F309812

General Info

Members Datasets Scaffolds Average Seq Length
202 155 187 399

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10012938|Ga0105238_100129386
Length 418
Sequence MAPFYLSRFAVGKGWRMRGIGGSTAEAELAALKPWPNPAPAITAEDRGERLAKAQDLLADIGADAIIVGAGPSLRYFAGVAWNPTERLVAMLLPRHGQPKMICPRFELGSLQAGLGIAADIALWAEHESPYALTVAELAGMGAKTLAIDPALPFFVVNGLALAAPGLALVDGAPVIDGCRMIKSPAELALMAQAKAMTLEVHRRAARILADGITTTAVRRFIDQAHRALGADDGSSFCAVQFGVASAYPHGLPGEQSLKSGDVVLIDTGCKVQGYNSDITRTYVFGEPSAEVRRVWDVEKRAQAAAFAAVKPGVPCEQIDAVARAVLADAGFGPDYDLPGLPHRTGHGIGLSIHEAPYLVRGDKTPLAPGMCFSNEPMIVIPDAFGVRLEDHFHVTEEGAAWFTEPQPDLEEPFRPRN

Samples

Sample ID Description Type Environment
1 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
2 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
3 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
4 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
5 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
6 2818991457 Xanthomonas translucens 569 Isolate Unclassified
7 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
8 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
9 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
10 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
11 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
12 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
13 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
14 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
15 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
16 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
17 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
18 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
19 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
22 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
53 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
54 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
55 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
58 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
60 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
61 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
63 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
64 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
66 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
67 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
91 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
92 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
93 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
94 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
97 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
98 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
104 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
105 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
106 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
107 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
108 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
109 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
110 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
111 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
112 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
113 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
114 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
115 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
116 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
117 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
118 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
119 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
120 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
121 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
122 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
123 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
124 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
125 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
126 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
127 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
128 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
129 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
130 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
131 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
132 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
133 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
134 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
135 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
136 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
137 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
138 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
139 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
140 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
141 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
142 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
143 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
144 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
145 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
148 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
149 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
150 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
151 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
152 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
153 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
154 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
155 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.57
Metatranscriptomes 0
Isolates 7.43

Biome Distribution

Category Percentage (%)
Aerial Root 0.5
Bulb 0
Endosphere 11.88
Nodule 0
Rhizoplane 2.48
Rhizosphere 70.3
Stem 0
Stem Tuber 0
Unclassified 14.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000767 3300002737 Bacteria 21704
2 JGI25157J39369_1000529 3300002741 Bacteria 23142
3 JGI25163J39215_1000203 3300002771 Bacteria 23146
4 JGI25164J39214_1000424 3300002772 Bacteria 23737
5 JGI25165J46597_1000804 3300003214 Bacteria 23737
6 Ga0055538_1001403 3300003751 Bacteria 4707
7 Ga0055535_1000769 3300003761 Bacteria 23737
8 Ga0055542_1000786 3300003762 Bacteria 23737
9 Ga0055529_1000672 3300003763 Bacteria 23737
10 Ga0058692_1000006 3300003856 Bacteria 398109
11 Ga0065165_1001264 3300005262 Bacteria 28582
12 Ga0070658_10093818 3300005327 Bacteria 2476
13 Ga0070676_10072898 3300005328 Bacteria 2065
14 Ga0070670_100008923 3300005331 Bacteria 8562
15 Ga0070680_100003197 3300005336 Bacteria 12180
16 Ga0070660_100023239 3300005339 Bacteria 4593
17 Ga0070660_100040421 3300005339 Bacteria 3549
18 Ga0070669_100080087 3300005353 Bacteria 2430
19 Ga0070671_100135799 3300005355 Bacteria 2074
20 Ga0070659_100001879 3300005366 Bacteria 15050
21 Ga0070659_100006174 3300005366 Bacteria 8652
22 Ga0070659_100054360 3300005366 Bacteria 3153
23 Ga0070678_100127603 3300005456 Bacteria 2016
24 Ga0070681_10007802 3300005458 Bacteria 10467
25 Ga0070679_100021087 3300005530 Bacteria 6358
26 Ga0070679_100041623 3300005530 Bacteria 4572
27 Ga0068853_100031515 3300005539 Bacteria 4484
28 Ga0068853_100048694 3300005539 Bacteria 3641
29 Ga0068853_100240811 3300005539 Bacteria 1658
30 Ga0070696_100017451 3300005546 Bacteria 4844
31 Ga0070665_100000418 3300005548 Bacteria 62048
32 Ga0070665_100092329 3300005548 Bacteria 3032
33 Ga0068856_100005007 3300005614 Bacteria 13117
34 Ga0068864_100134845 3300005618 Bacteria 2222
35 Ga0068865_100003395 3300006881 Bacteria 9535
36 Ga0105251_10000048 3300009011 Bacteria 110218
37 Ga0105240_10003057 3300009093 Bacteria 26302
38 Ga0105240_10049052 3300009093 Bacteria 5332
39 Ga0105240_10069551 3300009093 Bacteria 4357
40 Ga0105240_10231333 3300009093 Bacteria 2148
41 Ga0105240_10247450 3300009093 Bacteria 2064
42 Ga0105241_10153093 3300009174 Bacteria 1888
43 Ga0105241_10225772 3300009174 Bacteria 1576
44 Ga0105242_10062360 3300009176 Bacteria 3068
45 Ga0105248_10000112 3300009177 Bacteria 91321
46 Ga0105248_10453304 3300009177 Bacteria 1445
47 Ga0105238_10003909 3300009551 Bacteria 14800
48 Ga0105238_10012938 3300009551 Bacteria 8420
49 Ga0105238_10035883 3300009551 Bacteria 5040
50 Ga0157373_10000885 3300013100 Bacteria 23176
51 Ga0157371_10007872 3300013102 Bacteria 8555
52 Ga0157370_10327996 3300013104 Bacteria 1411
53 Ga0157372_10013497 3300013307 Bacteria 8731
54 Ga0163163_10166831 3300014325 Bacteria 2248
55 Ga0182008_10002553 3300014497 Bacteria 11336
56 Ga0182008_10088815 3300014497 Bacteria 1523
57 Ga0182006_1001403 3300015261 Bacteria 14605
58 Ga0182005_1001553 3300015265 Bacteria 9091
59 Ga0182005_1002805 3300015265 Bacteria 6074
60 Ga0183360_10002 3300015689 Bacteria 953821
61 Ga0163161_10032048 3300017792 Bacteria 3750
62 Ga0209760_100372 3300025207 Bacteria 11839
63 Ga0209784_100332 3300025224 Bacteria 23717
64 Ga0207427_100013 3300025231 Bacteria 581419
65 Ga0209437_100015 3300025233 Bacteria 713457
66 Ga0209258_100049 3300025242 Bacteria 358328
67 Ga0209646_1000815 3300025246 Bacteria 10554
68 Ga0209026_1000094 3300025250 Bacteria 169671
69 Ga0209026_1000098 3300025250 Bacteria 161845
70 Ga0209148_1000010 3300025254 Bacteria 1265567
71 Ga0209759_1000499 3300025256 Bacteria 43165
72 Ga0209759_1012813 3300025256 Bacteria 2302
73 Ga0209233_1000009 3300025261 Bacteria 1265567
74 Ga0209565_1002271 3300025263 Bacteria 7098
75 Ga0209455_1000082 3300025272 Bacteria 257909
76 Ga0207713_1002271 3300025735 Bacteria 14165
77 Ga0207680_10187242 3300025903 Bacteria 1403
78 Ga0207654_10135557 3300025911 Bacteria 1563
79 Ga0207707_10033359 3300025912 Bacteria 4505
80 Ga0207695_10000837 3300025913 Bacteria 56634
81 Ga0207695_10001415 3300025913 Bacteria 40402
82 Ga0207695_10017499 3300025913 Bacteria 8338
83 Ga0207695_10045601 3300025913 Bacteria 4652
84 Ga0207695_10072228 3300025913 Bacteria 3522
85 Ga0207695_10259939 3300025913 Bacteria 1634
86 Ga0207660_10007910 3300025917 Bacteria 6879
87 Ga0207657_10014419 3300025919 Bacteria 7720
88 Ga0207657_10036581 3300025919 Bacteria 4393
89 Ga0207657_10049834 3300025919 Bacteria 3646
90 Ga0207652_10006738 3300025921 Bacteria 9259
91 Ga0207681_10057357 3300025923 Bacteria 2661
92 Ga0207694_10015462 3300025924 Bacteria 5755
93 Ga0207694_10067496 3300025924 Bacteria 2791
94 Ga0207690_10000344 3300025932 Bacteria 31116
95 Ga0207690_10024836 3300025932 Bacteria 3757
96 Ga0207690_10092645 3300025932 Bacteria 2139
97 Ga0207706_10001904 3300025933 Bacteria 20501
98 Ga0207686_10004891 3300025934 Bacteria 7204
99 Ga0207704_10025740 3300025938 Bacteria 3216
100 Ga0207711_10000155 3300025941 Bacteria 73463
101 Ga0207711_10127371 3300025941 Bacteria 2279
102 Ga0207667_10024364 3300025949 Bacteria 6644
103 Ga0207667_10051592 3300025949 Bacteria 4335
104 Ga0207639_10332686 3300026041 Bacteria 1352
105 Ga0207702_10003418 3300026078 Bacteria 14521
106 Ga0207674_10166443 3300026116 Bacteria 2159
107 Ga0209371_1000016 3300027312 Bacteria 646301
108 Ga0268266_10000003 3300028379 Bacteria 1701703
109 Ga0268266_10162559 3300028379 Bacteria 2021
110 Ga0307517_10009887 3300028786 Bacteria 13439
111 Ga0268256_1000015 3300030500 Bacteria 646300
112 Ga0307513_10013179 3300031456 Bacteria 10158
113 Ga0307509_10133418 3300031507 Bacteria 2434
114 Ga0307508_10000812 3300031616 Bacteria 36575
115 Ga0307412_10002161 3300031911 Bacteria 10904
116 Ga0307414_10110716 3300032004 Bacteria 2089
117 Ga0373936_0004759 3300035113 Bacteria 5128
118 Ga0395899_0000052 3300037312 Bacteria 221643
119 Ga0395900_0000002 3300037418 Bacteria 671103
120 Ga0395898_0022753 3300037466 Bacteria 6343
121 Ga0395898_0142073 3300037466 Bacteria 2298
122 Ga0395905_0010469 3300037471 Bacteria 9022
123 Ga0395905_0168071 3300037471 Bacteria 2061
124 Ga0395901_0000013 3300038443 Bacteria 375733
125 Ga0439436_0000184 3300041404 Bacteria 14746
126 Ga0439461_0000026 3300041410 Bacteria 18847
127 Ga0439465_0003115 3300041413 Bacteria 5420
128 Ga0439465_0007445 3300041413 Bacteria 3480
129 Ga0451800_0156804 3300041459 Bacteria 1910
130 Ga0439431_0000609 3300041997 Bacteria 7584
131 Ga0439445_0008403 3300042004 Bacteria 2415
132 Ga0439432_000185 3300042006 Bacteria 22317
133 Ga0439434_0001796 3300042435 Bacteria 6239
134 Ga0495638_0078288 3300046460 Bacteria 2012
135 Ga0495650_0057095 3300046471 Bacteria 1581
136 Ga0495585_0135469 3300046492 Bacteria 1293
137 Ga0495583_0002205 3300046506 Bacteria 17260
138 Ga0495583_0006056 3300046506 Bacteria 8009
139 Ga0495606_0000535 3300046507 Bacteria 61035
140 Ga0495610_0000902 3300046512 Bacteria 27613
141 Ga0495631_0023792 3300046518 Bacteria 2835
142 Ga0495637_0006312 3300046520 Bacteria 5963
143 Ga0495643_0007637 3300046522 Bacteria 6946
144 Ga0495643_0011057 3300046522 Bacteria 5519
145 Ga0495648_0000122 3300046524 Bacteria 93823
146 Ga0495663_0000364 3300046525 Bacteria 16763
147 Ga0495642_0000901 3300046528 Bacteria 13933
148 Ga0495633_0000696 3300046558 Bacteria 30750
149 Ga0495668_0000039 3300046616 Bacteria 231402
150 Ga0495668_0026087 3300046616 Bacteria 3318
151 Ga0495668_0035239 3300046616 Bacteria 2805
152 Ga0495611_0036232 3300046648 Bacteria 2188
153 Ga0495611_0045823 3300046648 Bacteria 1959
154 Ga0495625_0000424 3300046660 Bacteria 63593
155 Ga0495625_0016688 3300046660 Bacteria 5768
156 Ga0495669_0000361 3300046684 Bacteria 23171
157 Ga0495670_0004858 3300046691 Bacteria 6598
158 Ga0495649_0009002 3300046694 Bacteria 5962
159 Ga0495683_0000964 3300047323 Bacteria 20180
160 Ga0495687_000089 3300047443 Bacteria 141448
161 Ga0495677_0031636 3300047445 Bacteria 1926
162 Ga0496101_0217975 3300048904 Bacteria 1480
163 Ga0496109_0006363 3300048912 Bacteria 9947
164 Ga0496115_0004311 3300048918 Bacteria 10295
165 Ga0496115_0008015 3300048918 Bacteria 7795
166 Ga0496117_0000785 3300048920 Bacteria 49837
167 Ga0496118_0039135 3300048921 Bacteria 3788
168 Ga0496119_0003604 3300048922 Bacteria 15938
169 Ga0496119_0021791 3300048922 Bacteria 4614
170 Ga0496120_0000276 3300048923 Bacteria 86130
171 Ga0496121_0001413 3300048924 Bacteria 40691
172 Ga0496122_0000355 3300048925 Bacteria 98786
173 Ga0496122_0002179 3300048925 Bacteria 28682
174 Ga0496123_0000374 3300048926 Bacteria 83982
175 Ga0496123_0001971 3300048926 Bacteria 26603
176 Ga0496124_0001048 3300048927 Bacteria 43639
177 Ga0496126_0028353 3300048929 Bacteria 5338
178 Ga0496126_0070420 3300048929 Bacteria 3116
179 Ga0501046_0099158 3300049580 Bacteria 2236
180 Ga0501047_0002698 3300049581 Bacteria 16892
181 Ga0501275_000167 3300049772 Bacteria 7499
182 Ga0500610_0000160 3300053079 Bacteria 20065
183 Ga0500608_052320 3300053122 Bacteria 1961
184 Ga0500568_0022965 3300053139 Bacteria 2658
185 Ga0500636_0003614 3300053177 Bacteria 8721
186 Ga0500645_000008 3300053730 Bacteria 212254
187 Ga0500645_004989 3300053730 Bacteria 4974

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048929 Ga0496126_0070420 Ga0496126_0070420_1103_2170 355
2 3300048904 Ga0496101_0217975 Ga0496101_0217975_19_1107 358
3 3300048927 Ga0496124_0001048 Ga0496124_0001048_5687_6895 385
4 3300005331 Ga0070670_100008923 Ga0070670_1000089233 387
5 3300005353 Ga0070669_100080087 Ga0070669_1000800872 387
6 3300009011 Ga0105251_10000048 Ga0105251_1000004815 387
7 3300025735 Ga0207713_1002271 Ga0207713_10022715 387
8 3300025923 Ga0207681_10057357 Ga0207681_100573572 387
9 3300048920 Ga0496117_0000785 Ga0496117_0000785_40819_42027 387
10 3300048922 Ga0496119_0003604 Ga0496119_0003604_5671_6879 387
11 3300048923 Ga0496120_0000276 Ga0496120_0000276_41987_43195 387
12 3300048925 Ga0496122_0002179 Ga0496122_0002179_21665_22873 387
13 3300048926 Ga0496123_0000374 Ga0496123_0000374_40672_41880 387
14 3300005328 Ga0070676_10072898 Ga0070676_100728982 392
15 3300005456 Ga0070678_100127603 Ga0070678_1001276032 392
16 3300017792 Ga0163161_10032048 Ga0163161_100320482 392
17 3300025932 Ga0207690_10024836 Ga0207690_100248362 392
18 3300025933 Ga0207706_10001904 Ga0207706_100019047 392
19 3300028379 Ga0268266_10162559 Ga0268266_101625592 392
20 3300028786 Ga0307517_10009887 Ga0307517_100098876 392
21 3300031507 Ga0307509_10133418 Ga0307509_101334182 392
22 3300031616 Ga0307508_10000812 Ga0307508_1000081212 392
23 3300041410 Ga0439461_0000026 Ga0439461_0000026_13329_14507 392
24 3300041413 Ga0439465_0003115 Ga0439465_0003115_1519_2697 392
25 3300041997 Ga0439431_0000609 Ga0439431_0000609_2335_3513 392
26 3300042006 Ga0439432_000185 Ga0439432_000185_16884_18062 392
27 3300042435 Ga0439434_0001796 Ga0439434_0001796_822_2000 392
28 3300046460 Ga0495638_0078288 Ga0495638_0078288_413_1594 392
29 3300046492 Ga0495585_0135469 Ga0495585_0135469_55_1236 392
30 3300046506 Ga0495583_0002205 Ga0495583_0002205_5573_6754 392
31 3300046506 Ga0495583_0006056 Ga0495583_0006056_3902_5083 392
32 3300046507 Ga0495606_0000535 Ga0495606_0000535_44888_46069 392
33 3300046518 Ga0495631_0023792 Ga0495631_0023792_30_1211 392
34 3300046520 Ga0495637_0006312 Ga0495637_0006312_2088_3269 392
35 3300046522 Ga0495643_0007637 Ga0495643_0007637_4260_5441 392
36 3300046522 Ga0495643_0011057 Ga0495643_0011057_1892_3073 392
37 3300046524 Ga0495648_0000122 Ga0495648_0000122_16669_17850 392
38 3300046525 Ga0495663_0000364 Ga0495663_0000364_1167_2348 392
39 3300046558 Ga0495633_0000696 Ga0495633_0000696_8070_9251 392
40 3300046616 Ga0495668_0026087 Ga0495668_0026087_854_2035 392
41 3300046648 Ga0495611_0036232 Ga0495611_0036232_92_1273 392
42 3300046648 Ga0495611_0045823 Ga0495611_0045823_223_1404 392
43 3300046660 Ga0495625_0000424 Ga0495625_0000424_13639_14820 392
44 3300046660 Ga0495625_0016688 Ga0495625_0016688_3120_4301 392
45 3300046684 Ga0495669_0000361 Ga0495669_0000361_16348_17529 392
46 3300046691 Ga0495670_0004858 Ga0495670_0004858_2799_3980 392
47 3300046694 Ga0495649_0009002 Ga0495649_0009002_288_1469 392
48 3300047323 Ga0495683_0000964 Ga0495683_0000964_6238_7419 392
49 3300047443 Ga0495687_000089 Ga0495687_000089_53237_54418 392
50 3300047445 Ga0495677_0031636 Ga0495677_0031636_347_1528 392
51 3300053079 Ga0500610_0000160 Ga0500610_0000160_4207_5388 392
52 3300053177 Ga0500636_0003614 Ga0500636_0003614_874_2055 392
53 3300053730 Ga0500645_000008 Ga0500645_000008_46283_47464 392
54 iso_pu_bacteria 2984564862 2984566905 392
55 iso_pu_bacteria 2643221598 2643999067 394
56 iso_pu_bacteria 2643221614 2644086224 394
57 iso_pu_bacteria 2643221661 2644344722 394
58 iso_pu_bacteria 2643221666 2644367465 394
59 iso_pu_bacteria 2747842501 2748016446 395
60 iso_pu_bacteria 2953994433 2953994833 395
61 3300009174 Ga0105241_10153093 Ga0105241_101530932 396
62 3300037471 Ga0395905_0168071 Ga0395905_0168071_591_1781 396
63 3300053730 Ga0500645_004989 Ga0500645_004989_94_1293 396
64 iso_pu_bacteria 2941489479 2941492038 396
65 3300005548 Ga0070665_100092329 Ga0070665_1000923293 397
66 3300049580 Ga0501046_0099158 Ga0501046_0099158_901_2094 397
67 3300053139 Ga0500568_0022965 Ga0500568_0022965_1282_2475 397
68 iso_pu_bacteria 2919130084 2919130703 397
69 iso_pu_bacteria 2929195423 2929198294 397
70 3300005355 Ga0070671_100135799 Ga0070671_1001357992 398
71 3300005530 Ga0070679_100041623 Ga0070679_1000416235 398
72 3300005618 Ga0068864_100134845 Ga0068864_1001348452 398
73 3300009093 Ga0105240_10247450 Ga0105240_102474501 398
74 3300009177 Ga0105248_10453304 Ga0105248_104533042 398
75 3300025903 Ga0207680_10187242 Ga0207680_101872421 398
76 3300025913 Ga0207695_10000837 Ga0207695_1000083760 398
77 3300025941 Ga0207711_10127371 Ga0207711_101273712 398
78 3300025949 Ga0207667_10024364 Ga0207667_100243642 398
79 3300031456 Ga0307513_10013179 Ga0307513_100131799 398
80 3300032004 Ga0307414_10110716 Ga0307414_101107162 398
81 3300046528 Ga0495642_0000901 Ga0495642_0000901_7837_9045 398
82 3300046616 Ga0495668_0035239 Ga0495668_0035239_1178_2386 398
83 3300048912 Ga0496109_0006363 Ga0496109_0006363_1111_2319 398
84 3300049772 Ga0501275_000167 Ga0501275_000167_2753_3958 398
85 iso_pu_bacteria 2818991457 2819660021 398
86 iso_pu_bacteria 2852684882 2852685163 398
87 iso_pu_bacteria 8021622325 8021622748 398
88 iso_pu_bacteria 8021626552 8021630192 398
89 iso_pu_bacteria 8021648035 8021648144 398
90 3300005327 Ga0070658_10093818 Ga0070658_100938182 399
91 3300005336 Ga0070680_100003197 Ga0070680_1000031974 399
92 3300005339 Ga0070660_100040421 Ga0070660_1000404212 399
93 3300005366 Ga0070659_100054360 Ga0070659_1000543602 399
94 3300005458 Ga0070681_10007802 Ga0070681_100078027 399
95 3300005530 Ga0070679_100021087 Ga0070679_1000210873 399
96 3300005539 Ga0068853_100048694 Ga0068853_1000486943 399
97 3300005614 Ga0068856_100005007 Ga0068856_1000050079 399
98 3300006881 Ga0068865_100003395 Ga0068865_1000033954 399
99 3300009093 Ga0105240_10003057 Ga0105240_1000305721 399
100 3300009093 Ga0105240_10049052 Ga0105240_100490523 399
101 3300009176 Ga0105242_10062360 Ga0105242_100623602 399
102 3300009177 Ga0105248_10000112 Ga0105248_1000011290 399
103 3300013104 Ga0157370_10327996 Ga0157370_103279962 399
104 3300014325 Ga0163163_10166831 Ga0163163_101668313 399
105 3300014497 Ga0182008_10002553 Ga0182008_100025534 399
106 3300015261 Ga0182006_1001403 Ga0182006_10014035 399
107 3300015265 Ga0182005_1001553 Ga0182005_10015534 399
108 3300025912 Ga0207707_10033359 Ga0207707_100333593 399
109 3300025913 Ga0207695_10001415 Ga0207695_1000141521 399
110 3300025913 Ga0207695_10017499 Ga0207695_100174994 399
111 3300025913 Ga0207695_10045601 Ga0207695_100456012 399
112 3300025917 Ga0207660_10007910 Ga0207660_100079103 399
113 3300025919 Ga0207657_10014419 Ga0207657_1001441910 399
114 3300025921 Ga0207652_10006738 Ga0207652_1000673811 399
115 3300025934 Ga0207686_10004891 Ga0207686_100048917 399
116 3300025938 Ga0207704_10025740 Ga0207704_100257402 399
117 3300025941 Ga0207711_10000155 Ga0207711_1000015552 399
118 3300025949 Ga0207667_10051592 Ga0207667_100515924 399
119 3300026078 Ga0207702_10003418 Ga0207702_100034185 399
120 3300031911 Ga0307412_10002161 Ga0307412_100021618 399
121 3300035113 Ga0373936_0004759 Ga0373936_0004759_1691_2902 399
122 3300037312 Ga0395899_0000052 Ga0395899_0000052_61927_63138 399
123 3300037418 Ga0395900_0000002 Ga0395900_0000002_639300_640511 399
124 3300037466 Ga0395898_0022753 Ga0395898_0022753_871_2082 399
125 3300037466 Ga0395898_0142073 Ga0395898_0142073_632_1843 399
126 3300037471 Ga0395905_0010469 Ga0395905_0010469_6513_7724 399
127 3300038443 Ga0395901_0000013 Ga0395901_0000013_63274_64485 399
128 3300041404 Ga0439436_0000184 Ga0439436_0000184_9115_10317 399
129 3300041413 Ga0439465_0007445 Ga0439465_0007445_2131_3333 399
130 3300042004 Ga0439445_0008403 Ga0439445_0008403_1168_2370 399
131 3300046471 Ga0495650_0057095 Ga0495650_0057095_64_1263 399
132 3300046512 Ga0495610_0000902 Ga0495610_0000902_17305_18507 399
133 3300048918 Ga0496115_0004311 Ga0496115_0004311_7301_8512 399
134 3300048922 Ga0496119_0021791 Ga0496119_0021791_2447_3649 399
135 3300049581 Ga0501047_0002698 Ga0501047_0002698_3096_4295 399
136 3300005262 Ga0065165_1001264 Ga0065165_10012647 400
137 3300005339 Ga0070660_100023239 Ga0070660_1000232392 400
138 3300005366 Ga0070659_100001879 Ga0070659_1000018794 400
139 3300005539 Ga0068853_100240811 Ga0068853_1002408111 400
140 3300005548 Ga0070665_100000418 Ga0070665_10000041819 400
141 3300009093 Ga0105240_10069551 Ga0105240_100695513 400
142 3300009093 Ga0105240_10231333 Ga0105240_102313332 400
143 3300009551 Ga0105238_10035883 Ga0105238_100358834 400
144 3300015689 Ga0183360_10002 Ga0183360_10002649 400
145 3300025263 Ga0209565_1002271 Ga0209565_10022714 400
146 3300025913 Ga0207695_10072228 Ga0207695_100722283 400
147 3300025913 Ga0207695_10259939 Ga0207695_102599391 400
148 3300025919 Ga0207657_10036581 Ga0207657_100365812 400
149 3300025919 Ga0207657_10049834 Ga0207657_100498343 400
150 3300025924 Ga0207694_10015462 Ga0207694_100154622 400
151 3300025932 Ga0207690_10000344 Ga0207690_1000034432 400
152 3300026041 Ga0207639_10332686 Ga0207639_103326861 400
153 3300028379 Ga0268266_10000003 Ga0268266_100000031166 400
154 3300046616 Ga0495668_0000039 Ga0495668_0000039_196293_197495 400
155 3300048918 Ga0496115_0008015 Ga0496115_0008015_5893_7119 400
156 3300048924 Ga0496121_0001413 Ga0496121_0001413_38_1243 400
157 3300048925 Ga0496122_0000355 Ga0496122_0000355_43374_44576 400
158 3300048926 Ga0496123_0001971 Ga0496123_0001971_8141_9343 400
159 3300053122 Ga0500608_052320 Ga0500608_052320_190_1392 400
160 3300003856 Ga0058692_1000006 Ga0058692_1000006326 401
161 3300009551 Ga0105238_10012938 Ga0105238_100129386 401
162 3300015265 Ga0182005_1002805 Ga0182005_10028052 401
163 3300027312 Ga0209371_1000016 Ga0209371_1000016322 401
164 3300030500 Ga0268256_1000015 Ga0268256_1000015248 401
165 3300048921 Ga0496118_0039135 Ga0496118_0039135_792_2000 401
166 3300048929 Ga0496126_0028353 Ga0496126_0028353_2878_4086 401
167 3300002737 JGI25162J39368_1000767 JGI25162J39368_10007675 402
168 3300002741 JGI25157J39369_1000529 JGI25157J39369_100052914 402
169 3300002771 JGI25163J39215_1000203 JGI25163J39215_10002035 402
170 3300002772 JGI25164J39214_1000424 JGI25164J39214_100042415 402
171 3300003214 JGI25165J46597_1000804 JGI25165J46597_10008045 402
172 3300003751 Ga0055538_1001403 Ga0055538_10014032 402
173 3300003761 Ga0055535_1000769 Ga0055535_100076915 402
174 3300003762 Ga0055542_1000786 Ga0055542_10007865 402
175 3300003763 Ga0055529_1000672 Ga0055529_10006725 402
176 3300005366 Ga0070659_100006174 Ga0070659_1000061745 402
177 3300005539 Ga0068853_100031515 Ga0068853_1000315152 402
178 3300005546 Ga0070696_100017451 Ga0070696_1000174513 402
179 3300009174 Ga0105241_10225772 Ga0105241_102257721 402
180 3300009551 Ga0105238_10003909 Ga0105238_100039099 402
181 3300013100 Ga0157373_10000885 Ga0157373_1000088510 402
182 3300013102 Ga0157371_10007872 Ga0157371_100078728 402
183 3300013307 Ga0157372_10013497 Ga0157372_100134978 402
184 3300014497 Ga0182008_10088815 Ga0182008_100888151 402
185 3300025207 Ga0209760_100372 Ga0209760_1003725 402
186 3300025224 Ga0209784_100332 Ga0209784_10033214 402
187 3300025231 Ga0207427_100013 Ga0207427_100013453 402
188 3300025233 Ga0209437_100015 Ga0209437_10001583 402
189 3300025242 Ga0209258_100049 Ga0209258_100049190 402
190 3300025246 Ga0209646_1000815 Ga0209646_10008159 402
191 3300025250 Ga0209026_1000094 Ga0209026_10000945 402
192 3300025250 Ga0209026_1000098 Ga0209026_100009816 402
193 3300025254 Ga0209148_1000010 Ga0209148_1000010830 402
194 3300025256 Ga0209759_1000499 Ga0209759_100049936 402
195 3300025256 Ga0209759_1012813 Ga0209759_10128132 402
196 3300025261 Ga0209233_1000009 Ga0209233_1000009340 402
197 3300025272 Ga0209455_1000082 Ga0209455_100008283 402
198 3300025911 Ga0207654_10135557 Ga0207654_101355571 402
199 3300025924 Ga0207694_10067496 Ga0207694_100674962 402
200 3300025932 Ga0207690_10092645 Ga0207690_100926451 402
201 3300026116 Ga0207674_10166443 Ga0207674_101664432 402
202 3300041459 Ga0451800_0156804 Ga0451800_0156804_540_1751 402

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00557

Peptidase_M24

Metallopeptidase family M24

189

397

0.95

PF01321

Creatinase_N

Creatinase/Prolidase N-terminal domain

50

182

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5fcf-assembly1.cif.gz_A crystal structure of xaa-pro dipeptidase from xanthomonas campestris, phosphate and mn bound 0.9905 6 402
5cde-assembly1.cif.gz_B r372a mutant of xaa-pro dipeptidase from xanthomonas campestris 0.9893 6 402
5fcf-assembly1.cif.gz_B crystal structure of xaa-pro dipeptidase from xanthomonas campestris, phosphate and mn bound 0.9863 6 402
5fch-assembly1.cif.gz_B crystal structure of xaa-pro dipeptidase from xanthomonas campestris, phosphate and zn bound 0.9859 5 402
5fcf-assembly1.cif.gz_A crystal structure of xaa-pro dipeptidase from xanthomonas campestris, phosphate and mn bound 0.9855 6 402
ID Description Score Start End Superfamily
5fchB02 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.987 168 402 3.90.230.10
4r60B01 Alpha Beta;3-Layer(aba) Sandwich;Creatine Amidinohydrolase; Chain A, domain 1;Creatinase/prolidase N-terminal domain 0.9835 6 167 3.40.350.10
5fchB02 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9827 168 402 3.90.230.10
4r60B01 Alpha Beta;3-Layer(aba) Sandwich;Creatine Amidinohydrolase; Chain A, domain 1;Creatinase/prolidase N-terminal domain 0.9657 6 167 3.40.350.10
1wy2A02 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9519 169 392 3.90.230.10
ID Description Score Start End GO Terms
AF-I4WTV2-F1-model_v4 Proline dipeptidase 0.9781 135 307
AF-A0A560HGF3-F1-model_v4 Xaa-Pro dipeptidase 0.9779 6 401 GO:0006508
GO:0008233
GO:0046872
AF-A0A246DV97-F1-model_v4 X-Pro dipeptidase 0.9738 22 402
AF-A0A3D1GQ51-F1-model_v4 deleted 0.9732 9 200
AF-A0A2Z7CCK3-F1-model_v4 Xaa-pro dipeptidase 0.9719 222 402

Feature Viewer

pLDDT pTM Quality
93.17 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map