F309576

General Info

Members Datasets Scaffolds Average Seq Length
202 106 202 82

Family's Representative Sequence

Representative Sequence 3300005545|Ga0070695_100625929|Ga0070695_1006259292
Length 99
Sequence MAPKYHDYPVRQKHLHMTTEMLSTLGRHIAEKILKQPKRSITPDEPIISSGLIDSFSLVDLALFVEDTYGVRVEDSELNAATFDTLTQLAALIESRQTK

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
59 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
60 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
61 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
62 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
63 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
64 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
65 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
66 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
67 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
68 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
69 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
70 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
71 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
72 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
73 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
74 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
75 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
76 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
77 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
78 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
79 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
80 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
81 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
82 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
83 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
84 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
85 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
86 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
87 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
88 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
89 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
90 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
91 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
92 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
93 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
94 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
95 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
96 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
97 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
98 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
99 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
100 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
101 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
102 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
103 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
104 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
105 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
106 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10015907 3300003203 Bacteria 3155
2 Ga0065704_10700961 3300005289 Bacteria 561
3 Ga0065712_10323866 3300005290 Bacteria 824
4 Ga0065707_10908565 3300005295 Bacteria 564
5 Ga0070683_102239135 3300005329 Unclassified 524
6 Ga0070690_101795129 3300005330 Bacteria 500
7 Ga0070680_100989811 3300005336 Bacteria 726
8 Ga0070689_100537097 3300005340 Unclassified 1006
9 Ga0070691_10340633 3300005341 Bacteria 830
10 Ga0070687_100504073 3300005343 Unclassified 815
11 Ga0070705_100063733 3300005440 Unclassified 2199
12 Ga0070694_100426936 3300005444 Bacteria 1042
13 Ga0070694_100520726 3300005444 Unclassified 949
14 Ga0070706_100303296 3300005467 Bacteria 1490
15 Ga0070706_101752838 3300005467 Bacteria 565
16 Ga0070707_102055840 3300005468 Bacteria 539
17 Ga0070698_100018610 3300005471 Bacteria 7312
18 Ga0070698_100302664 3300005471 Bacteria 1529
19 Ga0070698_101274576 3300005471 Unclassified 685
20 Ga0070699_100041824 3300005518 Bacteria 3965
21 Ga0070699_100152850 3300005518 Unclassified 2042
22 Ga0070699_100217490 3300005518 Unclassified 1702
23 Ga0070699_100347070 3300005518 Unclassified 1336
24 Ga0070699_101565565 3300005518 Bacteria 604
25 Ga0070697_100322641 3300005536 Bacteria 1330
26 Ga0070697_100482803 3300005536 Unclassified 1082
27 Ga0070697_101635607 3300005536 Bacteria 576
28 Ga0070695_100018234 3300005545 Bacteria 4261
29 Ga0070695_100625929 3300005545 Bacteria 847
30 Ga0070695_100701659 3300005545 Unclassified 803
31 Ga0070695_101458451 3300005545 Bacteria 569
32 Ga0070696_100036358 3300005546 Bacteria 3395
33 Ga0070704_100161027 3300005549 Bacteria 1775
34 Ga0070704_100386267 3300005549 Bacteria 1191
35 Ga0070704_100598339 3300005549 Bacteria 969
36 Ga0070704_101722394 3300005549 Unclassified 579
37 Ga0068857_100484879 3300005577 Bacteria 1159
38 Ga0068857_101456301 3300005577 Unclassified 667
39 Ga0068857_102368981 3300005577 Bacteria 521
40 Ga0070702_100377997 3300005615 Bacteria 1006
41 Ga0068859_100318562 3300005617 Bacteria 1649
42 Ga0068859_100719119 3300005617 Bacteria 1089
43 Ga0068859_102439854 3300005617 Bacteria 576
44 Ga0068870_10168221 3300005840 Bacteria 1306
45 Ga0068858_100721548 3300005842 Bacteria 970
46 Ga0068862_100124404 3300005844 Unclassified 2276
47 Ga0068862_100235692 3300005844 Unclassified 1662
48 Ga0068862_101645485 3300005844 Bacteria 649
49 Ga0081539_10016803 3300005985 Bacteria 5193
50 Ga0075427_10000606 3300006194 Bacteria 4193
51 Ga0075428_100130383 3300006844 Bacteria 2735
52 Ga0075428_100530555 3300006844 Unclassified 1259
53 Ga0075428_101700271 3300006844 Unclassified 658
54 Ga0075430_100324337 3300006846 Unclassified 1273
55 Ga0075430_101303033 3300006846 Unclassified 597
56 Ga0075431_100006157 3300006847 Bacteria 11901
57 Ga0075431_100374171 3300006847 Bacteria 1429
58 Ga0075434_100860387 3300006871 Bacteria 922
59 Ga0075429_100010245 3300006880 Bacteria 8114
60 Ga0075429_100098038 3300006880 Bacteria 2557
61 Ga0075429_100470622 3300006880 Bacteria 1101
62 Ga0075429_100524727 3300006880 Bacteria 1038
63 Ga0075429_101023689 3300006880 Unclassified 722
64 Ga0075429_101554406 3300006880 Unclassified 575
65 Ga0097620_100318598 3300006931 Bacteria 1649
66 Ga0097620_100719187 3300006931 Bacteria 1089
67 Ga0097620_102438429 3300006931 Bacteria 576
68 Ga0111539_10982610 3300009094 Bacteria 981
69 Ga0105245_10852402 3300009098 Unclassified 951
70 Ga0105247_10500107 3300009101 Bacteria 885
71 Ga0114129_10046764 3300009147 Bacteria 6081
72 Ga0114129_10078151 3300009147 Bacteria 4603
73 Ga0114129_10421908 3300009147 Unclassified 1754
74 Ga0105243_10003382 3300009148 Bacteria 12941
75 Ga0105243_10925032 3300009148 Bacteria 869
76 Ga0105249_10027255 3300009553 Bacteria 5155
77 Ga0105249_10663852 3300009553 Bacteria 1101
78 Ga0105249_11573433 3300009553 Unclassified 730
79 Ga0105249_12610110 3300009553 Unclassified 577
80 Ga0105246_10228929 3300011119 Bacteria 1462
81 Ga0157375_12661313 3300013308 Bacteria 598
82 Ga0163163_10976545 3300014325 Unclassified 910
83 Ga0157380_11969487 3300014326 Unclassified 646
84 Ga0157377_10524646 3300014745 Bacteria 832
85 Ga0207684_10380730 3300025910 Bacteria 1214
86 Ga0207684_10452792 3300025910 Bacteria 1102
87 Ga0207660_11444732 3300025917 Unclassified 557
88 Ga0207681_11048936 3300025923 Unclassified 684
89 Ga0207709_10013312 3300025935 Bacteria 4538
90 Ga0207709_10399160 3300025935 Bacteria 1051
91 Ga0207709_11296364 3300025935 Bacteria 602
92 Ga0207709_11582797 3300025935 Bacteria 544
93 Ga0207670_10377984 3300025936 Bacteria 1128
94 Ga0207670_10385766 3300025936 Bacteria 1117
95 Ga0207712_10028904 3300025961 Unclassified 3713
96 Ga0207712_10253640 3300025961 Bacteria 1423
97 Ga0207712_10445889 3300025961 Unclassified 1097
98 Ga0207708_10091700 3300026075 Bacteria 2343
99 Ga0207675_100273611 3300026118 Bacteria 1639
100 Ga0209995_1045416 3300027471 Unclassified 743
101 Ga0209999_1040701 3300027543 Bacteria 871
102 Ga0209966_1042861 3300027695 Bacteria 947
103 Ga0268265_10116445 3300028380 Bacteria 2193
104 Ga0268265_10310192 3300028380 Bacteria 1424
105 Ga0265326_10020303 3300028558 Unclassified 1904
106 Ga0265334_10015060 3300028573 Unclassified 3216
107 Ga0265318_10002960 3300028577 Bacteria 8796
108 Ga0265336_10184132 3300028666 Unclassified 621
109 Ga0265338_10030391 3300028800 Bacteria 5323
110 Ga0265324_10040730 3300029957 Unclassified 1609
111 Ga0265320_10027473 3300031240 Unclassified 2966
112 Ga0265340_10003249 3300031247 Bacteria 9216
113 Ga0265331_10032419 3300031250 Unclassified 2589
114 Ga0265316_10497417 3300031344 Unclassified 871
115 Ga0265313_10163778 3300031595 Unclassified 943
116 Ga0316575_10100533 3300031665 Bacteria 1176
117 Ga0316575_10168185 3300031665 Unclassified 908
118 Ga0316579_10010908 3300031691 Bacteria 3849
119 Ga0316579_10130514 3300031691 Unclassified 1210
120 Ga0316576_10264539 3300031727 Unclassified 1290
121 Ga0316578_10811515 3300031728 Unclassified 542
122 Ga0316577_10018253 3300031733 Bacteria 3878
123 Ga0316577_10044857 3300031733 Bacteria 2473
124 Ga0316577_10292933 3300031733 Unclassified 922
125 Ga0307410_11558214 3300031852 Bacteria 583
126 Ga0307416_101330100 3300032002 Unclassified 824
127 Ga0307416_103707509 3300032002 Bacteria 511
128 Ga0316585_10300180 3300032137 Unclassified 534
129 Ga0373934_0361556 3300035086 Unclassified 605
130 Ga0373955_0531361 3300035172 Bacteria 719
131 Ga0373962_0060718 3300035242 Bacteria 1110
132 Ga0316574_0257208 3300035398 Bacteria 1115
133 Ga0316574_0485512 3300035398 Unclassified 771
134 Ga0373933_0287142 3300035724 Unclassified 1064
135 Ga0316582_0013522 3300036647 Bacteria 4597
136 Ga0316582_0034550 3300036647 Bacteria 3115
137 Ga0316582_0060343 3300036647 Unclassified 2431
138 Ga0316584_0177521 3300036712 Bacteria 1577
139 Ga0451577_0030327 3300042876 Bacteria 4887
140 Ga0451577_0058648 3300042876 Bacteria 3432
141 Ga0451577_0167172 3300042876 Unclassified 1982
142 Ga0451577_0706042 3300042876 Bacteria 913
143 Ga0451577_0967894 3300042876 Unclassified 765
144 Ga0451577_1867903 3300042876 Unclassified 526
145 Ga0453683_0025063 3300044673 Bacteria 3791
146 Ga0453683_0034093 3300044673 Bacteria 3209
147 Ga0453683_0115402 3300044673 Bacteria 1689
148 Ga0453683_0354877 3300044673 Unclassified 942
149 Ga0453683_0818730 3300044673 Bacteria 613
150 Ga0453683_1019128 3300044673 Bacteria 550
151 Ga0453684_0000003 3300044712 Bacteria 1481694
152 Ga0453684_0000203 3300044712 Bacteria 258635
153 Ga0453684_0001311 3300044712 Bacteria 73522
154 Ga0453684_0006057 3300044712 Bacteria 23369
155 Ga0453684_0013888 3300044712 Bacteria 12991
156 Ga0453684_0050868 3300044712 Bacteria 5442
157 Ga0453684_0059528 3300044712 Bacteria 4923
158 Ga0453684_0066781 3300044712 Bacteria 4578
159 Ga0453684_0142229 3300044712 Bacteria 2863
160 Ga0453684_0173314 3300044712 Bacteria 2540
161 Ga0453684_0176580 3300044712 Bacteria 2511
162 Ga0453684_0266051 3300044712 Bacteria 1962
163 Ga0453684_0284036 3300044712 Bacteria 1886
164 Ga0453684_0307534 3300044712 Bacteria 1800
165 Ga0453684_0335962 3300044712 Bacteria 1707
166 Ga0453684_0661942 3300044712 Bacteria 1138
167 Ga0453684_0685069 3300044712 Unclassified 1115
168 Ga0453684_1542058 3300044712 Unclassified 684
169 Ga0453684_1748206 3300044712 Unclassified 634
170 Ga0451576_0352783 3300045051 Unclassified 1540
171 Ga0451576_0527052 3300045051 Bacteria 1241
172 Ga0451576_2176483 3300045051 Unclassified 570
173 Ga0495630_0354990 3300046517 Unclassified 1122
174 Ga0501298_158921 3300049521 Bacteria 557
175 Ga0501299_031517 3300049522 Unclassified 1026
176 Ga0501072_1474877 3300049588 Unclassified 525
177 Ga0501073_0183288 3300049589 Bacteria 1449
178 Ga0501074_0767176 3300049590 Unclassified 680
179 Ga0501075_0323476 3300049591 Unclassified 1175
180 Ga0501076_0278872 3300049592 Unclassified 1369
181 Ga0501227_080554 3300049665 Bacteria 853
182 Ga0501079_0065517 3300049741 Unclassified 2803
183 Ga0501080_0032708 3300049742 Bacteria 4852
184 Ga0501080_1814111 3300049742 Unclassified 512
185 Ga0501081_0577236 3300049743 Unclassified 841
186 nmdc:mga05p37_1411597_c1 3300050507 Bacteria 700
187 nmdc:mga05p37_2197863_c1 3300050507 Unclassified 512
188 nmdc:mga05p37_30557_c1 3300050507 Bacteria 6574
189 nmdc:mga05p37_631752_c1 3300050507 Bacteria 1203
190 nmdc:mga09592_140056_c1 3300050508 Bacteria 2085
191 nmdc:mga09592_1538764_c1 3300050508 Unclassified 540
192 nmdc:mga09592_210287_c1 3300050508 Unclassified 1685
193 nmdc:mga09592_290342_c1 3300050508 Bacteria 1418
194 nmdc:mga09592_862666_c1 3300050508 Unclassified 763
195 nmdc:mga09592_90817_c1 3300050508 Bacteria 2609
196 nmdc:mga0qj67_512588_c1 3300050509 Unclassified 964
197 nmdc:mga06r32_256225_c1 3300050510 Bacteria 1737
198 nmdc:mga06r32_59854_c1 3300050510 Bacteria 3664
199 nmdc:mga0n895_609447_c1 3300050512 Bacteria 1093
200 Ga0501084_0683150 3300054114 Unclassified 866
201 Ga0501082_0421475 3300060353 Bacteria 1166
202 Ga0501082_0452498 3300060353 Bacteria 1122

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005290 Ga0065712_10323866 Ga0065712_103238662 79
2 3300005343 Ga0070687_100504073 Ga0070687_1005040731 79
3 3300005617 Ga0068859_100719119 Ga0068859_1007191192 79
4 3300006931 Ga0097620_100719187 Ga0097620_1007191872 79
5 3300011119 Ga0105246_10228929 Ga0105246_102289292 79
6 3300031852 Ga0307410_11558214 Ga0307410_115582142 79
7 3300005329 Ga0070683_102239135 Ga0070683_1022391352 80
8 3300005468 Ga0070707_102055840 Ga0070707_1020558402 80
9 3300005518 Ga0070699_100152850 Ga0070699_1001528502 80
10 3300005536 Ga0070697_100322641 Ga0070697_1003226412 80
11 3300006844 Ga0075428_100530555 Ga0075428_1005305552 80
12 3300006880 Ga0075429_100098038 Ga0075429_1000980383 80
13 3300009147 Ga0114129_10421908 Ga0114129_104219081 80
14 3300014325 Ga0163163_10976545 Ga0163163_109765451 80
15 3300014745 Ga0157377_10524646 Ga0157377_105246461 80
16 3300025936 Ga0207670_10385766 Ga0207670_103857662 80
17 3300031665 Ga0316575_10100533 Ga0316575_101005332 80
18 3300031665 Ga0316575_10168185 Ga0316575_101681851 80
19 3300031691 Ga0316579_10010908 Ga0316579_100109083 80
20 3300031727 Ga0316576_10264539 Ga0316576_102645392 80
21 3300031728 Ga0316578_10811515 Ga0316578_108115151 80
22 3300031733 Ga0316577_10018253 Ga0316577_100182533 80
23 3300031733 Ga0316577_10044857 Ga0316577_100448571 80
24 3300032002 Ga0307416_101330100 Ga0307416_1013301002 80
25 3300032002 Ga0307416_103707509 Ga0307416_1037075091 80
26 3300032137 Ga0316585_10300180 Ga0316585_103001802 80
27 3300035086 Ga0373934_0361556 Ga0373934_0361556_165_410 80
28 3300035172 Ga0373955_0531361 Ga0373955_0531361_157_402 80
29 3300035398 Ga0316574_0257208 Ga0316574_0257208_575_820 80
30 3300035398 Ga0316574_0485512 Ga0316574_0485512_500_745 80
31 3300035724 Ga0373933_0287142 Ga0373933_0287142_545_790 80
32 3300036647 Ga0316582_0013522 Ga0316582_0013522_2536_2781 80
33 3300036647 Ga0316582_0034550 Ga0316582_0034550_2620_2865 80
34 3300036647 Ga0316582_0060343 Ga0316582_0060343_209_454 80
35 3300036712 Ga0316584_0177521 Ga0316584_0177521_114_359 80
36 3300042876 Ga0451577_0030327 Ga0451577_0030327_974_1219 80
37 3300042876 Ga0451577_0167172 Ga0451577_0167172_1417_1662 80
38 3300042876 Ga0451577_1867903 Ga0451577_1867903_199_471 80
39 3300044673 Ga0453683_0025063 Ga0453683_0025063_991_1236 80
40 3300044712 Ga0453684_0000003 Ga0453684_0000003_1283800_1284045 80
41 3300044712 Ga0453684_0000203 Ga0453684_0000203_205221_205466 80
42 3300044712 Ga0453684_0001311 Ga0453684_0001311_30156_30401 80
43 3300044712 Ga0453684_0013888 Ga0453684_0013888_6283_6525 80
44 3300044712 Ga0453684_0050868 Ga0453684_0050868_1449_1691 80
45 3300044712 Ga0453684_0059528 Ga0453684_0059528_1143_1385 80
46 3300044712 Ga0453684_0173314 Ga0453684_0173314_1273_1518 80
47 3300044712 Ga0453684_0176580 Ga0453684_0176580_2156_2398 80
48 3300044712 Ga0453684_0266051 Ga0453684_0266051_605_847 80
49 3300044712 Ga0453684_0284036 Ga0453684_0284036_391_636 80
50 3300044712 Ga0453684_0307534 Ga0453684_0307534_1540_1782 80
51 3300044712 Ga0453684_0335962 Ga0453684_0335962_154_399 80
52 3300044712 Ga0453684_0685069 Ga0453684_0685069_770_1015 80
53 3300044712 Ga0453684_1542058 Ga0453684_1542058_310_555 80
54 3300044712 Ga0453684_1748206 Ga0453684_1748206_243_488 80
55 3300045051 Ga0451576_0352783 Ga0451576_0352783_1232_1477 80
56 3300045051 Ga0451576_0527052 Ga0451576_0527052_301_543 80
57 3300046517 Ga0495630_0354990 Ga0495630_0354990_198_443 80
58 3300049521 Ga0501298_158921 Ga0501298_158921_165_410 80
59 3300049522 Ga0501299_031517 Ga0501299_031517_430_675 80
60 3300049665 Ga0501227_080554 Ga0501227_080554_119_364 80
61 3300050507 nmdc:mga05p37_1411597_c1 nmdc:mga05p37_1411597_c1_70_315 80
62 3300050507 nmdc:mga05p37_2197863_c1 nmdc:mga05p37_2197863_c1_113_355 80
63 3300050508 nmdc:mga09592_210287_c1 nmdc:mga09592_210287_c1_206_448 80
64 3300060353 Ga0501082_0421475 Ga0501082_0421475_174_419 80
65 3300003203 JGI25406J46586_10015907 JGI25406J46586_100159073 81
66 3300005289 Ga0065704_10700961 Ga0065704_107009611 81
67 3300005295 Ga0065707_10908565 Ga0065707_109085651 81
68 3300005330 Ga0070690_101795129 Ga0070690_1017951292 81
69 3300005336 Ga0070680_100989811 Ga0070680_1009898112 81
70 3300005340 Ga0070689_100537097 Ga0070689_1005370972 81
71 3300005341 Ga0070691_10340633 Ga0070691_103406332 81
72 3300005440 Ga0070705_100063733 Ga0070705_1000637333 81
73 3300005444 Ga0070694_100426936 Ga0070694_1004269361 81
74 3300005444 Ga0070694_100520726 Ga0070694_1005207262 81
75 3300005467 Ga0070706_100303296 Ga0070706_1003032962 81
76 3300005467 Ga0070706_101752838 Ga0070706_1017528381 81
77 3300005471 Ga0070698_100018610 Ga0070698_1000186105 81
78 3300005471 Ga0070698_100302664 Ga0070698_1003026642 81
79 3300005471 Ga0070698_101274576 Ga0070698_1012745762 81
80 3300005518 Ga0070699_100041824 Ga0070699_1000418245 81
81 3300005518 Ga0070699_100217490 Ga0070699_1002174902 81
82 3300005518 Ga0070699_100347070 Ga0070699_1003470702 81
83 3300005518 Ga0070699_101565565 Ga0070699_1015655651 81
84 3300005536 Ga0070697_100482803 Ga0070697_1004828032 81
85 3300005536 Ga0070697_101635607 Ga0070697_1016356072 81
86 3300005545 Ga0070695_100018234 Ga0070695_1000182344 81
87 3300005545 Ga0070695_100625929 Ga0070695_1006259292 81
88 3300005545 Ga0070695_100701659 Ga0070695_1007016592 81
89 3300005545 Ga0070695_101458451 Ga0070695_1014584512 81
90 3300005546 Ga0070696_100036358 Ga0070696_1000363585 81
91 3300005549 Ga0070704_100161027 Ga0070704_1001610273 81
92 3300005549 Ga0070704_100386267 Ga0070704_1003862672 81
93 3300005549 Ga0070704_100598339 Ga0070704_1005983392 81
94 3300005549 Ga0070704_101722394 Ga0070704_1017223942 81
95 3300005577 Ga0068857_100484879 Ga0068857_1004848792 81
96 3300005577 Ga0068857_101456301 Ga0068857_1014563012 81
97 3300005577 Ga0068857_102368981 Ga0068857_1023689812 81
98 3300005615 Ga0070702_100377997 Ga0070702_1003779972 81
99 3300005617 Ga0068859_100318562 Ga0068859_1003185622 81
100 3300005617 Ga0068859_102439854 Ga0068859_1024398542 81
101 3300005840 Ga0068870_10168221 Ga0068870_101682212 81
102 3300005842 Ga0068858_100721548 Ga0068858_1007215482 81
103 3300005844 Ga0068862_100124404 Ga0068862_1001244042 81
104 3300005844 Ga0068862_100235692 Ga0068862_1002356922 81
105 3300005844 Ga0068862_101645485 Ga0068862_1016454852 81
106 3300005985 Ga0081539_10016803 Ga0081539_100168032 81
107 3300006194 Ga0075427_10000606 Ga0075427_100006065 81
108 3300006844 Ga0075428_100130383 Ga0075428_1001303834 81
109 3300006844 Ga0075428_101700271 Ga0075428_1017002712 81
110 3300006846 Ga0075430_100324337 Ga0075430_1003243372 81
111 3300006846 Ga0075430_101303033 Ga0075430_1013030332 81
112 3300006847 Ga0075431_100006157 Ga0075431_1000061577 81
113 3300006847 Ga0075431_100374171 Ga0075431_1003741712 81
114 3300006871 Ga0075434_100860387 Ga0075434_1008603872 81
115 3300006880 Ga0075429_100010245 Ga0075429_1000102452 81
116 3300006880 Ga0075429_100470622 Ga0075429_1004706222 81
117 3300006880 Ga0075429_100524727 Ga0075429_1005247272 81
118 3300006880 Ga0075429_101023689 Ga0075429_1010236892 81
119 3300006880 Ga0075429_101554406 Ga0075429_1015544062 81
120 3300006931 Ga0097620_100318598 Ga0097620_1003185982 81
121 3300006931 Ga0097620_102438429 Ga0097620_1024384292 81
122 3300009094 Ga0111539_10982610 Ga0111539_109826102 81
123 3300009098 Ga0105245_10852402 Ga0105245_108524021 81
124 3300009101 Ga0105247_10500107 Ga0105247_105001072 81
125 3300009147 Ga0114129_10046764 Ga0114129_100467642 81
126 3300009147 Ga0114129_10078151 Ga0114129_100781517 81
127 3300009148 Ga0105243_10003382 Ga0105243_100033828 81
128 3300009148 Ga0105243_10925032 Ga0105243_109250322 81
129 3300009553 Ga0105249_10027255 Ga0105249_100272552 81
130 3300009553 Ga0105249_10663852 Ga0105249_106638522 81
131 3300009553 Ga0105249_11573433 Ga0105249_115734331 81
132 3300009553 Ga0105249_12610110 Ga0105249_126101101 81
133 3300013308 Ga0157375_12661313 Ga0157375_126613132 81
134 3300014326 Ga0157380_11969487 Ga0157380_119694872 81
135 3300025910 Ga0207684_10380730 Ga0207684_103807302 81
136 3300025910 Ga0207684_10452792 Ga0207684_104527922 81
137 3300025917 Ga0207660_11444732 Ga0207660_114447322 81
138 3300025923 Ga0207681_11048936 Ga0207681_110489361 81
139 3300025935 Ga0207709_10013312 Ga0207709_100133122 81
140 3300025935 Ga0207709_10399160 Ga0207709_103991602 81
141 3300025935 Ga0207709_11296364 Ga0207709_112963642 81
142 3300025935 Ga0207709_11582797 Ga0207709_115827972 81
143 3300025936 Ga0207670_10377984 Ga0207670_103779842 81
144 3300025961 Ga0207712_10028904 Ga0207712_100289043 81
145 3300025961 Ga0207712_10253640 Ga0207712_102536402 81
146 3300025961 Ga0207712_10445889 Ga0207712_104458892 81
147 3300026075 Ga0207708_10091700 Ga0207708_100917002 81
148 3300026118 Ga0207675_100273611 Ga0207675_1002736112 81
149 3300027471 Ga0209995_1045416 Ga0209995_10454162 81
150 3300027543 Ga0209999_1040701 Ga0209999_10407012 81
151 3300027695 Ga0209966_1042861 Ga0209966_10428612 81
152 3300028380 Ga0268265_10116445 Ga0268265_101164452 81
153 3300028380 Ga0268265_10310192 Ga0268265_103101922 81
154 3300028558 Ga0265326_10020303 Ga0265326_100203032 81
155 3300028573 Ga0265334_10015060 Ga0265334_100150602 81
156 3300028577 Ga0265318_10002960 Ga0265318_1000296010 81
157 3300028666 Ga0265336_10184132 Ga0265336_101841322 81
158 3300028800 Ga0265338_10030391 Ga0265338_100303914 81
159 3300029957 Ga0265324_10040730 Ga0265324_100407302 81
160 3300031240 Ga0265320_10027473 Ga0265320_100274732 81
161 3300031247 Ga0265340_10003249 Ga0265340_100032497 81
162 3300031250 Ga0265331_10032419 Ga0265331_100324193 81
163 3300031344 Ga0265316_10497417 Ga0265316_104974172 81
164 3300031595 Ga0265313_10163778 Ga0265313_101637782 81
165 3300031691 Ga0316579_10130514 Ga0316579_101305142 81
166 3300031733 Ga0316577_10292933 Ga0316577_102929332 81
167 3300035242 Ga0373962_0060718 Ga0373962_0060718_532_780 81
168 3300042876 Ga0451577_0058648 Ga0451577_0058648_2405_2656 81
169 3300042876 Ga0451577_0706042 Ga0451577_0706042_202_450 81
170 3300042876 Ga0451577_0967894 Ga0451577_0967894_155_400 81
171 3300044673 Ga0453683_0034093 Ga0453683_0034093_2004_2252 81
172 3300044673 Ga0453683_0115402 Ga0453683_0115402_72_320 81
173 3300044673 Ga0453683_0354877 Ga0453683_0354877_485_733 81
174 3300044673 Ga0453683_0818730 Ga0453683_0818730_117_365 81
175 3300044673 Ga0453683_1019128 Ga0453683_1019128_173_421 81
176 3300044712 Ga0453684_0006057 Ga0453684_0006057_8507_8755 81
177 3300044712 Ga0453684_0066781 Ga0453684_0066781_1710_1958 81
178 3300044712 Ga0453684_0142229 Ga0453684_0142229_1332_1580 81
179 3300044712 Ga0453684_0661942 Ga0453684_0661942_282_530 81
180 3300045051 Ga0451576_2176483 Ga0451576_2176483_16_264 81
181 3300049588 Ga0501072_1474877 Ga0501072_1474877_124_375 81
182 3300049589 Ga0501073_0183288 Ga0501073_0183288_80_337 81
183 3300049590 Ga0501074_0767176 Ga0501074_0767176_402_653 81
184 3300049591 Ga0501075_0323476 Ga0501075_0323476_156_407 81
185 3300049592 Ga0501076_0278872 Ga0501076_0278872_809_1060 81
186 3300049741 Ga0501079_0065517 Ga0501079_0065517_1554_1805 81
187 3300049742 Ga0501080_0032708 Ga0501080_0032708_865_1122 81
188 3300049742 Ga0501080_1814111 Ga0501080_1814111_103_354 81
189 3300049743 Ga0501081_0577236 Ga0501081_0577236_256_501 81
190 3300050507 nmdc:mga05p37_30557_c1 nmdc:mga05p37_30557_c1_5358_5603 81
191 3300050507 nmdc:mga05p37_631752_c1 nmdc:mga05p37_631752_c1_485_730 81
192 3300050508 nmdc:mga09592_140056_c1 nmdc:mga09592_140056_c1_786_1031 81
193 3300050508 nmdc:mga09592_1538764_c1 nmdc:mga09592_1538764_c1_120_419 81
194 3300050508 nmdc:mga09592_290342_c1 nmdc:mga09592_290342_c1_479_724 81
195 3300050508 nmdc:mga09592_862666_c1 nmdc:mga09592_862666_c1_124_369 81
196 3300050508 nmdc:mga09592_90817_c1 nmdc:mga09592_90817_c1_203_448 81
197 3300050509 nmdc:mga0qj67_512588_c1 nmdc:mga0qj67_512588_c1_705_950 81
198 3300050510 nmdc:mga06r32_256225_c1 nmdc:mga06r32_256225_c1_68_313 81
199 3300050510 nmdc:mga06r32_59854_c1 nmdc:mga06r32_59854_c1_124_369 81
200 3300050512 nmdc:mga0n895_609447_c1 nmdc:mga0n895_609447_c1_194_442 81
201 3300054114 Ga0501084_0683150 Ga0501084_0683150_266_517 81
202 3300060353 Ga0501082_0452498 Ga0501082_0452498_393_644 81

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00550

PP-binding

Phosphopantetheine attachment site

27

93

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6o6e-assembly1.cif.gz_E crystal structure of pltf trapped with pltl using a proline adenosine vinylsulfonamide inhibitor 0.8873 1 81
6o6e-assembly1.cif.gz_E crystal structure of pltf trapped with pltl using a proline adenosine vinylsulfonamide inhibitor 0.8766 1 81
6cy8-assembly1.cif.gz_A crystal structure of fad-dependent dehydrogenase 0.8632 10 75
6rcx-assembly1.cif.gz_B mycobacterial 4'-phosphopantetheinyl transferase pptab in complex with the acp domain of ppsc. 0.861 1 79
2n5h-assembly1.cif.gz_A pltl-holo 0.8602 2 80
ID Description Score Start End Superfamily
2n5hA00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.8602 2 80 1.10.1200.10
af_O53901_2025_2106_1.10.1200.10 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.8559 2 80 1.10.1200.10
4mrtC00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.8535 4 78 1.10.1200.10
2n5iA00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.8438 2 78 1.10.1200.10
af_P40976_871_959_1.10.1200.10 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.8403 1 81 1.10.1200.10
ID Description Score Start End GO Terms
AF-A0A523TJ69-F1-model_v4 Acyl carrier protein 1.006 5 80
AF-A0A419EHY0-F1-model_v4 Acyl carrier protein 1.001 2 81
AF-A0A3D5B684-F1-model_v4 Carrier domain-containing protein 1 2 80
AF-A0A2N2MH73-F1-model_v4 Carrier domain-containing protein 0.9986 1 79
AF-A0A7C4G6U1-F1-model_v4 Acyl carrier protein 0.9967 1 79

Feature Viewer

pLDDT pTM Quality
91.59 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map