | 3300048925 | Bacteria | 98786 |
| 173 | Ga0496122_0002179 | 3300048925 | Bacteria | 28682 |
| 174 | Ga0496123_0000374 | 3300048926 | Bacteria | 83982 |
| 175 | Ga0496123_0001971 | 3300048926 | Bacteria | 26603 |
| 176 | Ga0496124_0001048 | 3300048927 | Bacteria | 43639 |
| 177 | Ga0496126_0028353 | 3300048929 | Bacteria | 5338 |
| 178 | Ga0496126_0070420 | 3300048929 | Bacteria | 3116 |
| 179 | Ga0501046_0099158 | 3300049580 | Bacteria | 2236 |
| 180 | Ga0501047_0002698 | 3300049581 | Bacteria | 16892 |
| 181 | Ga0501275_000167 | 3300049772 | Bacteria | 7499 |
| 182 | Ga0500610_0000160 | 3300053079 | Bacteria | 20065 |
| 183 | Ga0500608_052320 | 3300053122 | Bacteria | 1961 |
| 184 | Ga0500568_0022965 | 3300053139 | Bacteria | 2658 |
| 185 | Ga0500636_0003614 | 3300053177 | Bacteria | 8721 |
| 186 | Ga0500645_000008 | 3300053730 | Bacteria | 212254 |
| 187 | Ga0500645_004989 | 3300053730 | Bacteria | 4974 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048929 | Ga0496126_0070420 | Ga0496126_0070420_1103_2170 | 355 |
| 2 | 3300048904 | Ga0496101_0217975 | Ga0496101_0217975_19_1107 | 358 |
| 3 | 3300048927 | Ga0496124_0001048 | Ga0496124_0001048_5687_6895 | 385 |
| 4 | 3300005331 | Ga0070670_100008923 | Ga0070670_1000089233 | 387 |
| 5 | 3300005353 | Ga0070669_100080087 | Ga0070669_1000800872 | 387 |
| 6 | 3300009011 | Ga0105251_10000048 | Ga0105251_1000004815 | 387 |
| 7 | 3300025735 | Ga0207713_1002271 | Ga0207713_10022715 | 387 |
| 8 | 3300025923 | Ga0207681_10057357 | Ga0207681_100573572 | 387 |
| 9 | 3300048920 | Ga0496117_0000785 | Ga0496117_0000785_40819_42027 | 387 |
| 10 | 3300048922 | Ga0496119_0003604 | Ga0496119_0003604_5671_6879 | 387 |
| 11 | 3300048923 | Ga0496120_0000276 | Ga0496120_0000276_41987_43195 | 387 |
| 12 | 3300048925 | Ga0496122_0002179 | Ga0496122_0002179_21665_22873 | 387 |
| 13 | 3300048926 | Ga0496123_0000374 | Ga0496123_0000374_40672_41880 | 387 |
| 14 | 3300005328 | Ga0070676_10072898 | Ga0070676_100728982 | 392 |
| 15 | 3300005456 | Ga0070678_100127603 | Ga0070678_1001276032 | 392 |
| 16 | 3300017792 | Ga0163161_10032048 | Ga0163161_100320482 | 392 |
| 17 | 3300025932 | Ga0207690_10024836 | Ga0207690_100248362 | 392 |
| 18 | 3300025933 | Ga0207706_10001904 | Ga0207706_100019047 | 392 |
| 19 | 3300028379 | Ga0268266_10162559 | Ga0268266_101625592 | 392 |
| 20 | 3300028786 | Ga0307517_10009887 | Ga0307517_100098876 | 392 |
| 21 | 3300031507 | Ga0307509_10133418 | Ga0307509_101334182 | 392 |
| 22 | 3300031616 | Ga0307508_10000812 | Ga0307508_1000081212 | 392 |
| 23 | 3300041410 | Ga0439461_0000026 | Ga0439461_0000026_13329_14507 | 392 |
| 24 | 3300041413 | Ga0439465_0003115 | Ga0439465_0003115_1519_2697 | 392 |
| 25 | 3300041997 | Ga0439431_0000609 | Ga0439431_0000609_2335_3513 | 392 |
| 26 | 3300042006 | Ga0439432_000185 | Ga0439432_000185_16884_18062 | 392 |
| 27 | 3300042435 | Ga0439434_0001796 | Ga0439434_0001796_822_2000 | 392 |
| 28 | 3300046460 | Ga0495638_0078288 | Ga0495638_0078288_413_1594 | 392 |
| 29 | 3300046492 | Ga0495585_0135469 | Ga0495585_0135469_55_1236 | 392 |
| 30 | 3300046506 | Ga0495583_0002205 | Ga0495583_0002205_5573_6754 | 392 |
| 31 | 3300046506 | Ga0495583_0006056 | Ga0495583_0006056_3902_5083 | 392 |
| 32 | 3300046507 | Ga0495606_0000535 | Ga0495606_0000535_44888_46069 | 392 |
| 33 | 3300046518 | Ga0495631_0023792 | Ga0495631_0023792_30_1211 | 392 |
| 34 | 3300046520 | Ga0495637_0006312 | Ga0495637_0006312_2088_3269 | 392 |
| 35 | 3300046522 | Ga0495643_0007637 | Ga0495643_0007637_4260_5441 | 392 |
| 36 | 3300046522 | Ga0495643_0011057 | Ga0495643_0011057_1892_3073 | 392 |
| 37 | 3300046524 | Ga0495648_0000122 | Ga0495648_0000122_16669_17850 | 392 |
| 38 | 3300046525 | Ga0495663_0000364 | Ga0495663_0000364_1167_2348 | 392 |
| 39 | 3300046558 | Ga0495633_0000696 | Ga0495633_0000696_8070_9251 | 392 |
| 40 | 3300046616 | Ga0495668_0026087 | Ga0495668_0026087_854_2035 | 392 |
| 41 | 3300046648 | Ga0495611_0036232 | Ga0495611_0036232_92_1273 | 392 |
| 42 | 3300046648 | Ga0495611_0045823 | Ga0495611_0045823_223_1404 | 392 |
| 43 | 3300046660 | Ga0495625_0000424 | Ga0495625_0000424_13639_14820 | 392 |
| 44 | 3300046660 | Ga0495625_0016688 | Ga0495625_0016688_3120_4301 | 392 |
| 45 | 3300046684 | Ga0495669_0000361 | Ga0495669_0000361_16348_17529 | 392 |
| 46 | 3300046691 | Ga0495670_0004858 | Ga0495670_0004858_2799_3980 | 392 |
| 47 | 3300046694 | Ga0495649_0009002 | Ga0495649_0009002_288_1469 | 392 |
| 48 | 3300047323 | Ga0495683_0000964 | Ga0495683_0000964_6238_7419 | 392 |
| 49 | 3300047443 | Ga0495687_000089 | Ga0495687_000089_53237_54418 | 392 |
| 50 | 3300047445 | Ga0495677_0031636 | Ga0495677_0031636_347_1528 | 392 |
| 51 | 3300053079 | Ga0500610_0000160 | Ga0500610_0000160_4207_5388 | 392 |
| 52 | 3300053177 | Ga0500636_0003614 | Ga0500636_0003614_874_2055 | 392 |
| 53 | 3300053730 | Ga0500645_000008 | Ga0500645_000008_46283_47464 | 392 |
| 54 | iso_pu_bacteria | 2984564862 | 2984566905 | 392 |
| 55 | iso_pu_bacteria | 2643221598 | 2643999067 | 394 |
| 56 | iso_pu_bacteria | 2643221614 | 2644086224 | 394 |
| 57 | iso_pu_bacteria | 2643221661 | 2644344722 | 394 |
| 58 | iso_pu_bacteria | 2643221666 | 2644367465 | 394 |
| 59 | iso_pu_bacteria | 2747842501 | 2748016446 | 395 |
| 60 | iso_pu_bacteria | 2953994433 | 2953994833 | 395 |
| 61 | 3300009174 | Ga0105241_10153093 | Ga0105241_101530932 | 396 |
| 62 | 3300037471 | Ga0395905_0168071 | Ga0395905_0168071_591_1781 | 396 |
| 63 | 3300053730 | Ga0500645_004989 | Ga0500645_004989_94_1293 | 396 |
| 64 | iso_pu_bacteria | 2941489479 | 2941492038 | 396 |
| 65 | 3300005548 | Ga0070665_100092329 | Ga0070665_1000923293 | 397 |
| 66 | 3300049580 | Ga0501046_0099158 | Ga0501046_0099158_901_2094 | 397 |
| 67 | 3300053139 | Ga0500568_0022965 | Ga0500568_0022965_1282_2475 | 397 |
| 68 | iso_pu_bacteria | 2919130084 | 2919130703 | 397 |
| 69 | iso_pu_bacteria | 2929195423 | 2929198294 | 397 |
| 70 | 3300005355 | Ga0070671_100135799 | Ga0070671_1001357992 | 398 |
| 71 | 3300005530 | Ga0070679_100041623 | Ga0070679_1000416235 | 398 |
| 72 | 3300005618 | Ga0068864_100134845 | Ga0068864_1001348452 | 398 |
| 73 | 3300009093 | Ga0105240_10247450 | Ga0105240_102474501 | 398 |
| 74 | 3300009177 | Ga0105248_10453304 | Ga0105248_104533042 | 398 |
| 75 | 3300025903 | Ga0207680_10187242 | Ga0207680_101872421 | 398 |
| 76 | 3300025913 | Ga0207695_10000837 | Ga0207695_1000083760 | 398 |
| 77 | 3300025941 | Ga0207711_10127371 | Ga0207711_101273712 | 398 |
| 78 | 3300025949 | Ga0207667_10024364 | Ga0207667_100243642 | 398 |
| 79 | 3300031456 | Ga0307513_10013179 | Ga0307513_100131799 | 398 |
| 80 | 3300032004 | Ga0307414_10110716 | Ga0307414_101107162 | 398 |
| 81 | 3300046528 | Ga0495642_0000901 | Ga0495642_0000901_7837_9045 | 398 |
| 82 | 3300046616 | Ga0495668_0035239 | Ga0495668_0035239_1178_2386 | 398 |
| 83 | 3300048912 | Ga0496109_0006363 | Ga0496109_0006363_1111_2319 | 398 |
| 84 | 3300049772 | Ga0501275_000167 | Ga0501275_000167_2753_3958 | 398 |
| 85 | iso_pu_bacteria | 2818991457 | 2819660021 | 398 |
| 86 | iso_pu_bacteria | 2852684882 | 2852685163 | 398 |
| 87 | iso_pu_bacteria | 8021622325 | 8021622748 | 398 |
| 88 | iso_pu_bacteria | 8021626552 | 8021630192 | 398 |
| 89 | iso_pu_bacteria | 8021648035 | 8021648144 | 398 |
| 90 | 3300005327 | Ga0070658_10093818 | Ga0070658_100938182 | 399 |
| 91 | 3300005336 | Ga0070680_100003197 | Ga0070680_1000031974 | 399 |
| 92 | 3300005339 | Ga0070660_100040421 | Ga0070660_1000404212 | 399 |
| 93 | 3300005366 | Ga0070659_100054360 | Ga0070659_1000543602 | 399 |
| 94 | 3300005458 | Ga0070681_10007802 | Ga0070681_100078027 | 399 |
| 95 | 3300005530 | Ga0070679_100021087 | Ga0070679_1000210873 | 399 |
| 96 | 3300005539 | Ga0068853_100048694 | Ga0068853_1000486943 | 399 |
| 97 | 3300005614 | Ga0068856_100005007 | Ga0068856_1000050079 | 399 |
| 98 | 3300006881 | Ga0068865_100003395 | Ga0068865_1000033954 | 399 |
| 99 | 3300009093 | Ga0105240_10003057 | Ga0105240_1000305721 | 399 |
| 100 | 3300009093 | Ga0105240_10049052 | Ga0105240_100490523 | 399 |
| 101 | 3300009176 | Ga0105242_10062360 | Ga0105242_100623602 | 399 |
| 102 | 3300009177 | Ga0105248_10000112 | Ga0105248_1000011290 | 399 |
| 103 | 3300013104 | Ga0157370_10327996 | Ga0157370_103279962 | 399 |
| 104 | 3300014325 | Ga0163163_10166831 | Ga0163163_101668313 | 399 |
| 105 | 3300014497 | Ga0182008_10002553 | Ga0182008_100025534 | 399 |
| 106 | 3300015261 | Ga0182006_1001403 | Ga0182006_10014035 | 399 |
| 107 | 3300015265 | Ga0182005_1001553 | Ga0182005_10015534 | 399 |
| 108 | 3300025912 | Ga0207707_10033359 | Ga0207707_100333593 | 399 |
| 109 | 3300025913 | Ga0207695_10001415 | Ga0207695_1000141521 | 399 |
| 110 | 3300025913 | Ga0207695_10017499 | Ga0207695_100174994 | 399 |
| 111 | 3300025913 | Ga0207695_10045601 | Ga0207695_100456012 | 399 |
| 112 | 3300025917 | Ga0207660_10007910 | Ga0207660_100079103 | 399 |
| 113 | 3300025919 | Ga0207657_10014419 | Ga0207657_1001441910 | 399 |
| 114 | 3300025921 | Ga0207652_10006738 | Ga0207652_1000673811 | 399 |
| 115 | 3300025934 | Ga0207686_10004891 | Ga0207686_100048917 | 399 |
| 116 | 3300025938 | Ga0207704_10025740 | Ga0207704_100257402 | 399 |
| 117 | 3300025941 | Ga0207711_10000155 | Ga0207711_1000015552 | 399 |
| 118 | 3300025949 | Ga0207667_10051592 | Ga0207667_100515924 | 399 |
| 119 | 3300026078 | Ga0207702_10003418 | Ga0207702_100034185 | 399 |
| 120 | 3300031911 | Ga0307412_10002161 | Ga0307412_100021618 | 399 |
| 121 | 3300035113 | Ga0373936_0004759 | Ga0373936_0004759_1691_2902 | 399 |
| 122 | 3300037312 | Ga0395899_0000052 | Ga0395899_0000052_61927_63138 | 399 |
| 123 | 3300037418 | Ga0395900_0000002 | Ga0395900_0000002_639300_640511 | 399 |
| 124 | 3300037466 | Ga0395898_0022753 | Ga0395898_0022753_871_2082 | 399 |
| 125 | 3300037466 | Ga0395898_0142073 | Ga0395898_0142073_632_1843 | 399 |
| 126 | 3300037471 | Ga0395905_0010469 | Ga0395905_0010469_6513_7724 | 399 |
| 127 | 3300038443 | Ga0395901_0000013 | Ga0395901_0000013_63274_64485 | 399 |
| 128 | 3300041404 | Ga0439436_0000184 | Ga0439436_0000184_9115_10317 | 399 |
| 129 | 3300041413 | Ga0439465_0007445 | Ga0439465_0007445_2131_3333 | 399 |
| 130 | 3300042004 | Ga0439445_0008403 | Ga0439445_0008403_1168_2370 | 399 |
| 131 | 3300046471 | Ga0495650_0057095 | Ga0495650_0057095_64_1263 | 399 |
| 132 | 3300046512 | Ga0495610_0000902 | Ga0495610_0000902_17305_18507 | 399 |
| 133 | 3300048918 | Ga0496115_0004311 | Ga0496115_0004311_7301_8512 | 399 |
| 134 | 3300048922 | Ga0496119_0021791 | Ga0496119_0021791_2447_3649 | 399 |
| 135 | 3300049581 | Ga0501047_0002698 | Ga0501047_0002698_3096_4295 | 399 |
| 136 | 3300005262 | Ga0065165_1001264 | Ga0065165_10012647 | 400 |
| 137 | 3300005339 | Ga0070660_100023239 | Ga0070660_1000232392 | 400 |
| 138 | 3300005366 | Ga0070659_100001879 | Ga0070659_1000018794 | 400 |
| 139 | 3300005539 | Ga0068853_100240811 | Ga0068853_1002408111 | 400 |
| 140 | 3300005548 | Ga0070665_100000418 | Ga0070665_10000041819 | 400 |
| 141 | 3300009093 | Ga0105240_10069551 | Ga0105240_100695513 | 400 |
| 142 | 3300009093 | Ga0105240_10231333 | Ga0105240_102313332 | 400 |
| 143 | 3300009551 | Ga0105238_10035883 | Ga0105238_100358834 | 400 |
| 144 | 3300015689 | Ga0183360_10002 | Ga0183360_10002649 | 400 |
| 145 | 3300025263 | Ga0209565_1002271 | Ga0209565_10022714 | 400 |
| 146 | 3300025913 | Ga0207695_10072228 | Ga0207695_100722283 | 400 |
| 147 | 3300025913 | Ga0207695_10259939 | Ga0207695_102599391 | 400 |
| 148 | 3300025919 | Ga0207657_10036581 | Ga0207657_100365812 | 400 |
| 149 | 3300025919 | Ga0207657_10049834 | Ga0207657_100498343 | 400 |
| 150 | 3300025924 | Ga0207694_10015462 | Ga0207694_100154622 | 400 |
| 151 | 3300025932 | Ga0207690_10000344 | Ga0207690_1000034432 | 400 |
| 152 | 3300026041 | Ga0207639_10332686 | Ga0207639_103326861 | 400 |
| 153 | 3300028379 | Ga0268266_10000003 | Ga0268266_100000031166 | 400 |
| 154 | 3300046616 | Ga0495668_0000039 | Ga0495668_0000039_196293_197495 | 400 |
| 155 | 3300048918 | Ga0496115_0008015 | Ga0496115_0008015_5893_7119 | 400 |
| 156 | 3300048924 | Ga0496121_0001413 | Ga0496121_0001413_38_1243 | 400 |
| 157 | 3300048925 | Ga0496122_0000355 | Ga0496122_0000355_43374_44576 | 400 |
| 158 | 3300048926 | Ga0496123_0001971 | Ga0496123_0001971_8141_9343 | 400 |
| 159 | 3300053122 | Ga0500608_052320 | Ga0500608_052320_190_1392 | 400 |
| 160 | 3300003856 | Ga0058692_1000006 | Ga0058692_1000006326 | 401 |
| 161 | 3300009551 | Ga0105238_10012938 | Ga0105238_100129386 | 401 |
| 162 | 3300015265 | Ga0182005_1002805 | Ga0182005_10028052 | 401 |
| 163 | 3300027312 | Ga0209371_1000016 | Ga0209371_1000016322 | 401 |
| 164 | 3300030500 | Ga0268256_1000015 | Ga0268256_1000015248 | 401 |
| 165 | 3300048921 | Ga0496118_0039135 | Ga0496118_0039135_792_2000 | 401 |
| 166 | 3300048929 | Ga0496126_0028353 | Ga0496126_0028353_2878_4086 | 401 |
| 167 | 3300002737 | JGI25162J39368_1000767 | JGI25162J39368_10007675 | 402 |
| 168 | 3300002741 | JGI25157J39369_1000529 | JGI25157J39369_100052914 | 402 |
| 169 | 3300002771 | JGI25163J39215_1000203 | JGI25163J39215_10002035 | 402 |
| 170 | 3300002772 | JGI25164J39214_1000424 | JGI25164J39214_100042415 | 402 |
| 171 | 3300003214 | JGI25165J46597_1000804 | JGI25165J46597_10008045 | 402 |
| 172 | 3300003751 | Ga0055538_1001403 | Ga0055538_10014032 | 402 |
| 173 | 3300003761 | Ga0055535_1000769 | Ga0055535_100076915 | 402 |
| 174 | 3300003762 | Ga0055542_1000786 | Ga0055542_10007865 | 402 |
| 175 | 3300003763 | Ga0055529_1000672 | Ga0055529_10006725 | 402 |
| 176 | 3300005366 | Ga0070659_100006174 | Ga0070659_1000061745 | 402 |
| 177 | 3300005539 | Ga0068853_100031515 | Ga0068853_1000315152 | 402 |
| 178 | 3300005546 | Ga0070696_100017451 | Ga0070696_1000174513 | 402 |
| 179 | 3300009174 | Ga0105241_10225772 | Ga0105241_102257721 | 402 |
| 180 | 3300009551 | Ga0105238_10003909 | Ga0105238_100039099 | 402 |
| 181 | 3300013100 | Ga0157373_10000885 | Ga0157373_1000088510 | 402 |
| 182 | 3300013102 | Ga0157371_10007872 | Ga0157371_100078728 | 402 |
| 183 | 3300013307 | Ga0157372_10013497 | Ga0157372_100134978 | 402 |
| 184 | 3300014497 | Ga0182008_10088815 | Ga0182008_100888151 | 402 |
| 185 | 3300025207 | Ga0209760_100372 | Ga0209760_1003725 | 402 |
| 186 | 3300025224 | Ga0209784_100332 | Ga0209784_10033214 | 402 |
| 187 | 3300025231 | Ga0207427_100013 | Ga0207427_100013453 | 402 |
| 188 | 3300025233 | Ga0209437_100015 | Ga0209437_10001583 | 402 |
| 189 | 3300025242 | Ga0209258_100049 | Ga0209258_100049190 | 402 |
| 190 | 3300025246 | Ga0209646_1000815 | Ga0209646_10008159 | 402 |
| 191 | 3300025250 | Ga0209026_1000094 | Ga0209026_10000945 | 402 |
| 192 | 3300025250 | Ga0209026_1000098 | Ga0209026_100009816 | 402 |
| 193 | 3300025254 | Ga0209148_1000010 | Ga0209148_1000010830 | 402 |
| 194 | 3300025256 | Ga0209759_1000499 | Ga0209759_100049936 | 402 |
| 195 | 3300025256 | Ga0209759_1012813 | Ga0209759_10128132 | 402 |
| 196 | 3300025261 | Ga0209233_1000009 | Ga0209233_1000009340 | 402 |
| 197 | 3300025272 | Ga0209455_1000082 | Ga0209455_100008283 | 402 |
| 198 | 3300025911 | Ga0207654_10135557 | Ga0207654_101355571 | 402 |
| 199 | 3300025924 | Ga0207694_10067496 | Ga0207694_100674962 | 402 |
| 200 | 3300025932 | Ga0207690_10092645 | Ga0207690_100926451 | 402 |
| 201 | 3300026116 | Ga0207674_10166443 | Ga0207674_101664432 | 402 |
| 202 | 3300041459 | Ga0451800_0156804 | Ga0451800_0156804_540_1751 | 402 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5fcf-assembly1.cif.gz_A | crystal structure of xaa-pro dipeptidase from xanthomonas campestris, phosphate and mn bound | 0.9905 | 6 | 402 |
| 5cde-assembly1.cif.gz_B | r372a mutant of xaa-pro dipeptidase from xanthomonas campestris | 0.9893 | 6 | 402 |
| 5fcf-assembly1.cif.gz_B | crystal structure of xaa-pro dipeptidase from xanthomonas campestris, phosphate and mn bound | 0.9863 | 6 | 402 |
| 5fch-assembly1.cif.gz_B | crystal structure of xaa-pro dipeptidase from xanthomonas campestris, phosphate and zn bound | 0.9859 | 5 | 402 |
| 5fcf-assembly1.cif.gz_A | crystal structure of xaa-pro dipeptidase from xanthomonas campestris, phosphate and mn bound | 0.9855 | 6 | 402 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5fchB02 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.987 | 168 | 402 | 3.90.230.10 |
| 4r60B01 | Alpha Beta;3-Layer(aba) Sandwich;Creatine Amidinohydrolase; Chain A, domain 1;Creatinase/prolidase N-terminal domain | 0.9835 | 6 | 167 | 3.40.350.10 |
| 5fchB02 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9827 | 168 | 402 | 3.90.230.10 |
| 4r60B01 | Alpha Beta;3-Layer(aba) Sandwich;Creatine Amidinohydrolase; Chain A, domain 1;Creatinase/prolidase N-terminal domain | 0.9657 | 6 | 167 | 3.40.350.10 |
| 1wy2A02 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9519 | 169 | 392 | 3.90.230.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-I4WTV2-F1-model_v4 | Proline dipeptidase | 0.9781 | 135 | 307 |
|
| AF-A0A560HGF3-F1-model_v4 | Xaa-Pro dipeptidase | 0.9779 | 6 | 401 |
GO:0006508
GO:0008233 GO:0046872 |
| AF-A0A246DV97-F1-model_v4 | X-Pro dipeptidase | 0.9738 | 22 | 402 |
|
| AF-A0A3D1GQ51-F1-model_v4 | deleted | 0.9732 | 9 | 200 |
|
| AF-A0A2Z7CCK3-F1-model_v4 | Xaa-pro dipeptidase | 0.9719 | 222 | 402 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar