F309410

General Info

Members Datasets Scaffolds Average Seq Length
202 116 185 325

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100004818|Ga0070660_1000048186
Length 362
Sequence MRVWECCVIAFHQHWWFKQGSIRAYPCPLVTDAMNTSTSPALVYFELLADRAKTPSALLLNLXGDRVEVLRTFVGNDDFKILSARFPCLLMDVGTMSGEMVEVATEVGCRPIPQAAVYYASSLAMELPASAKWIAGDWYLAPPAKPTSAQAASRALALQLVQLVAADADTHEIEAVLRRDPTLSYHLLRVVNSLGMGMSRQITSFSQAILILGRTQLRRWLNLMLFSSRQGDERSAMLLGHVAVRARIMELLAKCSGMDRAGQDSAFMAGMFSLLGVLFGMPLDEVLRPLKISDALSAAVLEHQGDLGHLLKTVECVECRDTPQLAAHLDALQVPYAEFSTLSVQAYAWMLDVIRDRGGMNV

Samples

Sample ID Description Type Environment
1 2643221645 Massilia sp. Root351 Isolate Unclassified
2 2643221664 Massilia sp. Root418 Isolate Unclassified
3 2738541280 Massilia sp. GV090 Isolate Unclassified
4 2738541297 Duganella sp. GV083 Isolate Unclassified
5 2738541300 Massilia sp. GV016 Isolate Unclassified
6 2738541357 Duganella sp. GV053 Isolate Unclassified
7 2738543003 Duganella sp. GV066 Isolate Unclassified
8 2738543018 Massilia sp. GV045 Isolate Unclassified
9 2738543026 Duganella sp. GV089 Isolate Unclassified
10 2738543029 Duganella sp. GV039 Isolate Unclassified
11 2738543030 Massilia sp. GV097 Isolate Unclassified
12 2821131069 Duganella sp. 1224 Isolate Unclassified
13 2842711865 Duganella sp. R-73148 Isolate Unclassified
14 2857553236 Duganella sp. R-74557 Isolate Unclassified
15 2857558681 Duganella sp. R-74565 Isolate Unclassified
16 2857564685 Duganella sp. R-74599 Isolate Unclassified
17 2904424332 Duganella sp. 1411 Isolate Rhizosphere
18 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
19 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
20 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
21 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
24 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
25 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
30 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
31 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
32 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
33 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
34 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
35 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
36 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
38 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
39 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
40 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
41 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
42 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
43 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
44 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
45 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
48 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
49 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
50 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
51 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
52 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
53 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
54 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
55 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
56 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
57 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
58 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
59 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
60 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
61 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
62 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
63 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
64 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
65 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
66 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
67 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
68 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
69 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
70 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
71 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
72 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
73 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
74 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
75 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
76 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
77 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
78 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
79 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
80 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
81 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
82 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
83 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
84 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
85 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
86 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
87 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
88 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
89 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
90 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
91 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
92 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
93 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
94 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
95 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
96 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
97 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
98 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
99 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
100 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
101 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
102 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
103 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
104 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
105 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
106 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
107 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
108 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
109 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
110 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
111 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
112 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
113 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
114 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
115 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
116 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.58
Metatranscriptomes 0
Isolates 8.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.37
Nodule 0.99
Rhizoplane 2.48
Rhizosphere 69.31
Stem 0
Stem Tuber 0
Unclassified 13.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1008160 3300002738 Bacteria 1370
2 JGI25159J45721_1001435 3300002987 Bacteria 9848
3 JGI25153J46596_10024035 3300003215 Bacteria 2205
4 Ga0055529_1000080 3300003763 Bacteria 148614
5 Ga0055526_1000137 3300003771 Bacteria 64902
6 Ga0055526_1000180 3300003771 Bacteria 55895
7 Ga0055526_1002286 3300003771 Bacteria 13078
8 Ga0055537_1000012 3300003773 Bacteria 133761
9 Ga0055524_1000021 3300003775 Bacteria 227578
10 Ga0055528_1000073 3300003790 Bacteria 77054
11 Ga0065165_1000156 3300005262 Bacteria 119261
12 Ga0065165_1057164 3300005262 Bacteria 1082
13 Ga0070660_100004818 3300005339 Bacteria 9332
14 Ga0070664_100013286 3300005564 Bacteria 6707
15 Ga0068865_100135255 3300006881 Bacteria 1851
16 Ga0099826_10000002 3300006948 Bacteria 1125830
17 Ga0105244_10001503 3300009036 Bacteria 18682
18 Ga0105244_10017785 3300009036 Bacteria 4007
19 Ga0213872_10000028 3300021361 Bacteria 148766
20 Ga0213872_10000398 3300021361 Bacteria 36154
21 Ga0213872_10006541 3300021361 Bacteria 5830
22 Ga0207425_1001276 3300025245 Bacteria 10952
23 Ga0209646_1000010 3300025246 Bacteria 573803
24 Ga0209565_1000057 3300025263 Bacteria 196908
25 Ga0209455_1000037 3300025272 Bacteria 464097
26 Ga0209673_1000051 3300025273 Bacteria 282161
27 Ga0209130_1000268 3300025284 Bacteria 65115
28 Ga0209675_1000027 3300025291 Bacteria 282175
29 Ga0209025_1003131 3300025294 Bacteria 16180
30 Ga0209564_1000009 3300025295 Bacteria 950196
31 Ga0209564_1000033 3300025295 Bacteria 446200
32 Ga0209564_1000094 3300025295 Bacteria 243176
33 Ga0209758_1002737 3300025297 Bacteria 17343
34 Ga0209256_1000044 3300025299 Bacteria 337264
35 Ga0209256_1000139 3300025299 Bacteria 155515
36 Ga0207426_1007139 3300025302 Bacteria 4717
37 Ga0207655_1047441 3300025728 Bacteria 1772
38 Ga0207657_10010216 3300025919 Bacteria 9375
39 Ga0209282_1000001 3300027666 Bacteria 2450367
40 Ga0316180_1192141 3300030736 Bacteria 2529
41 Ga0316182_1035915 3300030745 Unclassified 1344
42 Ga0265314_10033870 3300031711 Bacteria 3739
43 Ga0395899_0003183 3300037312 Bacteria 13021
44 Ga0395900_0002998 3300037418 Bacteria 18374
45 Ga0395905_0001030 3300037471 Bacteria 35512
46 Ga0395905_0008740 3300037471 Bacteria 9964
47 Ga0436361_0045193 3300039447 Bacteria 5356
48 Ga0436361_0442031 3300039447 Bacteria 19079
49 Ga0466972_0000060 3300044658 Bacteria 109789
50 Ga0466972_0004210 3300044658 Bacteria 7190
51 Ga0466982_0032767 3300044672 Bacteria 3095
52 Ga0466965_0000365 3300044683 Bacteria 15370
53 Ga0466965_0110019 3300044683 Bacteria 1415
54 Ga0466966_0018642 3300044684 Bacteria 4573
55 Ga0466964_0002125 3300044706 Bacteria 6985
56 Ga0466964_0011862 3300044706 Bacteria 3295
57 Ga0453684_0327661 3300044712 Bacteria 1733
58 Ga0466968_0007671 3300044735 Bacteria 4109
59 Ga0466968_0090286 3300044735 Bacteria 1356
60 Ga0466970_0112921 3300044765 Bacteria 1484
61 Ga0495617_000894 3300046452 Bacteria 13992
62 Ga0495627_000008 3300046453 Bacteria 572150
63 Ga0495590_0000001 3300046457 Bacteria 762984
64 Ga0495638_0000184 3300046460 Bacteria 95341
65 Ga0495653_0000409 3300046463 Bacteria 34377
66 Ga0495650_0000166 3300046471 Bacteria 146047
67 Ga0495650_0000503 3300046471 Bacteria 58702
68 Ga0495650_0000529 3300046471 Bacteria 55633
69 Ga0495650_0000753 3300046471 Bacteria 40457
70 Ga0495650_0006598 3300046471 Bacteria 7208
71 Ga0495650_0013786 3300046471 Bacteria 4251
72 Ga0495650_0014884 3300046471 Bacteria 4015
73 Ga0495605_0000059 3300046474 Bacteria 146371
74 Ga0495585_0000494 3300046492 Bacteria 37273
75 Ga0495607_0001801 3300046501 Bacteria 18308
76 Ga0495607_0050427 3300046501 Bacteria 2422
77 Ga0495607_0063603 3300046501 Bacteria 2087
78 Ga0495583_0000119 3300046506 Bacteria 133447
79 Ga0495583_0001264 3300046506 Bacteria 26562
80 Ga0495583_0096243 3300046506 Bacteria 1268
81 Ga0495606_0000011 3300046507 Bacteria 296816
82 Ga0495606_0000064 3300046507 Bacteria 183631
83 Ga0495606_0000156 3300046507 Bacteria 118821
84 Ga0495606_0000882 3300046507 Bacteria 44865
85 Ga0495606_0001038 3300046507 Bacteria 40221
86 Ga0495606_0001094 3300046507 Bacteria 38841
87 Ga0495606_0001288 3300046507 Bacteria 34734
88 Ga0495606_0012196 3300046507 Bacteria 6924
89 Ga0495610_0003509 3300046512 Bacteria 12172
90 Ga0495610_0032602 3300046512 Bacteria 2704
91 Ga0495610_0051442 3300046512 Bacteria 2004
92 Ga0495637_0000426 3300046520 Bacteria 30770
93 Ga0495637_0003494 3300046520 Bacteria 8339
94 Ga0495643_0000282 3300046522 Bacteria 72496
95 Ga0495643_0000369 3300046522 Bacteria 61039
96 Ga0495648_0000001 3300046524 Bacteria 696872
97 Ga0495648_0000675 3300046524 Bacteria 36444
98 Ga0495648_0027954 3300046524 Bacteria 3766
99 Ga0495648_0032948 3300046524 Bacteria 3392
100 Ga0495648_0043798 3300046524 Bacteria 2801
101 Ga0495663_0001922 3300046525 Bacteria 6397
102 Ga0495642_0005076 3300046528 Bacteria 5071
103 Ga0495654_0000028 3300046530 Bacteria 223384
104 Ga0495654_0016997 3300046530 Bacteria 3831
105 Ga0495654_0138745 3300046530 Bacteria 1085
106 Ga0495609_0000202 3300046538 Bacteria 59327
107 Ga0495609_0001239 3300046538 Bacteria 17585
108 Ga0495609_0013159 3300046538 Bacteria 3912
109 Ga0495609_0021113 3300046538 Bacteria 3004
110 Ga0495609_0022989 3300046538 Bacteria 2869
111 Ga0495597_0000131 3300046542 Bacteria 68056
112 Ga0495597_0000551 3300046542 Bacteria 31134
113 Ga0495597_0017380 3300046542 Bacteria 3386
114 Ga0495622_0000068 3300046557 Bacteria 90633
115 Ga0495622_0000276 3300046557 Bacteria 39002
116 Ga0495633_0005711 3300046558 Bacteria 7524
117 Ga0495633_0008447 3300046558 Bacteria 5793
118 Ga0495633_0049371 3300046558 Bacteria 1986
119 Ga0495668_0000048 3300046616 Bacteria 217867
120 Ga0495668_0000363 3300046616 Bacteria 60009
121 Ga0495668_0000487 3300046616 Bacteria 49686
122 Ga0495668_0001239 3300046616 Bacteria 25630
123 Ga0495668_0012539 3300046616 Bacteria 5027
124 Ga0495668_0016554 3300046616 Bacteria 4285
125 Ga0495625_0000483 3300046660 Bacteria 59571
126 Ga0495625_0000935 3300046660 Bacteria 39254
127 Ga0495625_0001295 3300046660 Bacteria 31401
128 Ga0495625_0005524 3300046660 Bacteria 11492
129 Ga0495625_0024419 3300046660 Bacteria 4600
130 Ga0495625_0039864 3300046660 Bacteria 3428
131 Ga0495625_0041421 3300046660 Bacteria 3352
132 Ga0495625_0110994 3300046660 Bacteria 1874
133 Ga0495659_0000021 3300046664 Bacteria 73067
134 Ga0495659_0004604 3300046664 Bacteria 4341
135 Ga0495661_0179815 3300046665 Bacteria 1122
136 Ga0495669_0002096 3300046684 Bacteria 8170
137 Ga0495671_0000001 3300046692 Bacteria 1169494
138 Ga0495671_0000102 3300046692 Bacteria 77849
139 Ga0495649_0018581 3300046694 Bacteria 3909
140 Ga0495660_0000219 3300046810 Bacteria 57585
141 Ga0495660_0001182 3300046810 Bacteria 18406
142 Ga0495660_0003628 3300046810 Bacteria 9503
143 Ga0495660_0003721 3300046810 Bacteria 9363
144 Ga0495660_0016216 3300046810 Bacteria 4298
145 Ga0495636_0017723 3300047318 Bacteria 2853
146 Ga0495636_0126685 3300047318 Bacteria 1133
147 Ga0495672_0000187 3300047320 Bacteria 89789
148 Ga0495672_0000259 3300047320 Bacteria 73356
149 Ga0495687_006415 3300047443 Bacteria 7211
150 Ga0495687_076021 3300047443 Bacteria 1330
151 Ga0495677_0025462 3300047445 Bacteria 2146
152 Ga0495679_008963 3300047446 Bacteria 4033
153 Ga0495679_022882 3300047446 Bacteria 2130
154 Ga0495685_008878 3300047447 Bacteria 3351
155 Ga0495673_0000003 3300047469 Bacteria 1491337
156 Ga0495673_0000097 3300047469 Bacteria 182247
157 Ga0495673_0000100 3300047469 Bacteria 173962
158 Ga0495686_0000248 3300047472 Bacteria 97017
159 Ga0495686_0017014 3300047472 Bacteria 4910
160 Ga0495686_0017930 3300047472 Bacteria 4760
161 Ga0495686_0019762 3300047472 Bacteria 4497
162 Ga0495686_0136546 3300047472 Bacteria 1450
163 Ga0495615_0033628 3300048090 Bacteria 1243
164 Ga0496102_0000123 3300048905 Bacteria 110781
165 Ga0496102_0060736 3300048905 Bacteria 3457
166 Ga0496103_0007681 3300048906 Bacteria 6411
167 Ga0496103_0072681 3300048906 Bacteria 2154
168 Ga0496114_0050268 3300048917 Bacteria 3470
169 Ga0496116_0102415 3300048919 Bacteria 1707
170 Ga0496120_0053863 3300048923 Bacteria 2284
171 Ga0496121_0029847 3300048924 Bacteria 5026
172 Ga0496122_0018215 3300048925 Bacteria 6504
173 Ga0496122_0077871 3300048925 Bacteria 2325
174 Ga0496123_0004114 3300048926 Bacteria 15593
175 Ga0496124_0048349 3300048927 Bacteria 3635
176 Ga0496124_0102493 3300048927 Bacteria 2316
177 Ga0496126_0067531 3300048929 Bacteria 3194
178 Ga0495678_000128 3300049459 Bacteria 89099
179 Ga0495678_000226 3300049459 Bacteria 65083
180 Ga0495678_040889 3300049459 Bacteria 1859
181 Ga0495678_041187 3300049459 Bacteria 1850
182 Ga0501269_000129 3300049766 Bacteria 23794
183 Ga0500618_000108 3300053125 Bacteria 67640
184 Ga0500586_001212 3300053145 Bacteria 5379
185 Ga0466962_0051426 3300061719 Bacteria 1970

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044683 Ga0466965_0110019 Ga0466965_0110019_47_871 270
2 3300046524 Ga0495648_0032948 Ga0495648_0032948_59_973 282
3 3300046530 Ga0495654_0138745 Ga0495654_0138745_14_901 287
4 3300046810 Ga0495660_0001182 Ga0495660_0001182_4181_5152 294
5 3300047472 Ga0495686_0017014 Ga0495686_0017014_2900_3871 294
6 3300021361 Ga0213872_10006541 Ga0213872_100065415 295
7 3300044765 Ga0466970_0112921 Ga0466970_0112921_166_1137 296
8 3300021361 Ga0213872_10000398 Ga0213872_1000039818 297
9 3300039447 Ga0436361_0442031 Ga0436361_0442031_16256_17236 297
10 3300031711 Ga0265314_10033870 Ga0265314_100338703 298
11 3300044672 Ga0466982_0032767 Ga0466982_0032767_1265_2236 298
12 3300047472 Ga0495686_0000248 Ga0495686_0000248_40738_41712 299
13 3300046538 Ga0495609_0021113 Ga0495609_0021113_1402_2373 301
14 3300047318 Ga0495636_0017723 Ga0495636_0017723_89_1033 306
15 iso_pu_bacteria 2643221664 2644358078 307
16 3300047445 Ga0495677_0025462 Ga0495677_0025462_866_1822 308
17 iso_pu_bacteria 2643221645 2644254256 308
18 iso_pu_bacteria 2738541280 2738741076 308
19 iso_pu_bacteria 2738541300 2738845534 308
20 iso_pu_bacteria 2738543018 2739276589 308
21 iso_pu_bacteria 2738543030 2739345633 308
22 3300048905 Ga0496102_0000123 Ga0496102_0000123_5094_6113 309
23 3300048906 Ga0496103_0007681 Ga0496103_0007681_2217_3236 309
24 3300046616 Ga0495668_0000048 Ga0495668_0000048_23684_24643 310
25 3300047472 Ga0495686_0017930 Ga0495686_0017930_3619_4572 310
26 3300003771 Ga0055526_1002286 Ga0055526_100228611 311
27 3300003773 Ga0055537_1000012 Ga0055537_100001222 311
28 3300003790 Ga0055528_1000073 Ga0055528_100007350 311
29 3300025263 Ga0209565_1000057 Ga0209565_100005725 311
30 3300025273 Ga0209673_1000051 Ga0209673_1000051263 311
31 3300025291 Ga0209675_1000027 Ga0209675_1000027263 311
32 3300025295 Ga0209564_1000094 Ga0209564_100009424 311
33 3300025299 Ga0209256_1000139 Ga0209256_100013924 311
34 3300039447 Ga0436361_0045193 Ga0436361_0045193_2533_3513 311
35 3300044658 Ga0466972_0000060 Ga0466972_0000060_99033_100007 311
36 3300044735 Ga0466968_0090286 Ga0466968_0090286_15_989 311
37 3300006881 Ga0068865_100135255 Ga0068865_1001352552 312
38 3300046501 Ga0495607_0001801 Ga0495607_0001801_6256_7206 312
39 3300046506 Ga0495583_0096243 Ga0495583_0096243_28_972 312
40 3300046507 Ga0495606_0012196 Ga0495606_0012196_4957_5919 312
41 3300046538 Ga0495609_0000202 Ga0495609_0000202_35253_36203 312
42 3300046542 Ga0495597_0017380 Ga0495597_0017380_1180_2142 312
43 3300046616 Ga0495668_0012539 Ga0495668_0012539_245_1195 312
44 3300046660 Ga0495625_0001295 Ga0495625_0001295_13289_14251 312
45 3300046660 Ga0495625_0041421 Ga0495625_0041421_751_1695 312
46 3300046664 Ga0495659_0000021 Ga0495659_0000021_60490_61452 312
47 3300046664 Ga0495659_0004604 Ga0495659_0004604_1958_2908 312
48 3300046665 Ga0495661_0179815 Ga0495661_0179815_44_994 312
49 3300046684 Ga0495669_0002096 Ga0495669_0002096_2860_3804 312
50 3300046692 Ga0495671_0000102 Ga0495671_0000102_11799_12761 312
51 3300046694 Ga0495649_0018581 Ga0495649_0018581_2892_3842 312
52 3300047318 Ga0495636_0126685 Ga0495636_0126685_172_1122 312
53 3300047320 Ga0495672_0000259 Ga0495672_0000259_43590_44552 312
54 3300047443 Ga0495687_076021 Ga0495687_076021_150_1094 312
55 3300047446 Ga0495679_008963 Ga0495679_008963_214_1164 312
56 3300048090 Ga0495615_0033628 Ga0495615_0033628_172_1158 313
57 3300002987 JGI25159J45721_1001435 JGI25159J45721_10014353 314
58 3300005262 Ga0065165_1000156 Ga0065165_100015689 314
59 3300025284 Ga0209130_1000268 Ga0209130_100026838 314
60 3300025302 Ga0207426_1007139 Ga0207426_10071394 314
61 3300044712 Ga0453684_0327661 Ga0453684_0327661_438_1415 314
62 3300048923 Ga0496120_0053863 Ga0496120_0053863_1294_2250 315
63 3300048925 Ga0496122_0077871 Ga0496122_0077871_618_1574 315
64 3300048926 Ga0496123_0004114 Ga0496123_0004114_12691_13647 315
65 3300048917 Ga0496114_0050268 Ga0496114_0050268_1507_2508 316
66 3300005339 Ga0070660_100004818 Ga0070660_1000048186 317
67 3300005564 Ga0070664_100013286 Ga0070664_1000132866 317
68 3300025919 Ga0207657_10010216 Ga0207657_100102162 317
69 3300046507 Ga0495606_0000011 Ga0495606_0000011_45566_46573 317
70 3300046557 Ga0495622_0000068 Ga0495622_0000068_59448_60482 317
71 iso_pu_bacteria 2857564685 2857564886 317
72 3300037312 Ga0395899_0003183 Ga0395899_0003183_5513_6505 318
73 3300037418 Ga0395900_0002998 Ga0395900_0002998_68_1060 318
74 3300037471 Ga0395905_0008740 Ga0395905_0008740_2742_3734 318
75 3300044684 Ga0466966_0018642 Ga0466966_0018642_1686_2678 318
76 3300061719 Ga0466962_0051426 Ga0466962_0051426_207_1199 318
77 3300037471 Ga0395905_0001030 Ga0395905_0001030_21160_22185 319
78 iso_pu_bacteria 2821131069 2821131444 319
79 iso_pu_bacteria 2857553236 2857554333 319
80 3300003775 Ga0055524_1000021 Ga0055524_1000021106 320
81 3300005262 Ga0065165_1057164 Ga0065165_10571641 320
82 3300006948 Ga0099826_10000002 Ga0099826_100000021029 320
83 3300025299 Ga0209256_1000044 Ga0209256_1000044191 320
84 3300027666 Ga0209282_1000001 Ga0209282_1000001132 320
85 3300044658 Ga0466972_0004210 Ga0466972_0004210_2770_3771 320
86 3300044683 Ga0466965_0000365 Ga0466965_0000365_3577_4578 320
87 3300044706 Ga0466964_0002125 Ga0466964_0002125_1142_2143 320
88 3300044706 Ga0466964_0011862 Ga0466964_0011862_183_1184 320
89 3300044735 Ga0466968_0007671 Ga0466968_0007671_3077_4078 320
90 iso_pu_bacteria 2738541297 2738829371 320
91 iso_pu_bacteria 2738541357 2739153167 320
92 iso_pu_bacteria 2738543003 2739195087 320
93 iso_pu_bacteria 2738543026 2739321563 320
94 iso_pu_bacteria 2738543029 2739339881 320
95 3300046525 Ga0495663_0001922 Ga0495663_0001922_79_1077 321
96 3300047447 Ga0495685_008878 Ga0495685_008878_1897_2886 321
97 3300048905 Ga0496102_0060736 Ga0496102_0060736_905_1915 321
98 3300048906 Ga0496103_0072681 Ga0496103_0072681_779_1789 321
99 iso_pu_bacteria 2842711865 2842714204 321
100 iso_pu_bacteria 2857558681 2857559938 321
101 iso_pu_bacteria 2904424332 2904426174 321
102 3300021361 Ga0213872_10000028 Ga0213872_1000002831 322
103 3300030736 Ga0316180_1192141 Ga0316180_11921412 322
104 3300030745 Ga0316182_1035915 Ga0316182_10359151 322
105 3300046471 Ga0495650_0000529 Ga0495650_0000529_35908_36885 322
106 3300046506 Ga0495583_0001264 Ga0495583_0001264_2339_3331 322
107 3300046507 Ga0495606_0001038 Ga0495606_0001038_17739_18716 322
108 3300046524 Ga0495648_0027954 Ga0495648_0027954_971_1963 322
109 3300047469 Ga0495673_0000003 Ga0495673_0000003_1464029_1465006 322
110 3300048929 Ga0496126_0067531 Ga0496126_0067531_304_1281 322
111 3300046453 Ga0495627_000008 Ga0495627_000008_490584_491603 323
112 3300046538 Ga0495609_0001239 Ga0495609_0001239_2031_3050 323
113 3300046810 Ga0495660_0000219 Ga0495660_0000219_31270_32268 323
114 3300046810 Ga0495660_0003721 Ga0495660_0003721_7087_8106 323
115 3300047469 Ga0495673_0000097 Ga0495673_0000097_24155_25141 323
116 3300048919 Ga0496116_0102415 Ga0496116_0102415_668_1687 323
117 3300048927 Ga0496124_0048349 Ga0496124_0048349_1531_2538 323
118 3300049459 Ga0495678_000128 Ga0495678_000128_3409_4416 323
119 3300003215 JGI25153J46596_10024035 JGI25153J46596_100240352 324
120 3300003763 Ga0055529_1000080 Ga0055529_100008012 324
121 3300025245 Ga0207425_1001276 Ga0207425_100127610 324
122 3300025272 Ga0209455_1000037 Ga0209455_1000037136 324
123 3300025294 Ga0209025_1003131 Ga0209025_100313115 324
124 3300025297 Ga0209758_1002737 Ga0209758_10027372 324
125 3300046463 Ga0495653_0000409 Ga0495653_0000409_10650_11633 324
126 3300046471 Ga0495650_0000503 Ga0495650_0000503_25074_26057 324
127 3300046471 Ga0495650_0000753 Ga0495650_0000753_14384_15379 324
128 3300046471 Ga0495650_0006598 Ga0495650_0006598_1703_2686 324
129 3300046471 Ga0495650_0013786 Ga0495650_0013786_1214_2197 324
130 3300046492 Ga0495585_0000494 Ga0495585_0000494_14419_15402 324
131 3300046507 Ga0495606_0000156 Ga0495606_0000156_98050_99033 324
132 3300046520 Ga0495637_0000426 Ga0495637_0000426_27862_28845 324
133 3300046524 Ga0495648_0000675 Ga0495648_0000675_8104_9087 324
134 3300046530 Ga0495654_0000028 Ga0495654_0000028_142611_143594 324
135 3300046530 Ga0495654_0016997 Ga0495654_0016997_45_1028 324
136 3300046558 Ga0495633_0049371 Ga0495633_0049371_479_1471 324
137 3300046616 Ga0495668_0000363 Ga0495668_0000363_57103_58086 324
138 3300046660 Ga0495625_0000935 Ga0495625_0000935_23859_24854 324
139 3300046660 Ga0495625_0110994 Ga0495625_0110994_161_1144 324
140 3300046692 Ga0495671_0000001 Ga0495671_0000001_227534_228526 324
141 3300046810 Ga0495660_0003628 Ga0495660_0003628_1270_2253 324
142 3300047446 Ga0495679_022882 Ga0495679_022882_63_1046 324
143 3300047469 Ga0495673_0000100 Ga0495673_0000100_142117_143100 324
144 3300047472 Ga0495686_0136546 Ga0495686_0136546_109_1092 324
145 3300048924 Ga0496121_0029847 Ga0496121_0029847_1187_2170 324
146 3300048925 Ga0496122_0018215 Ga0496122_0018215_4865_5848 324
147 3300002738 JGI25154J39366_1008160 JGI25154J39366_10081602 325
148 3300003771 Ga0055526_1000137 Ga0055526_100013721 325
149 3300003771 Ga0055526_1000180 Ga0055526_100018020 325
150 3300009036 Ga0105244_10001503 Ga0105244_1000150314 325
151 3300009036 Ga0105244_10017785 Ga0105244_100177855 325
152 3300025246 Ga0209646_1000010 Ga0209646_1000010197 325
153 3300025295 Ga0209564_1000009 Ga0209564_1000009331 325
154 3300025295 Ga0209564_1000033 Ga0209564_1000033290 325
155 3300025728 Ga0207655_1047441 Ga0207655_10474412 325
156 3300046452 Ga0495617_000894 Ga0495617_000894_11056_12045 325
157 3300046457 Ga0495590_0000001 Ga0495590_0000001_741731_742714 325
158 3300046460 Ga0495638_0000184 Ga0495638_0000184_75317_76300 325
159 3300046471 Ga0495650_0000166 Ga0495650_0000166_127808_128794 325
160 3300046471 Ga0495650_0014884 Ga0495650_0014884_1079_2062 325
161 3300046474 Ga0495605_0000059 Ga0495605_0000059_131651_132637 325
162 3300046501 Ga0495607_0050427 Ga0495607_0050427_201_1184 325
163 3300046501 Ga0495607_0063603 Ga0495607_0063603_285_1280 325
164 3300046506 Ga0495583_0000119 Ga0495583_0000119_18985_19968 325
165 3300046507 Ga0495606_0000064 Ga0495606_0000064_159951_160946 325
166 3300046507 Ga0495606_0000882 Ga0495606_0000882_16894_17877 325
167 3300046507 Ga0495606_0001094 Ga0495606_0001094_18779_19771 325
168 3300046507 Ga0495606_0001288 Ga0495606_0001288_16504_17493 325
169 3300046512 Ga0495610_0003509 Ga0495610_0003509_4489_5490 325
170 3300046512 Ga0495610_0032602 Ga0495610_0032602_245_1252 325
171 3300046512 Ga0495610_0051442 Ga0495610_0051442_664_1659 325
172 3300046520 Ga0495637_0003494 Ga0495637_0003494_1664_2653 325
173 3300046522 Ga0495643_0000282 Ga0495643_0000282_18552_19559 325
174 3300046522 Ga0495643_0000369 Ga0495643_0000369_41932_42975 325
175 3300046524 Ga0495648_0000001 Ga0495648_0000001_28280_29263 325
176 3300046524 Ga0495648_0043798 Ga0495648_0043798_308_1315 325
177 3300046528 Ga0495642_0005076 Ga0495642_0005076_584_1567 325
178 3300046538 Ga0495609_0013159 Ga0495609_0013159_2253_3236 325
179 3300046538 Ga0495609_0022989 Ga0495609_0022989_1135_2142 325
180 3300046542 Ga0495597_0000131 Ga0495597_0000131_49060_50103 325
181 3300046542 Ga0495597_0000551 Ga0495597_0000551_7158_8150 325
182 3300046557 Ga0495622_0000276 Ga0495622_0000276_8174_9157 325
183 3300046558 Ga0495633_0005711 Ga0495633_0005711_1038_2030 325
184 3300046558 Ga0495633_0008447 Ga0495633_0008447_3701_4684 325
185 3300046616 Ga0495668_0000487 Ga0495668_0000487_29434_30417 325
186 3300046616 Ga0495668_0001239 Ga0495668_0001239_1588_2583 325
187 3300046616 Ga0495668_0016554 Ga0495668_0016554_1517_2503 325
188 3300046660 Ga0495625_0000483 Ga0495625_0000483_18005_18988 325
189 3300046660 Ga0495625_0005524 Ga0495625_0005524_8455_9465 325
190 3300046660 Ga0495625_0024419 Ga0495625_0024419_1940_2932 325
191 3300046660 Ga0495625_0039864 Ga0495625_0039864_913_1905 325
192 3300046810 Ga0495660_0016216 Ga0495660_0016216_486_1529 325
193 3300047320 Ga0495672_0000187 Ga0495672_0000187_19891_20898 325
194 3300047443 Ga0495687_006415 Ga0495687_006415_1976_2959 325
195 3300047472 Ga0495686_0019762 Ga0495686_0019762_1860_2855 325
196 3300048927 Ga0496124_0102493 Ga0496124_0102493_1069_2055 325
197 3300049459 Ga0495678_000226 Ga0495678_000226_1954_2961 325
198 3300049459 Ga0495678_040889 Ga0495678_040889_838_1821 325
199 3300049459 Ga0495678_041187 Ga0495678_041187_39_1022 325
200 3300049766 Ga0501269_000129 Ga0501269_000129_16362_17363 325
201 3300053125 Ga0500618_000108 Ga0500618_000108_33515_34516 325
202 3300053145 Ga0500586_001212 Ga0500586_001212_1975_2967 325

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08668

HDOD

HDOD domain

152

287

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3m1t-assembly1.cif.gz_A crystal structure of putative phosphohydrolase (yp_929327.1) from shewanella amazonensis sb2b at 1.62 a resolution 0.6751 117 318
3gem-assembly1.cif.gz_A crystal structure of short-chain dehydrogenase from pseudomonas syringae 0.6144 23 74
7lrh-assembly2.cif.gz_C c-terminal domain of ribd from brucella abortus (5-amino-6-ribosylamino-2,4(1h,3h)-pyrimidinedione 5'-phosphate reductase) 0.5853 24 74
3i7a-assembly1.cif.gz_A crystal structure of putative metal-dependent phosphohydrolase (yp_926882.1) from shewanella amazonensis sb2b at 2.06 a resolution 0.582 104 316
3hc1-assembly1.cif.gz_A crystal structure of hdod domain protein with unknown function (np_953345.1) from geobacter sulfurreducens at 1.90 a resolution 0.5336 117 317
ID Description Score Start End Superfamily
3m1tA00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6417 117 318 1.10.3210.10
3i7aA00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.5987 119 316 1.10.3210.10
3hc1A00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.536 117 317 1.10.3210.10
4gi2B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.5164 1 74 3.40.50.720
3m1tA00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.5153 117 318 1.10.3210.10
ID Description Score Start End GO Terms
AF-A0A4Q3JUI7-F1-model_v4 deleted 0.9499 202 312
AF-A0A4Q3KP76-F1-model_v4 deleted 0.9485 200 317
AF-A0A2N2SE73-F1-model_v4 Regulator 0.9298 202 321
AF-A0A257XNW2-F1-model_v4 Signal transduction protein 0.9173 106 317
AF-A0A2N2SE73-F1-model_v4 Regulator 0.9145 202 321

Feature Viewer

pLDDT pTM Quality
83.29 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map