F309286

General Info

Members Datasets Scaffolds Average Seq Length
202 108 201 326

Family's Representative Sequence

Representative Sequence 3300003316|rootH1_10102922|rootH1_101029222
Length 354
Sequence MGRRLRRADCSSRLTDCRQGTQVGMSVQVDAPPLPVHLQLEVTSACNLRCTMCLVRYRPPVNKIAGAMRPELFHRLLEDVPLQRLTLQGLGEPLLSPYLPEMIEAAVRGGIRVGFNTNATLLSRHRAEQLVASKLDWLHVSLDGASPGVYEAVRQGARFDTVVANLTGLVAAKREAASATPWIRVVFVAMRDNVAELPVLVRLLGEIGVNELRVQNLSHSFEDTDSAGGYDEIREFTAGQALWTGEDLAQARSSFAAAMRTAQQSGLRLRLPSFTDAGGANCTWPWDAAYVTSSGVVQPCCMVMGDDRISLGDLTQTRFAEIWYGDAYREFRRRLNSAEPPEVCRGCSLYRHTF

Samples

Sample ID Description Type Environment
1 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
44 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
45 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
46 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
47 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
48 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
49 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
50 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
51 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
52 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
53 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
54 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
55 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
56 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
57 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
58 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
59 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
60 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
61 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
62 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
63 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
64 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
65 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
66 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
67 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
68 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
69 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
70 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
71 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
72 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
73 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
74 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
75 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
76 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
86 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
87 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
88 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
89 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
90 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
91 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
92 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
93 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
94 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
95 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
96 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
97 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
98 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
100 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
101 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
102 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
103 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
104 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
105 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
106 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
107 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
108 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0
Isolates 0.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.91
Rhizosphere 88.61
Stem 0
Stem Tuber 0
Unclassified 2.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10102922 3300003316 Bacteria 2208
2 rootH1_10122949 3300003316 Bacteria 1602
3 rootH2_10006042 3300003320 Bacteria 7787
4 rootL2_10009669 3300003322 Bacteria 3257
5 rootL2_10068449 3300003322 Bacteria 5090
6 JGI25407J50210_10004189 3300003373 Bacteria 3509
7 Ga0070658_10030625 3300005327 Bacteria 4322
8 Ga0070683_100015922 3300005329 Bacteria 6615
9 Ga0070680_100033031 3300005336 Bacteria 4168
10 Ga0068868_100037554 3300005338 Bacteria 3755
11 Ga0070661_100050715 3300005344 Bacteria 3036
12 Ga0070674_100106594 3300005356 Bacteria 2051
13 Ga0070659_100281395 3300005366 Bacteria 1384
14 Ga0070659_100336073 3300005366 Bacteria 1265
15 Ga0070714_100023253 3300005435 Bacteria 5088
16 Ga0070694_100008948 3300005444 Bacteria 6134
17 Ga0070681_10020175 3300005458 Bacteria 6681
18 Ga0070684_100005222 3300005535 Bacteria 9929
19 Ga0070684_100062287 3300005535 Bacteria 3267
20 Ga0070704_100168910 3300005549 Bacteria 1737
21 Ga0068854_100179105 3300005578 Bacteria 1655
22 Ga0068856_100015523 3300005614 Bacteria 7362
23 Ga0068856_100056311 3300005614 Bacteria 3879
24 Ga0068856_100144558 3300005614 Bacteria 2386
25 Ga0068852_100105786 3300005616 Bacteria 2550
26 Ga0068852_100331988 3300005616 Bacteria 1480
27 Ga0068859_100026404 3300005617 Bacteria 5823
28 Ga0081538_10000144 3300005981 Bacteria 73787
29 Ga0075428_100002290 3300006844 Bacteria 20714
30 Ga0075428_100172201 3300006844 Bacteria 2346
31 Ga0075430_100001707 3300006846 Bacteria 17906
32 Ga0075430_100002516 3300006846 Bacteria 15273
33 Ga0075430_100072822 3300006846 Bacteria 2881
34 Ga0075431_100008345 3300006847 Bacteria 10363
35 Ga0075431_100009848 3300006847 Bacteria 9595
36 Ga0075431_100012994 3300006847 Bacteria 8406
37 Ga0075429_100004208 3300006880 Bacteria 12326
38 Ga0097620_100026404 3300006931 Bacteria 5823
39 Ga0111539_10369611 3300009094 Unclassified 1669
40 Ga0114129_10004483 3300009147 Bacteria 19689
41 Ga0157369_10433927 3300013105 Bacteria 1361
42 Ga0157374_10041169 3300013296 Bacteria 4256
43 Ga0157372_10105663 3300013307 Bacteria 3220
44 Ga0207660_10085894 3300025917 Bacteria 2322
45 Ga0207652_10014264 3300025921 Bacteria 6435
46 Ga0207664_10027815 3300025929 Bacteria 4291
47 Ga0207669_10110177 3300025937 Bacteria 1843
48 Ga0207640_10280102 3300025981 Bacteria 1309
49 Ga0207677_10035033 3300026023 Bacteria 3256
50 Ga0207678_10262960 3300026067 Bacteria 1479
51 Ga0207702_10054956 3300026078 Bacteria 3376
52 Ga0207702_10059936 3300026078 Bacteria 3243
53 Ga0207674_10087518 3300026116 Bacteria 3108
54 Ga0207698_10058218 3300026142 Bacteria 2994
55 Ga0307408_100019643 3300031548 Bacteria 4551
56 Ga0307408_100025121 3300031548 Bacteria 4077
57 Ga0307408_100056429 3300031548 Bacteria 2848
58 Ga0307408_100202897 3300031548 Bacteria 1606
59 Ga0307410_10058822 3300031852 Bacteria 2622
60 Ga0307406_10019116 3300031901 Bacteria 4018
61 Ga0307406_10081475 3300031901 Bacteria 2152
62 Ga0307407_10231650 3300031903 Bacteria 1255
63 Ga0307412_10056668 3300031911 Bacteria 2613
64 Ga0307409_100054851 3300031995 Bacteria 3073
65 Ga0307416_100044485 3300032002 Bacteria 3487
66 Ga0307416_100204494 3300032002 Unclassified 1877
67 Ga0307411_10055749 3300032005 Bacteria 2602
68 Ga0307411_10098873 3300032005 Unclassified 2058
69 Ga0307415_100019117 3300032126 Bacteria 4153
70 Ga0307415_100033761 3300032126 Bacteria 3323
71 Ga0307415_100119907 3300032126 Bacteria 1970
72 Ga0307415_100394675 3300032126 Bacteria 1179
73 Ga0373931_0005991 3300035691 Bacteria 5653
74 Ga0395899_0005476 3300037312 Bacteria 9847
75 Ga0395899_0286521 3300037312 Unclassified 1119
76 Ga0395900_0036610 3300037418 Bacteria 5059
77 Ga0395898_0012190 3300037466 Bacteria 8892
78 Ga0395905_0185187 3300037471 Bacteria 1954
79 Ga0395901_0004199 3300038443 Bacteria 14522
80 Ga0466966_0029867 3300044684 Bacteria 3544
81 Ga0466963_0000641 3300044694 Bacteria 16820
82 Ga0466963_0009050 3300044694 Bacteria 5983
83 Ga0466963_0040041 3300044694 Bacteria 3071
84 Ga0466971_0030077 3300044719 Bacteria 2430
85 Ga0466971_0049799 3300044719 Bacteria 1885
86 Ga0466960_0044838 3300044901 Bacteria 2110
87 Ga0466960_0137484 3300044901 Unclassified 1295
88 Ga0466959_0182807 3300045049 Bacteria 1466
89 Ga0466958_0049689 3300045836 Bacteria 2538
90 Ga0466967_0000197 3300045976 Bacteria 25201
91 Ga0466967_0001208 3300045976 Bacteria 14538
92 Ga0466967_0004218 3300045976 Bacteria 9640
93 Ga0466967_0008674 3300045976 Bacteria 7478
94 Ga0466967_0074509 3300045976 Bacteria 3049
95 Ga0466967_0129158 3300045976 Bacteria 2344
96 Ga0496100_0001391 3300048903 Bacteria 11859
97 Ga0496102_0007326 3300048905 Bacteria 9419
98 Ga0496102_0013644 3300048905 Bacteria 7042
99 Ga0496104_0053640 3300048907 Bacteria 3810
100 Ga0496105_0013247 3300048908 Bacteria 6543
101 Ga0496106_0013500 3300048909 Bacteria 6031
102 Ga0496108_0003488 3300048911 Bacteria 12601
103 Ga0496108_0011100 3300048911 Bacteria 7317
104 Ga0496109_0002466 3300048912 Bacteria 15507
105 Ga0496109_0194493 3300048912 Unclassified 1906
106 Ga0496109_0510802 3300048912 Unclassified 1134
107 Ga0496111_0041568 3300048914 Bacteria 3299
108 Ga0496111_0083629 3300048914 Unclassified 2332
109 Ga0496112_0009573 3300048915 Bacteria 8739
110 Ga0496112_0067696 3300048915 Bacteria 3525
111 Ga0496113_0012558 3300048916 Bacteria 5698
112 Ga0496114_0080736 3300048917 Bacteria 2747
113 Ga0496114_0380586 3300048917 Unclassified 1249
114 Ga0501031_0197745 3300049568 Unclassified 1312
115 Ga0501036_0063530 3300049572 Bacteria 3126
116 Ga0501036_0116916 3300049572 Bacteria 2252
117 Ga0501038_0040407 3300049574 Bacteria 4074
118 Ga0501038_0085346 3300049574 Bacteria 2655
119 Ga0501038_0400040 3300049574 Bacteria 1063
120 Ga0501039_0072674 3300049575 Bacteria 2673
121 Ga0501039_0076799 3300049575 Bacteria 2597
122 Ga0501040_0144836 3300049576 Unclassified 1674
123 Ga0501041_0007571 3300049577 Bacteria 6377
124 Ga0501042_0051624 3300049578 Bacteria 2933
125 Ga0501042_0118220 3300049578 Bacteria 1908
126 Ga0501042_0320418 3300049578 Unclassified 1120
127 Ga0501046_0093570 3300049580 Bacteria 2310
128 Ga0501046_0170801 3300049580 Bacteria 1632
129 Ga0501048_0080364 3300049582 Bacteria 2300
130 Ga0501048_0135532 3300049582 Bacteria 1740
131 Ga0501067_0038495 3300049583 Bacteria 2655
132 Ga0501068_0104811 3300049584 Bacteria 1755
133 Ga0501068_0244759 3300049584 Bacteria 1142
134 Ga0501069_0093344 3300049585 Bacteria 1703
135 Ga0501071_0011387 3300049587 Bacteria 5993
136 Ga0501071_0260353 3300049587 Bacteria 1310
137 Ga0501071_0383873 3300049587 Unclassified 1071
138 Ga0501072_0002283 3300049588 Bacteria 14338
139 Ga0501072_0006015 3300049588 Bacteria 9251
140 Ga0501072_0048193 3300049588 Bacteria 3355
141 Ga0501072_0104857 3300049588 Bacteria 2248
142 Ga0501072_0169046 3300049588 Bacteria 1745
143 Ga0501072_0238748 3300049588 Unclassified 1447
144 Ga0501074_0102414 3300049590 Bacteria 2050
145 Ga0501074_0176202 3300049590 Bacteria 1526
146 Ga0501075_0017327 3300049591 Bacteria 5203
147 Ga0501075_0225711 3300049591 Bacteria 1428
148 Ga0501076_0028585 3300049592 Bacteria 4330
149 Ga0501076_0045303 3300049592 Bacteria 3472
150 Ga0501076_0090026 3300049592 Bacteria 2467
151 Ga0501076_0100557 3300049592 Bacteria 2330
152 Ga0501076_0121249 3300049592 Bacteria 2117
153 Ga0501077_0003270 3300049593 Bacteria 9761
154 Ga0501077_0017764 3300049593 Bacteria 4493
155 Ga0501077_0163448 3300049593 Bacteria 1414
156 Ga0501079_0035627 3300049741 Bacteria 3832
157 Ga0501079_0040848 3300049741 Bacteria 3580
158 Ga0501079_0051857 3300049741 Bacteria 3168
159 Ga0501079_0066562 3300049741 Bacteria 2780
160 Ga0501079_0089593 3300049741 Bacteria 2382
161 Ga0501079_0414099 3300049741 Unclassified 1057
162 Ga0501080_0094976 3300049742 Bacteria 2769
163 Ga0501080_0193845 3300049742 Bacteria 1867
164 Ga0501080_0510487 3300049742 Bacteria 1073
165 Ga0501081_0008977 3300049743 Bacteria 6498
166 Ga0501081_0009470 3300049743 Bacteria 6350
167 Ga0501081_0019883 3300049743 Bacteria 4473
168 Ga0501081_0052723 3300049743 Bacteria 2808
169 Ga0501081_0152251 3300049743 Bacteria 1662
170 Ga0501081_0247683 3300049743 Bacteria 1300
171 Ga0501081_0261396 3300049743 Bacteria 1265
172 Ga0501083_0067960 3300049744 Bacteria 2372
173 Ga0501083_0097817 3300049744 Unclassified 1936
174 Ga0501035_0077517 3300049822 Bacteria 2937
175 Ga0501035_0262439 3300049822 Bacteria 1464
176 Ga0501045_0031994 3300049824 Bacteria 3811
177 Ga0501045_0095329 3300049824 Bacteria 2201
178 Ga0501045_0140492 3300049824 Bacteria 1796
179 nmdc:mga05p37_1671_c1 3300050507 Bacteria 25778
180 nmdc:mga05p37_21140_c1 3300050507 Bacteria 7878
181 nmdc:mga05p37_23519_c1 3300050507 Bacteria 7477
182 nmdc:mga09592_1000_c1 3300050508 Bacteria 22406
183 nmdc:mga09592_406198_c1 3300050508 Bacteria 1177
184 nmdc:mga0qj67_172409_c1 3300050509 Bacteria 1757
185 nmdc:mga0qj67_608_c1 3300050509 Bacteria 24507
186 nmdc:mga0qj67_9_c2 3300050509 Bacteria 67584
187 nmdc:mga06r32_235_c1 3300050510 Bacteria 45163
188 nmdc:mga06r32_275373_c1 3300050510 Bacteria 1670
189 nmdc:mga06r32_71144_c1 3300050510 Bacteria 3366
190 Ga0501084_0006373 3300054114 Bacteria 9693
191 Ga0501084_0057412 3300054114 Bacteria 3257
192 Ga0501084_0134421 3300054114 Bacteria 2082
193 Ga0501084_0213827 3300054114 Bacteria 1626
194 Ga0590071_018276 3300059421 Bacteria 1649
195 Ga0501082_0004660 3300060353 Bacteria 11965
196 Ga0501082_0051960 3300060353 Bacteria 3532
197 Ga0501082_0240994 3300060353 Bacteria 1574
198 Ga0466962_0015978 3300061719 Bacteria 3622
199 Ga0530510_0024125 3300061734 Bacteria 4338
200 Ga0530510_0124462 3300061734 Bacteria 1894
201 Ga0530510_0141356 3300061734 Bacteria 1774

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049591 Ga0501075_0225711 Ga0501075_0225711_13_789 252
2 3300049742 Ga0501080_0510487 Ga0501080_0510487_279_1055 252
3 3300050508 nmdc:mga09592_406198_c1 nmdc:mga09592_406198_c1_12_836 270
4 3300009094 Ga0111539_10369611 Ga0111539_103696112 280
5 3300049741 Ga0501079_0066562 Ga0501079_0066562_1865_2746 286
6 3300049744 Ga0501083_0067960 Ga0501083_0067960_1481_2362 286
7 3300006846 Ga0075430_100072822 Ga0075430_1000728221 287
8 3300006847 Ga0075431_100012994 Ga0075431_1000129944 287
9 3300050509 nmdc:mga0qj67_172409_c1 nmdc:mga0qj67_172409_c1_87_965 287
10 3300049741 Ga0501079_0414099 Ga0501079_0414099_71_1024 288
11 3300003320 rootH2_10006042 rootH2_100060423 293
12 3300049741 Ga0501079_0035627 Ga0501079_0035627_2655_3647 298
13 3300049743 Ga0501081_0152251 Ga0501081_0152251_534_1526 298
14 3300005356 Ga0070674_100106594 Ga0070674_1001065942 300
15 3300025937 Ga0207669_10110177 Ga0207669_101101772 300
16 3300048912 Ga0496109_0510802 Ga0496109_0510802_193_1113 300
17 3300003316 rootH1_10122949 rootH1_101229493 301
18 3300013105 Ga0157369_10433927 Ga0157369_104339272 302
19 3300037312 Ga0395899_0286521 Ga0395899_0286521_79_1008 302
20 3300038443 Ga0395901_0004199 Ga0395901_0004199_919_1848 302
21 3300044901 Ga0466960_0044838 Ga0466960_0044838_399_1328 302
22 3300044901 Ga0466960_0137484 Ga0466960_0137484_12_947 302
23 3300045976 Ga0466967_0001208 Ga0466967_0001208_11339_12268 302
24 3300049574 Ga0501038_0400040 Ga0501038_0400040_20_946 302
25 3300049587 Ga0501071_0260353 Ga0501071_0260353_47_973 302
26 3300049588 Ga0501072_0006015 Ga0501072_0006015_8270_9196 302
27 3300049590 Ga0501074_0176202 Ga0501074_0176202_575_1504 302
28 3300049593 Ga0501077_0003270 Ga0501077_0003270_8653_9579 302
29 3300049742 Ga0501080_0094976 Ga0501080_0094976_138_1064 302
30 3300049743 Ga0501081_0008977 Ga0501081_0008977_4474_5400 302
31 3300049822 Ga0501035_0262439 Ga0501035_0262439_274_1200 302
32 3300054114 Ga0501084_0057412 Ga0501084_0057412_2300_3229 302
33 3300054114 Ga0501084_0134421 Ga0501084_0134421_1067_1993 302
34 3300060353 Ga0501082_0004660 Ga0501082_0004660_10254_11180 302
35 3300048912 Ga0496109_0194493 Ga0496109_0194493_874_1854 307
36 3300049588 Ga0501072_0002283 Ga0501072_0002283_3237_4235 307
37 3300049592 Ga0501076_0028585 Ga0501076_0028585_2375_3373 307
38 3300005616 Ga0068852_100105786 Ga0068852_1001057862 308
39 3300026142 Ga0207698_10058218 Ga0207698_100582182 308
40 3300049574 Ga0501038_0040407 Ga0501038_0040407_2034_3041 308
41 3300049580 Ga0501046_0093570 Ga0501046_0093570_83_1090 308
42 3300049582 Ga0501048_0135532 Ga0501048_0135532_288_1295 308
43 3300049592 Ga0501076_0090026 Ga0501076_0090026_1397_2404 308
44 3300049743 Ga0501081_0019883 Ga0501081_0019883_1902_2909 308
45 3300049822 Ga0501035_0077517 Ga0501035_0077517_1397_2404 308
46 3300049824 Ga0501045_0031994 Ga0501045_0031994_2672_3679 308
47 3300031901 Ga0307406_10019116 Ga0307406_100191163 310
48 3300049588 Ga0501072_0048193 Ga0501072_0048193_1883_2899 310
49 3300049593 Ga0501077_0163448 Ga0501077_0163448_358_1371 314
50 3300049743 Ga0501081_0247683 Ga0501081_0247683_150_1163 314
51 3300049824 Ga0501045_0140492 Ga0501045_0140492_388_1401 314
52 3300044694 Ga0466963_0000641 Ga0466963_0000641_7672_8673 316
53 3300045976 Ga0466967_0004218 Ga0466967_0004218_4523_5524 316
54 3300044694 Ga0466963_0009050 Ga0466963_0009050_1304_2323 319
55 3300044719 Ga0466971_0049799 Ga0466971_0049799_488_1507 319
56 3300045976 Ga0466967_0000197 Ga0466967_0000197_276_1295 319
57 3300049588 Ga0501072_0169046 Ga0501072_0169046_70_1062 322
58 3300026067 Ga0207678_10262960 Ga0207678_102629602 323
59 3300032126 Ga0307415_100019117 Ga0307415_1000191172 323
60 3300044694 Ga0466963_0040041 Ga0466963_0040041_1826_2833 323
61 3300045836 Ga0466958_0049689 Ga0466958_0049689_1259_2266 323
62 3300045976 Ga0466967_0008674 Ga0466967_0008674_5387_6394 323
63 3300045976 Ga0466967_0074509 Ga0466967_0074509_226_1233 323
64 3300049583 Ga0501067_0038495 Ga0501067_0038495_444_1460 323
65 3300061719 Ga0466962_0015978 Ga0466962_0015978_251_1258 323
66 3300005435 Ga0070714_100023253 Ga0070714_1000232534 324
67 3300025929 Ga0207664_10027815 Ga0207664_100278152 324
68 3300032126 Ga0307415_100394675 Ga0307415_1003946751 324
69 3300049587 Ga0501071_0383873 Ga0501071_0383873_31_1023 324
70 3300060353 Ga0501082_0240994 Ga0501082_0240994_22_1041 324
71 3300005327 Ga0070658_10030625 Ga0070658_100306254 325
72 3300005329 Ga0070683_100015922 Ga0070683_1000159225 325
73 3300005336 Ga0070680_100033031 Ga0070680_1000330311 325
74 3300005338 Ga0068868_100037554 Ga0068868_1000375543 325
75 3300005344 Ga0070661_100050715 Ga0070661_1000507153 325
76 3300005366 Ga0070659_100281395 Ga0070659_1002813951 325
77 3300005444 Ga0070694_100008948 Ga0070694_1000089484 325
78 3300005458 Ga0070681_10020175 Ga0070681_100201756 325
79 3300005535 Ga0070684_100005222 Ga0070684_1000052228 325
80 3300005535 Ga0070684_100062287 Ga0070684_1000622872 325
81 3300005549 Ga0070704_100168910 Ga0070704_1001689102 325
82 3300005578 Ga0068854_100179105 Ga0068854_1001791051 325
83 3300005614 Ga0068856_100015523 Ga0068856_1000155232 325
84 3300005616 Ga0068852_100331988 Ga0068852_1003319882 325
85 3300005617 Ga0068859_100026404 Ga0068859_1000264045 325
86 3300006844 Ga0075428_100172201 Ga0075428_1001722012 325
87 3300006846 Ga0075430_100001707 Ga0075430_10000170713 325
88 3300006847 Ga0075431_100008345 Ga0075431_1000083454 325
89 3300006931 Ga0097620_100026404 Ga0097620_1000264045 325
90 3300013296 Ga0157374_10041169 Ga0157374_100411692 325
91 3300013307 Ga0157372_10105663 Ga0157372_101056633 325
92 3300025917 Ga0207660_10085894 Ga0207660_100858943 325
93 3300025921 Ga0207652_10014264 Ga0207652_100142649 325
94 3300025981 Ga0207640_10280102 Ga0207640_102801021 325
95 3300026023 Ga0207677_10035033 Ga0207677_100350332 325
96 3300026078 Ga0207702_10059936 Ga0207702_100599363 325
97 3300026116 Ga0207674_10087518 Ga0207674_100875183 325
98 3300031548 Ga0307408_100019643 Ga0307408_1000196433 325
99 3300031548 Ga0307408_100056429 Ga0307408_1000564292 325
100 3300031548 Ga0307408_100202897 Ga0307408_1002028972 325
101 3300031852 Ga0307410_10058822 Ga0307410_100588222 325
102 3300031901 Ga0307406_10081475 Ga0307406_100814752 325
103 3300031911 Ga0307412_10056668 Ga0307412_100566682 325
104 3300031995 Ga0307409_100054851 Ga0307409_1000548512 325
105 3300032002 Ga0307416_100044485 Ga0307416_1000444853 325
106 3300032005 Ga0307411_10055749 Ga0307411_100557492 325
107 3300035691 Ga0373931_0005991 Ga0373931_0005991_2535_3533 325
108 3300045976 Ga0466967_0129158 Ga0466967_0129158_1257_2261 325
109 3300048905 Ga0496102_0007326 Ga0496102_0007326_1191_2189 325
110 3300048911 Ga0496108_0003488 Ga0496108_0003488_9813_10817 325
111 3300048912 Ga0496109_0002466 Ga0496109_0002466_5117_6121 325
112 3300048914 Ga0496111_0041568 Ga0496111_0041568_1286_2290 325
113 3300048915 Ga0496112_0009573 Ga0496112_0009573_994_1998 325
114 3300048915 Ga0496112_0067696 Ga0496112_0067696_1435_2427 325
115 3300048917 Ga0496114_0080736 Ga0496114_0080736_1240_2244 325
116 3300049568 Ga0501031_0197745 Ga0501031_0197745_224_1219 325
117 3300049572 Ga0501036_0063530 Ga0501036_0063530_448_1443 325
118 3300049572 Ga0501036_0116916 Ga0501036_0116916_412_1413 325
119 3300049574 Ga0501038_0085346 Ga0501038_0085346_325_1320 325
120 3300049575 Ga0501039_0072674 Ga0501039_0072674_703_1704 325
121 3300049575 Ga0501039_0076799 Ga0501039_0076799_322_1317 325
122 3300049576 Ga0501040_0144836 Ga0501040_0144836_384_1379 325
123 3300049577 Ga0501041_0007571 Ga0501041_0007571_377_1372 325
124 3300049578 Ga0501042_0051624 Ga0501042_0051624_1916_2917 325
125 3300049578 Ga0501042_0118220 Ga0501042_0118220_312_1307 325
126 3300049578 Ga0501042_0320418 Ga0501042_0320418_106_1107 325
127 3300049580 Ga0501046_0170801 Ga0501046_0170801_333_1334 325
128 3300049582 Ga0501048_0080364 Ga0501048_0080364_763_1764 325
129 3300049584 Ga0501068_0104811 Ga0501068_0104811_85_1086 325
130 3300049584 Ga0501068_0244759 Ga0501068_0244759_110_1123 325
131 3300049585 Ga0501069_0093344 Ga0501069_0093344_97_1092 325
132 3300049587 Ga0501071_0011387 Ga0501071_0011387_2946_3947 325
133 3300049588 Ga0501072_0104857 Ga0501072_0104857_618_1619 325
134 3300049588 Ga0501072_0238748 Ga0501072_0238748_141_1136 325
135 3300049590 Ga0501074_0102414 Ga0501074_0102414_1043_2038 325
136 3300049591 Ga0501075_0017327 Ga0501075_0017327_2374_3369 325
137 3300049592 Ga0501076_0045303 Ga0501076_0045303_994_1989 325
138 3300049592 Ga0501076_0100557 Ga0501076_0100557_589_1584 325
139 3300049592 Ga0501076_0121249 Ga0501076_0121249_831_1832 325
140 3300049593 Ga0501077_0017764 Ga0501077_0017764_3249_4244 325
141 3300049741 Ga0501079_0040848 Ga0501079_0040848_253_1248 325
142 3300049741 Ga0501079_0051857 Ga0501079_0051857_1424_2425 325
143 3300049741 Ga0501079_0089593 Ga0501079_0089593_931_1926 325
144 3300049742 Ga0501080_0193845 Ga0501080_0193845_408_1403 325
145 3300049743 Ga0501081_0009470 Ga0501081_0009470_122_1117 325
146 3300049743 Ga0501081_0052723 Ga0501081_0052723_1038_2039 325
147 3300049744 Ga0501083_0097817 Ga0501083_0097817_499_1494 325
148 3300049824 Ga0501045_0095329 Ga0501045_0095329_473_1474 325
149 3300050507 nmdc:mga05p37_23519_c1 nmdc:mga05p37_23519_c1_4194_5192 325
150 3300050509 nmdc:mga0qj67_608_c1 nmdc:mga0qj67_608_c1_17329_18327 325
151 3300050510 nmdc:mga06r32_71144_c1 nmdc:mga06r32_71144_c1_209_1207 325
152 3300054114 Ga0501084_0006373 Ga0501084_0006373_3136_4131 325
153 3300054114 Ga0501084_0213827 Ga0501084_0213827_256_1257 325
154 3300060353 Ga0501082_0051960 Ga0501082_0051960_329_1324 325
155 3300061734 Ga0530510_0024125 Ga0530510_0024125_1418_2413 325
156 3300061734 Ga0530510_0124462 Ga0530510_0124462_433_1434 325
157 3300061734 Ga0530510_0141356 Ga0530510_0141356_283_1284 325
158 3300003322 rootL2_10009669 rootL2_100096694 326
159 3300031548 Ga0307408_100025121 Ga0307408_1000251214 326
160 3300032002 Ga0307416_100204494 Ga0307416_1002044942 326
161 3300032005 Ga0307411_10098873 Ga0307411_100988732 326
162 3300049743 Ga0501081_0261396 Ga0501081_0261396_69_1091 326
163 3300050510 nmdc:mga06r32_275373_c1 nmdc:mga06r32_275373_c1_108_1109 326
164 3300003373 JGI25407J50210_10004189 JGI25407J50210_100041893 327
165 3300005614 Ga0068856_100056311 Ga0068856_1000563113 327
166 3300005981 Ga0081538_10000144 Ga0081538_1000014432 327
167 3300026078 Ga0207702_10054956 Ga0207702_100549562 327
168 3300044684 Ga0466966_0029867 Ga0466966_0029867_848_1852 327
169 3300045049 Ga0466959_0182807 Ga0466959_0182807_297_1301 327
170 3300048903 Ga0496100_0001391 Ga0496100_0001391_5664_6677 327
171 3300048905 Ga0496102_0013644 Ga0496102_0013644_5231_6244 327
172 3300048907 Ga0496104_0053640 Ga0496104_0053640_1069_2082 327
173 3300048908 Ga0496105_0013247 Ga0496105_0013247_151_1164 327
174 3300048909 Ga0496106_0013500 Ga0496106_0013500_3993_5006 327
175 3300048911 Ga0496108_0011100 Ga0496108_0011100_1074_2087 327
176 3300048914 Ga0496111_0083629 Ga0496111_0083629_307_1320 327
177 3300048916 Ga0496113_0012558 Ga0496113_0012558_3211_4224 327
178 3300048917 Ga0496114_0380586 Ga0496114_0380586_104_1117 327
179 iso_pu_bacteria 2751185782 2753265866 327
180 3300050507 nmdc:mga05p37_21140_c1 nmdc:mga05p37_21140_c1_2327_3328 328
181 3300059421 Ga0590071_018276 Ga0590071_018276_495_1508 328
182 3300006844 Ga0075428_100002290 Ga0075428_10000229013 329
183 3300006846 Ga0075430_100002516 Ga0075430_1000025168 329
184 3300006847 Ga0075431_100009848 Ga0075431_1000098483 329
185 3300006880 Ga0075429_100004208 Ga0075429_1000042084 329
186 3300009147 Ga0114129_10004483 Ga0114129_1000448313 329
187 3300050507 nmdc:mga05p37_1671_c1 nmdc:mga05p37_1671_c1_8923_9948 329
188 3300050508 nmdc:mga09592_1000_c1 nmdc:mga09592_1000_c1_11618_12643 329
189 3300050509 nmdc:mga0qj67_9_c2 nmdc:mga0qj67_9_c2_54686_55711 329
190 3300050510 nmdc:mga06r32_235_c1 nmdc:mga06r32_235_c1_31642_32667 329
191 3300003322 rootL2_10068449 rootL2_100684492 330
192 3300044719 Ga0466971_0030077 Ga0466971_0030077_14_1030 330
193 3300005366 Ga0070659_100336073 Ga0070659_1003360731 331
194 3300005614 Ga0068856_100144558 Ga0068856_1001445581 331
195 3300031903 Ga0307407_10231650 Ga0307407_102316501 332
196 3300032126 Ga0307415_100119907 Ga0307415_1001199072 332
197 3300037312 Ga0395899_0005476 Ga0395899_0005476_1622_2647 333
198 3300037418 Ga0395900_0036610 Ga0395900_0036610_1085_2110 333
199 3300037466 Ga0395898_0012190 Ga0395898_0012190_3416_4441 333
200 3300037471 Ga0395905_0185187 Ga0395905_0185187_293_1318 333
201 3300032126 Ga0307415_100033761 Ga0307415_1000337611 334
202 3300003316 rootH1_10102922 rootH1_101029222 354

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

40

197

0.9

PF13186

SPASM

Iron-sulfur cluster-binding domain

282

348

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6efn-assembly1.cif.gz_A-2 structure of a ripp maturase, skfb 0.8083 31 345
6b4c-assembly4.cif.gz_D structure of viperin from trichoderma virens 0.7875 34 272
6c8v-assembly1.cif.gz_A x-ray structure of pqqe from methylobacterium extorquens 0.7814 33 331
5why-assembly1.cif.gz_A structural insights into thioether bond formation in the biosynthesis of sactipeptides 0.764 32 332
5why-assembly2.cif.gz_B structural insights into thioether bond formation in the biosynthesis of sactipeptides 0.7595 32 333
ID Description Score Start End Superfamily
af_Q59026_29_239_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.818 40 215 3.20.20.70
af_P9WJ79_7_303_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8104 30 330 3.20.20.70
af_O33183_77_264_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.794 36 229 3.20.20.70
af_Q58214_34_265_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7872 39 273 3.20.20.70
af_P9WJ79_7_303_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7829 30 330 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A3N5R7R5-F1-model_v4 Radical SAM protein 0.9494 64 191 GO:0003824
GO:0046872
GO:0051536
AF-A0A1G1GPP9-F1-model_v4 Radical SAM protein 0.9341 44 354 GO:0003824
GO:0046872
GO:0051536
AF-A0A660ZQ72-F1-model_v4 Radical SAM core domain-containing protein 0.9313 34 345 GO:0003824
GO:0046872
GO:0051536
AF-A0A353TWI9-F1-model_v4 Radical SAM protein 0.9282 34 216 GO:0003824
GO:0046872
GO:0051536
AF-X0X2M8-F1-model_v4 Radical SAM core domain-containing protein 0.9235 32 218 GO:0003824
GO:0046872
GO:0051539

Feature Viewer

pLDDT pTM Quality
87.21 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map