F309775

General Info

Members Datasets Scaffolds Average Seq Length
202 157 404 340

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10001985|Ga0105245_100019855
Length 358
Sequence MLQRLIAFGAIERCRTLMKYKKLGNAGVKVSELCLGAMTFGEADEKSFMHKIGSDEKTSFGVLNRALDLGVNFVDTADVYGQDGLSERVIGAWFERDQRRNELVLATKFRFSMGEGPNRSGASRYRIMRCAEHSLKRLRTDHIDLYQIHMQDIDTPEEELLRALDDLVTQGKVLYIGCSNYAAYRLMDSLWKSRTQSLASFVTLQAEYSLVTRDLEREHVPLCRAERLGILPWSPLAGGFLSGKYDKNTPPPAGARLEKWKDRLAGFDKERNWKILDAVRAIAQETSSTPAAVSLAWLLAQPQVTSAIFGARSIAQLEENVKATALTLSTDQLKRLDDASNFELGYPYSFMKNVQASW

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
59 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
92 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
93 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
94 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
95 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
96 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
97 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
98 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
99 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
100 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
101 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
102 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
103 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
104 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
105 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
106 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
107 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
108 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
109 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
110 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
117 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
118 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
119 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
122 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
123 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
124 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
132 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
133 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
134 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
135 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
136 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
137 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
138 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
139 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
140 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
141 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
142 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
143 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
144 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
145 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
146 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
147 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
148 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
149 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
150 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
151 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
152 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
153 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
154 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
155 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
156 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
157 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.01
Metatranscriptomes 0
Isolates 0.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.44
Nodule 0
Rhizoplane 4.46
Rhizosphere 80.2
Stem 0
Stem Tuber 0
Unclassified 1.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10001985 3300009098 Bacteria 18589
2 JGI25406J46586_10005279 3300003203 Bacteria 5994
3 rootH2_10064890 3300003320 Bacteria 3872
4 rootH2_10210376 3300003320 Bacteria 2261
5 rootL2_10167808 3300003322 Bacteria 3873
6 rootH1_10098451 3300003323 Bacteria 4963
7 rootH1_10196938 3300003323 Bacteria 16280
8 Ga0070690_100003305 3300005330 Bacteria 8801
9 Ga0068869_100110153 3300005334 Bacteria 2094
10 Ga0070682_100260633 3300005337 Bacteria 1254
11 Ga0070660_100114826 3300005339 Bacteria 2145
12 Ga0070689_100043161 3300005340 Bacteria 3464
13 Ga0070689_100093298 3300005340 Bacteria 2376
14 Ga0070661_100013809 3300005344 Bacteria 5676
15 Ga0070675_100101147 3300005354 Bacteria 2428
16 Ga0070659_100003791 3300005366 Bacteria 10788
17 Ga0070659_100208132 3300005366 Bacteria 1611
18 Ga0070710_10144239 3300005437 Bacteria 1463
19 Ga0070711_100170362 3300005439 Bacteria 1659
20 Ga0070678_100036393 3300005456 Bacteria 3445
21 Ga0070662_100068402 3300005457 Bacteria 2611
22 Ga0070681_10001350 3300005458 Bacteria 21438
23 Ga0068867_100106691 3300005459 Bacteria 2146
24 Ga0070706_100051449 3300005467 Bacteria 3802
25 Ga0070698_100012316 3300005471 Bacteria 9056
26 Ga0070679_100019165 3300005530 Bacteria 6648
27 Ga0070679_100441288 3300005530 Bacteria 1246
28 Ga0070684_100129516 3300005535 Bacteria 2275
29 Ga0070684_100344033 3300005535 Bacteria 1371
30 Ga0070672_100003366 3300005543 Bacteria 10357
31 Ga0070665_100005797 3300005548 Bacteria 12675
32 Ga0070665_100416486 3300005548 Bacteria 1352
33 Ga0070704_100361262 3300005549 Bacteria 1228
34 Ga0070664_100000536 3300005564 Bacteria 28952
35 Ga0068857_100000904 3300005577 Bacteria 22401
36 Ga0068854_100097554 3300005578 Bacteria 2197
37 Ga0070702_100009530 3300005615 Bacteria 4756
38 Ga0068859_100059633 3300005617 Bacteria 3845
39 Ga0068864_100179715 3300005618 Bacteria 1934
40 Ga0068864_100338214 3300005618 Bacteria 1418
41 Ga0068861_100003741 3300005719 Bacteria 10144
42 Ga0068858_100256526 3300005842 Bacteria 1661
43 Ga0081539_10006549 3300005985 Bacteria 11111
44 Ga0075366_10081385 3300006195 Unclassified 1934
45 Ga0075428_100072568 3300006844 Bacteria 3760
46 Ga0075430_100016872 3300006846 Bacteria 6220
47 Ga0075431_100031578 3300006847 Bacteria 5455
48 Ga0075433_10027871 3300006852 Bacteria 4797
49 Ga0075429_100067851 3300006880 Bacteria 3105
50 Ga0097620_100059631 3300006931 Bacteria 3845
51 Ga0105251_10001595 3300009011 Bacteria 19335
52 Ga0105240_10446041 3300009093 Bacteria 1449
53 Ga0111539_10024068 3300009094 Bacteria 7478
54 Ga0105245_10033578 3300009098 Bacteria 4548
55 Ga0105245_10179867 3300009098 Bacteria 2020
56 Ga0105243_10027021 3300009148 Bacteria 4395
57 Ga0105243_10037130 3300009148 Bacteria 3784
58 Ga0105241_10018369 3300009174 Bacteria 5144
59 Ga0105248_10233699 3300009177 Bacteria 2070
60 Ga0105249_10007143 3300009553 Bacteria 9748
61 Ga0105249_10020162 3300009553 Bacteria 5957
62 Ga0105249_10136056 3300009553 Bacteria 2351
63 Ga0157373_10055807 3300013100 Bacteria 2806
64 Ga0157369_10482337 3300013105 Bacteria 1283
65 Ga0157374_10141042 3300013296 Bacteria 2339
66 Ga0163163_10121369 3300014325 Bacteria 2647
67 Ga0163163_10648801 3300014325 Bacteria 1119
68 Ga0157380_10398353 3300014326 Bacteria 1305
69 Ga0157377_10080440 3300014745 Bacteria 1903
70 Ga0157379_10237883 3300014968 Bacteria 1651
71 Ga0157376_10204034 3300014969 Bacteria 1821
72 Ga0157376_10211758 3300014969 Bacteria 1790
73 Ga0213876_10071985 3300021384 Bacteria 1826
74 Ga0207682_10055850 3300025893 Bacteria 1643
75 Ga0207688_10029341 3300025901 Bacteria 3028
76 Ga0207645_10123431 3300025907 Bacteria 1682
77 Ga0207643_10033680 3300025908 Bacteria 2867
78 Ga0207654_10015982 3300025911 Unclassified 3902
79 Ga0207707_10115433 3300025912 Bacteria 2346
80 Ga0207660_10340565 3300025917 Bacteria 1200
81 Ga0207662_10010594 3300025918 Bacteria 5097
82 Ga0207662_10029417 3300025918 Bacteria 3183
83 Ga0207657_10112283 3300025919 Bacteria 2249
84 Ga0207649_10109685 3300025920 Bacteria 1841
85 Ga0207649_10260077 3300025920 Bacteria 1254
86 Ga0207652_10278376 3300025921 Bacteria 1509
87 Ga0207659_10042294 3300025926 Bacteria 3194
88 Ga0207687_10010885 3300025927 Bacteria 5943
89 Ga0207706_10324249 3300025933 Bacteria 1340
90 Ga0207709_10040491 3300025935 Bacteria 2790
91 Ga0207709_10058187 3300025935 Bacteria 2401
92 Ga0207670_10066686 3300025936 Bacteria 2473
93 Ga0207670_10107638 3300025936 Bacteria 2002
94 Ga0207691_10001436 3300025940 Bacteria 23782
95 Ga0207689_10028803 3300025942 Bacteria 4643
96 Ga0207661_10302508 3300025944 Bacteria 1434
97 Ga0207712_10023185 3300025961 Bacteria 4094
98 Ga0207712_10033879 3300025961 Bacteria 3456
99 Ga0207712_10229251 3300025961 Bacteria 1490
100 Ga0207712_10378688 3300025961 Bacteria 1184
101 Ga0207639_10045744 3300026041 Bacteria 3299
102 Ga0207678_10176538 3300026067 Bacteria 1824
103 Ga0207708_10152837 3300026075 Bacteria 1818
104 Ga0207702_10088622 3300026078 Bacteria 2704
105 Ga0207648_10069871 3300026089 Bacteria 3061
106 Ga0207676_10049403 3300026095 Bacteria 3272
107 Ga0207676_10144248 3300026095 Bacteria 2043
108 Ga0207676_10229639 3300026095 Bacteria 1658
109 Ga0207674_10000212 3300026116 Bacteria 71941
110 Ga0207674_10178511 3300026116 Bacteria 2075
111 Ga0207675_100195173 3300026118 Bacteria 1943
112 Ga0207683_10003809 3300026121 Bacteria 13067
113 Ga0207698_10107538 3300026142 Bacteria 2329
114 Ga0207428_10016566 3300027907 Bacteria 6336
115 Ga0268266_10013083 3300028379 Bacteria 7155
116 Ga0268266_10373579 3300028379 Bacteria 1343
117 Ga0265337_1010245 3300028556 Bacteria 3296
118 Ga0307515_10008310 3300028794 Bacteria 20256
119 Ga0307515_10148970 3300028794 Bacteria 2459
120 Ga0265330_10019117 3300031235 Bacteria 3143
121 Ga0265332_10033154 3300031238 Bacteria 2249
122 Ga0265332_10043052 3300031238 Bacteria 1951
123 Ga0265332_10121758 3300031238 Bacteria 1095
124 Ga0265320_10000541 3300031240 Bacteria 29187
125 Ga0265325_10003818 3300031241 Bacteria 9703
126 Ga0265340_10009152 3300031247 Bacteria 5326
127 Ga0265340_10034391 3300031247 Bacteria 2521
128 Ga0265331_10056184 3300031250 Bacteria 1870
129 Ga0265316_10001786 3300031344 Bacteria 22688
130 Ga0307513_10008890 3300031456 Bacteria 12774
131 Ga0307513_10223029 3300031456 Bacteria 1704
132 Ga0307509_10103493 3300031507 Bacteria 2875
133 Ga0307509_10204694 3300031507 Bacteria 1805
134 Ga0265313_10000370 3300031595 Bacteria 48777
135 Ga0307508_10002032 3300031616 Bacteria 21922
136 Ga0307508_10053768 3300031616 Bacteria 3572
137 Ga0307516_10011674 3300031730 Bacteria 9531
138 Ga0307406_10036862 3300031901 Bacteria 3015
139 Ga0307406_10045810 3300031901 Bacteria 2748
140 Ga0307406_10129393 3300031901 Bacteria 1770
141 Ga0307406_10262230 3300031901 Bacteria 1308
142 Ga0307415_100021708 3300032126 Bacteria 3952
143 Ga0373936_0000008 3300035113 Bacteria 268505
144 Ga0373941_0023744 3300035115 Bacteria 1754
145 Ga0373954_0078240 3300035118 Bacteria 1578
146 Ga0373961_0000129 3300035241 Bacteria 38869
147 Ga0373937_0086861 3300036401 Bacteria 2894
148 Ga0395899_0016073 3300037312 Bacteria 5705
149 Ga0395900_0145777 3300037418 Bacteria 2421
150 Ga0395901_0055015 3300038443 Bacteria 4137
151 Ga0436365_0162361 3300039437 Bacteria 1969
152 Ga0436365_1357703 3300039437 Bacteria 8686
153 Ga0436363_0652668 3300039450 Bacteria 3900
154 Ga0451807_0233567 3300041486 Bacteria 7987
155 Ga0451577_0014191 3300042876 Bacteria 7427
156 Ga0466969_0004576 3300044656 Bacteria 7368
157 Ga0466967_0021355 3300045976 Bacteria 5256
158 Ga0466967_0117183 3300045976 Bacteria 2455
159 Ga0495650_0045324 3300046471 Bacteria 1852
160 Ga0495680_0011411 3300047322 Bacteria 7866
161 Ga0496104_0101010 3300048907 Bacteria 2761
162 Ga0496106_0143176 3300048909 Bacteria 1881
163 Ga0496108_0021214 3300048911 Bacteria 5338
164 Ga0496109_0029473 3300048912 Bacteria 4915
165 Ga0496111_0140532 3300048914 Bacteria 1789
166 Ga0496112_0039887 3300048915 Bacteria 4589
167 Ga0496114_0007593 3300048917 Bacteria 8571
168 Ga0496114_0191435 3300048917 Bacteria 1790
169 Ga0501034_0289811 3300049571 Bacteria 1575
170 Ga0501034_0301223 3300049571 Bacteria 1540
171 Ga0501070_0047880 3300049586 Bacteria 3552
172 Ga0501070_0149615 3300049586 Bacteria 1926
173 Ga0501074_0156954 3300049590 Bacteria 1625
174 Ga0501227_003214 3300049665 Bacteria 3548
175 Ga0501080_0111135 3300049742 Bacteria 2540
176 Ga0501044_0082960 3300049823 Bacteria 3242
177 Ga0501044_0083683 3300049823 Bacteria 3226
178 nmdc:mga0k408_162268_c1 3300050493 Unclassified 1332
179 nmdc:mga05p37_185320_c1 3300050507 Bacteria 2531
180 nmdc:mga09592_100614_c1 3300050508 Bacteria 2475
181 nmdc:mga09592_117029_c1 3300050508 Bacteria 2288
182 nmdc:mga09592_13250_c1 3300050508 Bacteria 6732
183 nmdc:mga08y16_17675_c1 3300050511 Bacteria 7512
184 nmdc:mga0n895_45221_c1 3300050512 Bacteria 4295
185 nmdc:mga0n895_59453_c1 3300050512 Bacteria 3770
186 nmdc:mga0rr50_290857_c1 3300050513 Bacteria 1365
187 nmdc:mga0a205_18565_c1 3300050515 Bacteria 6542
188 Ga0495612_0143909 3300053078 Bacteria 1035
189 Ga0500646_0009792 3300053090 Bacteria 2453
190 Ga0500583_0012891 3300053092 Bacteria 3210
191 Ga0500640_002160 3300053095 Bacteria 6391
192 Ga0500554_000031 3300053102 Bacteria 23280
193 Ga0500595_000177 3300053119 Bacteria 42904
194 Ga0500597_033608 3300053120 Bacteria 2125
195 Ga0500614_000938 3300053123 Bacteria 7273
196 Ga0500559_0006730 3300053136 Bacteria 5163
197 Ga0500603_005983 3300053150 Bacteria 2636
198 Ga0500638_032051 3300053162 Bacteria 2537
199 Ga0500637_0051747 3300053178 Bacteria 2341
200 Ga0501084_0398806 3300054114 Bacteria 1163
201 2863425983 2863421361 Bacteria 7300805
202 2919109704 2919108558 Bacteria 5897419
203 Ga0105245_10001985
204 JGI25406J46586_10005279
205 rootH2_10064890
206 rootH2_10210376
207 rootL2_10167808
208 rootH1_10098451
209 rootH1_10196938
210 Ga0070690_100003305
211 Ga0068869_100110153
212 Ga0070682_100260633
213 Ga0070660_100114826
214 Ga0070689_100043161
215 Ga0070689_100093298
216 Ga0070661_100013809
217 Ga0070675_100101147
218 Ga0070659_100003791
219 Ga0070659_100208132
220 Ga0070710_10144239
221 Ga0070711_100170362
222 Ga0070678_100036393
223 Ga0070662_100068402
224 Ga0070681_10001350
225 Ga0068867_100106691
226 Ga0070706_100051449
227 Ga0070698_100012316
228 Ga0070679_100019165
229 Ga0070679_100441288
230 Ga0070684_100129516
231 Ga0070684_100344033
232 Ga0070672_100003366
233 Ga0070665_100005797
234 Ga0070665_100416486
235 Ga0070704_100361262
236 Ga0070664_100000536
237 Ga0068857_100000904
238 Ga0068854_100097554
239 Ga0070702_100009530
240 Ga0068859_100059633
241 Ga0068864_100179715
242 Ga0068864_100338214
243 Ga0068861_100003741
244 Ga0068858_100256526
245 Ga0081539_10006549
246 Ga0075366_10081385
247 Ga0075428_100072568
248 Ga0075430_100016872
249 Ga0075431_100031578
250 Ga0075433_10027871
251 Ga0075429_100067851
252 Ga0097620_100059631
253 Ga0105251_10001595
254 Ga0105240_10446041
255 Ga0111539_10024068
256 Ga0105245_10033578
257 Ga0105245_10179867
258 Ga0105243_10027021
259 Ga0105243_10037130
260 Ga0105241_10018369
261 Ga0105248_10233699
262 Ga0105249_10007143
263 Ga0105249_10020162
264 Ga0105249_10136056
265 Ga0157373_10055807
266 Ga0157369_10482337
267 Ga0157374_10141042
268 Ga0163163_10121369
269 Ga0163163_10648801
270 Ga0157380_10398353
271 Ga0157377_10080440
272 Ga0157379_10237883
273 Ga0157376_10204034
274 Ga0157376_10211758
275 Ga0213876_10071985
276 Ga0207682_10055850
277 Ga0207688_10029341
278 Ga0207645_10123431
279 Ga0207643_10033680
280 Ga0207654_10015982
281 Ga0207707_10115433
282 Ga0207660_10340565
283 Ga0207662_10010594
284 Ga0207662_10029417
285 Ga0207657_10112283
286 Ga0207649_10109685
287 Ga0207649_10260077
288 Ga0207652_10278376
289 Ga0207659_10042294
290 Ga0207687_10010885
291 Ga0207706_10324249
292 Ga0207709_10040491
293 Ga0207709_10058187
294 Ga0207670_10066686
295 Ga0207670_10107638
296 Ga0207691_10001436
297 Ga0207689_10028803
298 Ga0207661_10302508
299 Ga0207712_10023185
300 Ga0207712_10033879
301 Ga0207712_10229251
302 Ga0207712_10378688
303 Ga0207639_10045744
304 Ga0207678_10176538
305 Ga0207708_10152837
306 Ga0207702_10088622
307 Ga0207648_10069871
308 Ga0207676_10049403
309 Ga0207676_10144248
310 Ga0207676_10229639
311 Ga0207674_10000212
312 Ga0207674_10178511
313 Ga0207675_100195173
314 Ga0207683_10003809
315 Ga0207698_10107538
316 Ga0207428_10016566
317 Ga0268266_10013083
318 Ga0268266_10373579
319 Ga0265337_1010245
320 Ga0307515_10008310
321 Ga0307515_10148970
322 Ga0265330_10019117
323 Ga0265332_10033154
324 Ga0265332_10043052
325 Ga0265332_10121758
326 Ga0265320_10000541
327 Ga0265325_10003818
328 Ga0265340_10009152
329 Ga0265340_10034391
330 Ga0265331_10056184
331 Ga0265316_10001786
332 Ga0307513_10008890
333 Ga0307513_10223029
334 Ga0307509_10103493
335 Ga0307509_10204694
336 Ga0265313_10000370
337 Ga0307508_10002032
338 Ga0307508_10053768
339 Ga0307516_10011674
340 Ga0307406_10036862
341 Ga0307406_10045810
342 Ga0307406_10129393
343 Ga0307406_10262230
344 Ga0307415_100021708
345 Ga0373936_0000008
346 Ga0373941_0023744
347 Ga0373954_0078240
348 Ga0373961_0000129
349 Ga0373937_0086861
350 Ga0395899_0016073
351 Ga0395900_0145777
352 Ga0395901_0055015
353 Ga0436365_0162361
354 Ga0436365_1357703
355 Ga0436363_0652668
356 Ga0451807_0233567
357 Ga0451577_0014191
358 Ga0466969_0004576
359 Ga0466967_0021355
360 Ga0466967_0117183
361 Ga0495650_0045324
362 Ga0495680_0011411
363 Ga0496104_0101010
364 Ga0496106_0143176
365 Ga0496108_0021214
366 Ga0496109_0029473
367 Ga0496111_0140532
368 Ga0496112_0039887
369 Ga0496114_0007593
370 Ga0496114_0191435
371 Ga0501034_0289811
372 Ga0501034_0301223
373 Ga0501070_0047880
374 Ga0501070_0149615
375 Ga0501074_0156954
376 Ga0501227_003214
377 Ga0501080_0111135
378 Ga0501044_0082960
379 Ga0501044_0083683
380 nmdc:mga0k408_162268_c1
381 nmdc:mga05p37_185320_c1
382 nmdc:mga09592_100614_c1
383 nmdc:mga09592_117029_c1
384 nmdc:mga09592_13250_c1
385 nmdc:mga08y16_17675_c1
386 nmdc:mga0n895_45221_c1
387 nmdc:mga0n895_59453_c1
388 nmdc:mga0rr50_290857_c1
389 nmdc:mga0a205_18565_c1
390 Ga0495612_0143909
391 Ga0500646_0009792
392 Ga0500583_0012891
393 Ga0500640_002160
394 Ga0500554_000031
395 Ga0500595_000177
396 Ga0500597_033608
397 Ga0500614_000938
398 Ga0500559_0006730
399 Ga0500603_005983
400 Ga0500638_032051
401 Ga0500637_0051747
402 Ga0501084_0398806
403 2863425983
404 2919109704

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

32

341

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7utf-assembly2.cif.gz_D structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9303 1 328
7utf-assembly1.cif.gz_C structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9295 1 328
7utf-assembly1.cif.gz_A structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9259 1 326
7utf-assembly2.cif.gz_B structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9192 1 326
4xk2-assembly2.cif.gz_B crystal structure of aldo-keto reductase from polaromonas sp. js666 0.9151 1 325
ID Description Score Start End Superfamily
af_P77735_1_322_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.932 1 314 3.20.20.100
af_O59826_13_339_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9178 1 313 3.20.20.100
af_C4J2K0_1_323_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9153 1 309 3.20.20.100
4xk2A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9108 1 325 3.20.20.100
af_P77735_1_322_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9068 1 314 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A836UBG9-F1-model_v4 Aldo/keto reductase 0.9657 56 220 GO:0005829
AF-A0A7Z1AX47-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.961 1 334 GO:0016491
AF-A0A7Z1AX47-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9582 1 334 GO:0016491
AF-A0A0B7BLA2-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9565 2 277
AF-A0A2C1L178-F1-model_v4 Aldo/keto reductase 0.9563 1 321 GO:0005829
GO:0016491

Map