F309159

General Info

Members Datasets Scaffolds Average Seq Length
201 169 402 207

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221678|2644442630
Length 230
Sequence ADPTVLHPMPEQPRVVLLRALVKSPLIEVGEYTYYDDPDDATAFETRNVLYHYGPEKLVIGRFCALGTGVRFLMNGANHRMDGPSTFPFPTMGGSWAEHFDLLTGLPNRGDTVVGNDVWFGYGTTVMPGVRIGHGAIIGAGSVVTADVPDYGIVGGNPARLIRTRYSEADVARLLAVAWWDWPAEHITTHLRTIMSGSVDDLVAAAPSSAAPHASAPETVSPKASPRGPA

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
8 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
10 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
11 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
12 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
13 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
14 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
15 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
16 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
17 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
18 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
19 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
25 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
26 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
27 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
28 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
29 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
30 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
31 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
32 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
33 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
34 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
35 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
36 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
37 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
38 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
39 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
40 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
41 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
42 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
43 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
44 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
45 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
46 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
47 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
48 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
49 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
50 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
51 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
52 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
53 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
54 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
55 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
56 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
57 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
58 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
59 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
60 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
61 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
62 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
63 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
64 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
65 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
66 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
67 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
68 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
69 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
70 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
71 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
72 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
73 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
74 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
75 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
76 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
77 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
78 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
79 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
80 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
81 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
82 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
83 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
84 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
91 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
92 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
93 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
94 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
95 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
96 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
97 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
98 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
99 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
100 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
101 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
102 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
103 2547132424 Nocardia nova SH22a Isolate Unclassified
104 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
105 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
106 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
107 2643221548 Streptomyces sp. Root55 Isolate Unclassified
108 2643221578 Streptomyces sp. Root63 Isolate Unclassified
109 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
110 2643221692 Nocardia sp. Root136 Isolate Unclassified
111 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
112 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
113 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
114 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
115 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
116 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
117 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
118 2808606394 Promicromonospora sp. C35 Isolate Unclassified
119 2808606448 Streptomyces sp. 193411 Isolate Unclassified
120 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
121 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
122 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
123 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
124 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
125 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
126 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
127 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
128 2862574272 Streptomyces sp. AcE210 Isolate Nodule
129 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
130 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
131 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
132 2867369537 Streptomyces sp. Z26 Isolate Unclassified
133 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
134 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
135 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
136 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
137 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
138 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
139 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
140 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
141 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
142 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
143 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
144 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
145 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
146 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
147 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
148 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
149 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
150 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
151 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
152 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
153 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
154 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
155 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
156 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
157 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
158 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
159 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
160 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
161 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
162 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
163 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
164 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
165 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
166 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
167 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
168 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
169 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 64.18
Metatranscriptomes 1
Isolates 34.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.47
Nodule 0.5
Rhizoplane 0.5
Rhizosphere 70.65
Stem 0
Stem Tuber 0
Unclassified 1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002869 3300001979 Bacteria 7705
2 JGI24737J22298_10013758 3300001990 Bacteria 2631
3 JGI24735J21928_10080762 3300002067 Bacteria 931
4 JGI24735J21928_10091515 3300002067 Bacteria 872
5 JGI25160J50197_1007525 3300003354 Bacteria 4251
6 Ga0006562J51391_1138039 3300003578 Bacteria 4550
7 Ga0070714_100136103 3300005435 Bacteria 2200
8 Ga0070663_100069297 3300005455 Bacteria 2562
9 Ga0081455_10243203 3300005937 Bacteria 1321
10 Ga0070717_10027789 3300006028 Bacteria 4523
11 Ga0075428_100092098 3300006844 Bacteria 3305
12 Ga0105240_10096366 3300009093 Unclassified 3605
13 Ga0114129_10693630 3300009147 Bacteria 1309
14 Ga0105241_10224799 3300009174 Bacteria 1580
15 Ga0105238_11522750 3300009551 Unclassified 698
16 Ga0157370_10014658 3300013104 Bacteria 8011
17 Ga0157369_10000067 3300013105 Bacteria 144506
18 Ga0224712_10000172 3300022467 Bacteria 11167
19 Ga0207426_1000423 3300025302 Bacteria 69267
20 Ga0207426_1001520 3300025302 Bacteria 18903
21 Ga0207647_10041492 3300025904 Bacteria 2893
22 Ga0207654_10207497 3300025911 Bacteria 1293
23 Ga0207712_10285512 3300025961 Bacteria 1348
24 Ga0207678_10088054 3300026067 Bacteria 2654
25 Ga0207698_10679620 3300026142 Bacteria 1023
26 Ga0307517_10130940 3300028786 Bacteria 1806
27 Ga0307515_10000025 3300028794 Bacteria 390205
28 Ga0307511_10115474 3300030521 Bacteria 1686
29 Ga0307512_10003158 3300030522 Bacteria 19565
30 Ga0307512_10105282 3300030522 Bacteria 1888
31 Ga0265340_10000549 3300031247 Bacteria 20793
32 Ga0307513_10361212 3300031456 Bacteria 1197
33 Ga0307509_10008035 3300031507 Bacteria 13552
34 Ga0307508_10009478 3300031616 Bacteria 8951
35 Ga0307508_10064396 3300031616 Bacteria 3232
36 Ga0307514_10137714 3300031649 Bacteria 1667
37 Ga0307516_10076114 3300031730 Bacteria 3209
38 Ga0307416_101364391 3300032002 Bacteria 815
39 Ga0307507_10015879 3300033179 Bacteria 8816
40 Ga0307507_10183359 3300033179 Bacteria 1490
41 Ga0307510_10001299 3300033180 Bacteria 27239
42 Ga0307510_10034361 3300033180 Bacteria 5680
43 Ga0373934_0227214 3300035086 Bacteria 770
44 Ga0395900_0020441 3300037418 Bacteria 6759
45 Ga0395898_0002562 3300037466 Bacteria 21315
46 Ga0395901_0309850 3300038443 Bacteria 1635
47 Ga0466972_0045378 3300044658 Bacteria 2130
48 Ga0466965_0024644 3300044683 Bacteria 2911
49 Ga0466965_0141964 3300044683 Bacteria 1251
50 Ga0466966_0014448 3300044684 Bacteria 5227
51 Ga0466961_0012239 3300044693 Bacteria 5486
52 Ga0466961_0049754 3300044693 Bacteria 2678
53 Ga0466970_0081457 3300044765 Bacteria 1750
54 Ga0466970_0488193 3300044765 Bacteria 708
55 Ga0466960_0083000 3300044901 Bacteria 1618
56 Ga0495627_011566 3300046453 Bacteria 3163
57 Ga0495592_0008903 3300046454 Bacteria 7539
58 Ga0495592_0052075 3300046454 Bacteria 3040
59 Ga0495603_0000262 3300046455 Bacteria 27718
60 Ga0495603_0017250 3300046455 Bacteria 4370
61 Ga0495603_0049888 3300046455 Bacteria 2490
62 Ga0495629_0000568 3300046459 Bacteria 29992
63 Ga0495629_0004453 3300046459 Bacteria 10497
64 Ga0495629_0017783 3300046459 Bacteria 5095
65 Ga0495629_0030279 3300046459 Bacteria 3838
66 Ga0495629_0118536 3300046459 Bacteria 1844
67 Ga0495651_0011261 3300046462 Bacteria 6874
68 Ga0495662_0040476 3300046476 Bacteria 2250
69 Ga0495585_0047681 3300046492 Bacteria 2386
70 Ga0495585_0053598 3300046492 Bacteria 2232
71 Ga0495585_0334239 3300046492 Bacteria 739
72 Ga0495594_0000586 3300046499 Bacteria 18751
73 Ga0495620_0119937 3300046515 Bacteria 1037
74 Ga0495630_0155519 3300046517 Bacteria 1740
75 Ga0495666_0131004 3300046526 Bacteria 1172
76 Ga0495640_0006320 3300046533 Bacteria 9388
77 Ga0495586_0053803 3300046535 Bacteria 2181
78 Ga0495587_0060384 3300046536 Bacteria 2223
79 Ga0495622_0006332 3300046557 Bacteria 5495
80 Ga0495634_0026509 3300046642 Bacteria 4043
81 Ga0495611_0009290 3300046648 Bacteria 4151
82 Ga0495611_0029774 3300046648 Bacteria 2396
83 Ga0495611_0124470 3300046648 Bacteria 1202
84 Ga0495625_0043556 3300046660 Bacteria 3254
85 Ga0495625_0079030 3300046660 Bacteria 2295
86 Ga0495635_0004287 3300046663 Bacteria 9874
87 Ga0495661_0398927 3300046665 Bacteria 669
88 Ga0495588_0035218 3300046674 Bacteria 2536
89 Ga0495657_0008241 3300046675 Bacteria 7985
90 Ga0495613_0001287 3300046689 Bacteria 19142
91 Ga0495613_0019026 3300046689 Bacteria 5117
92 Ga0495624_0066201 3300046690 Bacteria 2256
93 Ga0495589_0003155 3300046794 Bacteria 9017
94 Ga0495589_0006559 3300046794 Bacteria 6133
95 Ga0495600_0105449 3300046809 Bacteria 1836
96 Ga0495660_0067207 3300046810 Bacteria 1910
97 Ga0495581_0004708 3300047315 Bacteria 7878
98 Ga0495604_0028619 3300047317 Bacteria 4433
99 Ga0495604_0058174 3300047317 Bacteria 2969
100 Ga0495676_0001362 3300047321 Bacteria 21019
101 Ga0495676_0003203 3300047321 Bacteria 14798
102 Ga0495676_0030014 3300047321 Bacteria 4621
103 Ga0495676_0118688 3300047321 Bacteria 1928
104 Ga0495676_0300432 3300047321 Bacteria 1083
105 Ga0495683_0169696 3300047323 Bacteria 1004
106 Ga0495675_0145977 3300047444 Bacteria 1464
107 Ga0495685_012842 3300047447 Bacteria 2838
108 Ga0495681_0007201 3300047470 Bacteria 7151
109 Ga0495593_0000736 3300047673 Bacteria 18999
110 Ga0495593_0213479 3300047673 Bacteria 969
111 Ga0495614_0000715 3300048089 Bacteria 14007
112 Ga0496119_0120105 3300048922 Bacteria 1446
113 Ga0501037_0175959 3300049573 Bacteria 1520
114 Ga0501038_0086531 3300049574 Bacteria 2633
115 Ga0501038_0124192 3300049574 Bacteria 2126
116 Ga0501039_0695626 3300049575 Bacteria 795
117 Ga0501046_0062656 3300049580 Bacteria 2905
118 Ga0501047_0019763 3300049581 Bacteria 6465
119 Ga0501035_0753710 3300049822 Bacteria 781
120 Ga0501044_0124891 3300049823 Bacteria 2571
121 Ga0501044_0308102 3300049823 Bacteria 1511
122 Ga0495601_0250898 3300053077 Bacteria 1156
123 Ga0500578_0094768 3300053086 Bacteria 1894
124 Ga0500640_013584 3300053095 Bacteria 3372
125 Ga0500553_056742 3300053101 Bacteria 1855
126 Ga0500560_000321 3300053107 Bacteria 6155
127 Ga0500573_0190985 3300053140 Bacteria 1094
128 Ga0500577_0031803 3300053142 Bacteria 1849
129 Ga0500579_087029 3300053143 Bacteria 1711
130 Ga0500600_0072195 3300053149 Bacteria 1890
131 Ga0466962_0166223 3300061719 Bacteria 1073
132 2644442630 2643221678 Bacteria 9540101
133 2515852833 2515154155 Bacteria 7985436
134 2548699375 2547132424 Bacteria 8348532
135 2552109820 2551306166 Bacteria 9731570
136 2585301610 2582581312 Bacteria 7308206
137 2616906620 2616644941 Bacteria 8510691
138 2643759786 2643221548 Bacteria 8053412
139 2643897917 2643221578 Bacteria 9213798
140 2644409062 2643221673 Bacteria 9196637
141 2644516006 2643221692 Bacteria 7282860
142 2676495185 2675903060 Bacteria 10051191
143 2686534652 2684623035 Bacteria 8032739
144 2768642131 2767802112 Bacteria 6465194
145 2776372913 2775506925 Bacteria 7237746
146 2784588847 2784132148 Bacteria 8627943
147 2804844002 2802429296 Bacteria 7227771
148 2808844811 2808606359 Bacteria 9866990
149 2809027026 2808606394 Bacteria 6248540
150 2809232464 2808606448 Bacteria 8656184
151 2812358139 2811994879 Bacteria 9313447
152 2812476893 2811994917 Bacteria 7761064
153 2816422674 2816332119 Bacteria 8120218
154 2816510202 2816332139 Bacteria 9138787
155 2819693642 2818991463 Bacteria 7948711
156 2858907173 2858902515 Bacteria 7086037
157 2861526133 2861520306 Bacteria 8348283
158 2862292308 2862290372 Bacteria 7471434
159 2862580757 2862574272 Bacteria 10567477
160 2863073835 2863067949 Bacteria 8541735
161 2867317901 2867312974 Bacteria 7058875
162 2867319597 2867319477 Bacteria 7069771
163 2867371505 2867369537 Bacteria 6501581
164 2873158580 2873151551 Bacteria 8625867
165 2873321005 2873314349 Bacteria 8512634
166 2875393828 2875391855 Bacteria 7600475
167 2880502419 2880495981 Bacteria 7340502
168 2891397606 2891395885 Bacteria 9251614
169 2891561436 2891554331 Bacteria 8812224
170 2895434085 2895427314 Bacteria 13147766
171 2895446841 2895442618 Bacteria 11027144
172 2895887514 2895880812 Bacteria 11255272
173 2912727609 2912723979 Bacteria 8557534
174 2912759298 2912757875 Bacteria 7940295
175 2912762267 2912757875 Bacteria 7940295
176 2917742513 2917736166 Bacteria 9690793
177 2919472701 2919468124 Bacteria 9133025
178 2919720061 2919713450 Bacteria 7431245
179 2929230908 2929226422 Bacteria 7248583
180 2946050824 2946045630 Bacteria 8527308
181 2966604970 2966598605 Bacteria 7676064
182 2990092275 2990088156 Bacteria 6657676
183 2997455083 2997451912 Bacteria 8492419
184 3003000264 3002998708 Bacteria 11715108
185 3006497979 3006493962 Bacteria 8825450
186 8003877955 8003870546 Bacteria 7396674
187 8023629456 8023623736 Bacteria 8593882
188 8025419508 8025413630 Bacteria 7014048
189 8025483496 8025478263 Bacteria 8209203
190 8033688126 8033684223 Bacteria 6906479
191 8047899181 8047893842 Bacteria 11723082
192 8048135880 8048127548 Bacteria 11053136
193 8048359738 8048356638 Bacteria 11044339
194 8048376143 8048369669 Bacteria 11666822
195 8048385202 8048379754 Bacteria 11877923
196 8053953545 8053945823 Bacteria 8962862
197 8054165917 8054160619 Bacteria 7783213
198 8056208157 8056207758 Bacteria 8639239
199 8056453150 8056447290 Bacteria 7680491
200 8056671730 8056667051 Bacteria 6953971
201 8057572970 8057568493 Bacteria 7221719
202 JGI24740J21852_10002869
203 JGI24737J22298_10013758
204 JGI24735J21928_10080762
205 JGI24735J21928_10091515
206 JGI25160J50197_1007525
207 Ga0006562J51391_1138039
208 Ga0070714_100136103
209 Ga0070663_100069297
210 Ga0081455_10243203
211 Ga0070717_10027789
212 Ga0075428_100092098
213 Ga0105240_10096366
214 Ga0114129_10693630
215 Ga0105241_10224799
216 Ga0105238_11522750
217 Ga0157370_10014658
218 Ga0157369_10000067
219 Ga0224712_10000172
220 Ga0207426_1000423
221 Ga0207426_1001520
222 Ga0207647_10041492
223 Ga0207654_10207497
224 Ga0207712_10285512
225 Ga0207678_10088054
226 Ga0207698_10679620
227 Ga0307517_10130940
228 Ga0307515_10000025
229 Ga0307511_10115474
230 Ga0307512_10003158
231 Ga0307512_10105282
232 Ga0265340_10000549
233 Ga0307513_10361212
234 Ga0307509_10008035
235 Ga0307508_10009478
236 Ga0307508_10064396
237 Ga0307514_10137714
238 Ga0307516_10076114
239 Ga0307416_101364391
240 Ga0307507_10015879
241 Ga0307507_10183359
242 Ga0307510_10001299
243 Ga0307510_10034361
244 Ga0373934_0227214
245 Ga0395900_0020441
246 Ga0395898_0002562
247 Ga0395901_0309850
248 Ga0466972_0045378
249 Ga0466965_0024644
250 Ga0466965_0141964
251 Ga0466966_0014448
252 Ga0466961_0012239
253 Ga0466961_0049754
254 Ga0466970_0081457
255 Ga0466970_0488193
256 Ga0466960_0083000
257 Ga0495627_011566
258 Ga0495592_0008903
259 Ga0495592_0052075
260 Ga0495603_0000262
261 Ga0495603_0017250
262 Ga0495603_0049888
263 Ga0495629_0000568
264 Ga0495629_0004453
265 Ga0495629_0017783
266 Ga0495629_0030279
267 Ga0495629_0118536
268 Ga0495651_0011261
269 Ga0495662_0040476
270 Ga0495585_0047681
271 Ga0495585_0053598
272 Ga0495585_0334239
273 Ga0495594_0000586
274 Ga0495620_0119937
275 Ga0495630_0155519
276 Ga0495666_0131004
277 Ga0495640_0006320
278 Ga0495586_0053803
279 Ga0495587_0060384
280 Ga0495622_0006332
281 Ga0495634_0026509
282 Ga0495611_0009290
283 Ga0495611_0029774
284 Ga0495611_0124470
285 Ga0495625_0043556
286 Ga0495625_0079030
287 Ga0495635_0004287
288 Ga0495661_0398927
289 Ga0495588_0035218
290 Ga0495657_0008241
291 Ga0495613_0001287
292 Ga0495613_0019026
293 Ga0495624_0066201
294 Ga0495589_0003155
295 Ga0495589_0006559
296 Ga0495600_0105449
297 Ga0495660_0067207
298 Ga0495581_0004708
299 Ga0495604_0028619
300 Ga0495604_0058174
301 Ga0495676_0001362
302 Ga0495676_0003203
303 Ga0495676_0030014
304 Ga0495676_0118688
305 Ga0495676_0300432
306 Ga0495683_0169696
307 Ga0495675_0145977
308 Ga0495685_012842
309 Ga0495681_0007201
310 Ga0495593_0000736
311 Ga0495593_0213479
312 Ga0495614_0000715
313 Ga0496119_0120105
314 Ga0501037_0175959
315 Ga0501038_0086531
316 Ga0501038_0124192
317 Ga0501039_0695626
318 Ga0501046_0062656
319 Ga0501047_0019763
320 Ga0501035_0753710
321 Ga0501044_0124891
322 Ga0501044_0308102
323 Ga0495601_0250898
324 Ga0500578_0094768
325 Ga0500640_013584
326 Ga0500553_056742
327 Ga0500560_000321
328 Ga0500573_0190985
329 Ga0500577_0031803
330 Ga0500579_087029
331 Ga0500600_0072195
332 Ga0466962_0166223
333 2644442630
334 2515852833
335 2548699375
336 2552109820
337 2585301610
338 2616906620
339 2643759786
340 2643897917
341 2644409062
342 2644516006
343 2676495185
344 2686534652
345 2768642131
346 2776372913
347 2784588847
348 2804844002
349 2808844811
350 2809027026
351 2809232464
352 2812358139
353 2812476893
354 2816422674
355 2816510202
356 2819693642
357 2858907173
358 2861526133
359 2862292308
360 2862580757
361 2863073835
362 2867317901
363 2867319597
364 2867371505
365 2873158580
366 2873321005
367 2875393828
368 2880502419
369 2891397606
370 2891561436
371 2895434085
372 2895446841
373 2895887514
374 2912727609
375 2912759298
376 2912762267
377 2917742513
378 2919472701
379 2919720061
380 2929230908
381 2946050824
382 2966604970
383 2990092275
384 2997455083
385 3003000264
386 3006497979
387 8003877955
388 8023629456
389 8025419508
390 8025483496
391 8033688126
392 8047899181
393 8048135880
394 8048359738
395 8048376143
396 8048385202
397 8053953545
398 8054165917
399 8056208157
400 8056453150
401 8056671730
402 8057572970

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00132

Hexapep

Bacterial transferase hexapeptide (six repeats)

111

146

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cj8-assembly1.cif.gz_B crystal structure of 2,3,4,5-tetrahydropyridine-2-carboxylate n-succinyltransferase from enterococcus faecalis v583 0.8536 62 170
4n6b-assembly2.cif.gz_C soybean serine acetyltransferase complexed with coa 0.8521 30 168
4hzc-assembly2.cif.gz_I crystal structure of serine acetyltransferase from brucella abortus strain s19 0.8394 31 170
1sst-assembly1.cif.gz_B-2 serine acetyltransferase- complex with coa 0.8342 31 168
1mr9-assembly2.cif.gz_Z crystal structure of streptogramin a acetyltransferase with acetyl-coa bound 0.831 7 203
ID Description Score Start End Superfamily
af_K7MGT5_229_334_2.160.10.10 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.9069 114 173 2.160.10.10
3cj8B03 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.8617 62 170 2.160.10.10
1mr9Z00 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.8295 7 203 2.160.10.10
1mr9Z00 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.8088 7 203 2.160.10.10
3eevB00 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.7943 15 208 2.160.10.10
ID Description Score Start End GO Terms
AF-V4PTT3-F1-model_v4 Acetyltransferase 0.8865 24 215 GO:0016746
AF-A0A1H4KRZ4-F1-model_v4 Virginiamycin A acetyltransferase 0.8666 6 212 GO:0016740
AF-A0A2A5J917-F1-model_v4 Acetyltransferase 0.8663 7 211 GO:0016740
AF-A0A1G7TGL7-F1-model_v4 Virginiamycin A acetyltransferase 0.866 6 212 GO:0016740
AF-A0A1Q5MH19-F1-model_v4 Acetyltransferase 0.8658 6 214 GO:0016740

Map