F309116

General Info

Members Datasets Scaffolds Average Seq Length
201 127 402 164

Family's Representative Sequence

Representative Sequence 3300053134|Ga0500658_0000108|Ga0500658_0000108_19068_19610
Length 180
Sequence VPSSSPPPSVVEATDTSPSRGGSQRIALAAVAGAHGIKGEVRLKLFSDSIESLSQSRKLYVAGTERRLVGIRDGKVPVARFEAISDRGAAEALRGSLVELDREALPPLADGEYYHADIIGLPCVDRAGAPLGTVAAVENYGAGDLLEIELEGGRKSLIAFKPGIADLEDGRVVIDPEFLA

Samples

Sample ID Description Type Environment
1 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
87 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
88 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
89 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
90 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
91 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
96 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
97 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
98 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
104 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
105 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
106 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
107 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
108 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
109 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
110 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
111 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
112 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
113 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
114 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
115 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
116 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
117 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
118 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
119 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
120 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
121 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
122 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
123 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
124 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
125 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
126 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
127 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1
Nodule 0
Rhizoplane 2.99
Rhizosphere 95.02
Stem 0
Stem Tuber 0
Unclassified 2.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500658_0000108 3300053134 Bacteria 38564
2 Ga0070658_10090033 3300005327 Bacteria 2527
3 Ga0070676_10028360 3300005328 Bacteria 3179
4 Ga0070670_100019107 3300005331 Bacteria 5875
5 Ga0070670_100162261 3300005331 Bacteria 1937
6 Ga0068869_100491752 3300005334 Bacteria 1023
7 Ga0070680_100326493 3300005336 Bacteria 1303
8 Ga0070660_100829577 3300005339 Bacteria 778
9 Ga0070661_100068731 3300005344 Bacteria 2603
10 Ga0070661_100363994 3300005344 Bacteria 1137
11 Ga0070668_100019423 3300005347 Bacteria 5114
12 Ga0070668_100038266 3300005347 Bacteria 3666
13 Ga0070668_100395706 3300005347 Bacteria 1179
14 Ga0070669_100046286 3300005353 Bacteria 3172
15 Ga0070669_100773972 3300005353 Bacteria 814
16 Ga0070675_100326602 3300005354 Bacteria 1356
17 Ga0070671_100052191 3300005355 Bacteria 3400
18 Ga0070671_100237101 3300005355 Bacteria 1548
19 Ga0070671_101885252 3300005355 Bacteria 531
20 Ga0070674_100126063 3300005356 Bacteria 1902
21 Ga0070659_100216626 3300005366 Bacteria 1579
22 Ga0070659_101019084 3300005366 Bacteria 727
23 Ga0070667_100062259 3300005367 Bacteria 3160
24 Ga0070667_100086057 3300005367 Bacteria 2696
25 Ga0070667_101395019 3300005367 Bacteria 657
26 Ga0070709_10102586 3300005434 Bacteria 1908
27 Ga0070714_100027531 3300005435 Bacteria 4708
28 Ga0070714_100447340 3300005435 Bacteria 1227
29 Ga0070663_100161871 3300005455 Bacteria 1723
30 Ga0070663_100411319 3300005455 Bacteria 1108
31 Ga0070678_100208480 3300005456 Bacteria 1618
32 Ga0070678_100693106 3300005456 Bacteria 917
33 Ga0070662_101300636 3300005457 Bacteria 626
34 Ga0070662_101474538 3300005457 Bacteria 587
35 Ga0068867_100014484 3300005459 Bacteria 5588
36 Ga0068867_100111587 3300005459 Bacteria 2101
37 Ga0068853_100471373 3300005539 Bacteria 1183
38 Ga0070696_100052606 3300005546 Bacteria 2833
39 Ga0070665_100015884 3300005548 Bacteria 7555
40 Ga0068854_100025032 3300005578 Bacteria 4094
41 Ga0068854_100736145 3300005578 Bacteria 854
42 Ga0068859_100092000 3300005617 Bacteria 3084
43 Ga0068859_100514032 3300005617 Bacteria 1293
44 Ga0068864_100243759 3300005618 Bacteria 1666
45 Ga0068866_10076038 3300005718 Bacteria 1790
46 Ga0068861_100282135 3300005719 Bacteria 1431
47 Ga0068861_100630239 3300005719 Bacteria 988
48 Ga0068851_10026779 3300005834 Bacteria 2836
49 Ga0068851_10168949 3300005834 Bacteria 1206
50 Ga0068858_100380263 3300005842 Bacteria 1355
51 Ga0068860_100049059 3300005843 Bacteria 4023
52 Ga0068860_100229789 3300005843 Bacteria 1803
53 Ga0068862_100037404 3300005844 Bacteria 4114
54 Ga0081539_10032922 3300005985 Bacteria 3165
55 Ga0070712_101178088 3300006175 Bacteria 666
56 Ga0097621_100221724 3300006237 Bacteria 1648
57 Ga0068865_100175192 3300006881 Bacteria 1648
58 Ga0097620_100092001 3300006931 Bacteria 3084
59 Ga0097620_100514002 3300006931 Bacteria 1293
60 Ga0105240_10117316 3300009093 Bacteria 3209
61 Ga0105243_10525046 3300009148 Bacteria 1126
62 Ga0105242_11547825 3300009176 Unclassified 695
63 Ga0105248_10159737 3300009177 Bacteria 2543
64 Ga0105248_10452358 3300009177 Bacteria 1447
65 Ga0105238_10343110 3300009551 Bacteria 1482
66 Ga0105249_10641094 3300009553 Unclassified 1119
67 Ga0157370_10009365 3300013104 Bacteria 10475
68 Ga0157370_10252582 3300013104 Bacteria 1631
69 Ga0157370_10391497 3300013104 Bacteria 1280
70 Ga0157369_10590722 3300013105 Bacteria 1147
71 Ga0157372_10277318 3300013307 Bacteria 1949
72 Ga0157375_10195322 3300013308 Bacteria 2179
73 Ga0163163_10270275 3300014325 Bacteria 1751
74 Ga0163161_10196675 3300017792 Bacteria 1552
75 Ga0207697_10022884 3300025315 Bacteria 2559
76 Ga0207656_10021427 3300025321 Bacteria 2583
77 Ga0207688_10127144 3300025901 Bacteria 1491
78 Ga0207699_10406338 3300025906 Bacteria 970
79 Ga0207645_10001438 3300025907 Bacteria 19492
80 Ga0207695_10084450 3300025913 Bacteria 3205
81 Ga0207693_10756497 3300025915 Bacteria 750
82 Ga0207681_10007562 3300025923 Bacteria 6659
83 Ga0207681_10669419 3300025923 Bacteria 861
84 Ga0207650_10019777 3300025925 Bacteria 4737
85 Ga0207650_10138865 3300025925 Bacteria 1909
86 Ga0207650_10764313 3300025925 Bacteria 818
87 Ga0207659_10243733 3300025926 Bacteria 1455
88 Ga0207700_10135306 3300025928 Bacteria 2018
89 Ga0207644_10102422 3300025931 Bacteria 2153
90 Ga0207644_10874313 3300025931 Bacteria 753
91 Ga0207709_10453265 3300025935 Bacteria 992
92 Ga0207669_10093082 3300025937 Bacteria 1968
93 Ga0207704_10037869 3300025938 Bacteria 2790
94 Ga0207665_10020562 3300025939 Bacteria 4338
95 Ga0207691_11256841 3300025940 Bacteria 612
96 Ga0207711_10079069 3300025941 Bacteria 2870
97 Ga0207711_10099567 3300025941 Bacteria 2570
98 Ga0207711_10176464 3300025941 Bacteria 1941
99 Ga0207711_11812826 3300025941 Bacteria 553
100 Ga0207689_10174401 3300025942 Bacteria 1773
101 Ga0207689_10235592 3300025942 Bacteria 1513
102 Ga0207651_10846553 3300025960 Bacteria 812
103 Ga0207668_10000487 3300025972 Bacteria 24894
104 Ga0207668_10027131 3300025972 Bacteria 3729
105 Ga0207668_10281661 3300025972 Bacteria 1364
106 Ga0207640_10018020 3300025981 Bacteria 4143
107 Ga0207640_10103135 3300025981 Bacteria 2005
108 Ga0207640_10895100 3300025981 Bacteria 775
109 Ga0207658_10011538 3300025986 Bacteria 6014
110 Ga0207658_10997242 3300025986 Bacteria 764
111 Ga0207678_10078577 3300026067 Bacteria 2826
112 Ga0207678_10352663 3300026067 Bacteria 1269
113 Ga0207678_10405556 3300026067 Bacteria 1181
114 Ga0207648_10013250 3300026089 Bacteria 7681
115 Ga0207648_10048603 3300026089 Bacteria 3713
116 Ga0207648_10663344 3300026089 Bacteria 964
117 Ga0207676_10374827 3300026095 Bacteria 1323
118 Ga0207675_100288083 3300026118 Bacteria 1597
119 Ga0207675_101101835 3300026118 Bacteria 814
120 Ga0207683_10186685 3300026121 Bacteria 1881
121 Ga0207698_10262274 3300026142 Bacteria 1588
122 Ga0209982_1010866 3300027552 Bacteria 1353
123 Ga0209971_1086677 3300027682 Bacteria 763
124 Ga0209974_10003037 3300027876 Bacteria 6067
125 Ga0268266_10011844 3300028379 Bacteria 7557
126 Ga0268265_10051887 3300028380 Bacteria 3098
127 Ga0268264_10130908 3300028381 Bacteria 2224
128 Ga0268264_11199403 3300028381 Bacteria 768
129 Ga0307408_100010384 3300031548 Bacteria 6139
130 Ga0307408_100069893 3300031548 Bacteria 2591
131 Ga0307516_10070763 3300031730 Bacteria 3351
132 Ga0307405_10131397 3300031731 Bacteria 1731
133 Ga0307405_10227596 3300031731 Bacteria 1372
134 Ga0307405_10323040 3300031731 Bacteria 1180
135 Ga0307405_10747964 3300031731 Bacteria 814
136 Ga0307413_10003226 3300031824 Bacteria 6826
137 Ga0307413_10571489 3300031824 Bacteria 920
138 Ga0307410_10042657 3300031852 Bacteria 3000
139 Ga0307410_10081016 3300031852 Bacteria 2279
140 Ga0307407_10019567 3300031903 Bacteria 3450
141 Ga0307412_10706507 3300031911 Bacteria 866
142 Ga0307412_11108181 3300031911 Unclassified 705
143 Ga0307412_11260929 3300031911 Unclassified 664
144 Ga0307409_100014640 3300031995 Bacteria 5112
145 Ga0307409_100066956 3300031995 Bacteria 2834
146 Ga0307409_100724322 3300031995 Bacteria 996
147 Ga0307416_100021461 3300032002 Bacteria 4637
148 Ga0307416_100809117 3300032002 Bacteria 1033
149 Ga0307414_10057026 3300032004 Bacteria 2743
150 Ga0307414_10092555 3300032004 Bacteria 2251
151 Ga0307414_10202379 3300032004 Bacteria 1616
152 Ga0307411_10225660 3300032005 Bacteria 1456
153 Ga0307411_10313428 3300032005 Bacteria 1264
154 Ga0307411_11053164 3300032005 Bacteria 731
155 Ga0373947_0312193 3300035725 Bacteria 1050
156 Ga0395899_0055228 3300037312 Bacteria 2938
157 Ga0395900_0002071 3300037418 Bacteria 22508
158 Ga0395900_0014775 3300037418 Bacteria 7957
159 Ga0395900_0134235 3300037418 Bacteria 2535
160 Ga0395900_0415360 3300037418 Bacteria 1307
161 Ga0395898_0238742 3300037466 Bacteria 1733
162 Ga0395898_0349301 3300037466 Bacteria 1410
163 Ga0395898_0350209 3300037466 Bacteria 1408
164 Ga0395905_0046680 3300037471 Bacteria 4061
165 Ga0395905_0113192 3300037471 Bacteria 2549
166 Ga0395901_0009995 3300038443 Bacteria 9615
167 Ga0395901_0083712 3300038443 Bacteria 3334
168 Ga0436363_1712800 3300039450 Bacteria 1965
169 Ga0439465_0081166 3300041413 Bacteria 1100
170 Ga0439432_218617 3300042006 Bacteria 550
171 Ga0439464_0001497 3300042439 Bacteria 5519
172 Ga0466969_0005310 3300044656 Bacteria 6855
173 Ga0466966_0006895 3300044684 Bacteria 7526
174 Ga0466966_0008080 3300044684 Bacteria 6973
175 Ga0466966_0099037 3300044684 Bacteria 1804
176 Ga0466961_0017682 3300044693 Bacteria 4580
177 Ga0466961_0164357 3300044693 Bacteria 1382
178 Ga0466961_0424489 3300044693 Bacteria 806
179 Ga0466963_0003186 3300044694 Bacteria 9321
180 Ga0466971_0005915 3300044719 Bacteria 5319
181 Ga0466970_0001157 3300044765 Bacteria 12784
182 Ga0466957_0008224 3300044842 Bacteria 5926
183 Ga0466959_0030727 3300045049 Bacteria 3976
184 Ga0466959_0051100 3300045049 Bacteria 3033
185 Ga0466958_0004855 3300045836 Bacteria 7158
186 Ga0466967_0291327 3300045976 Bacteria 1568
187 Ga0466967_0812279 3300045976 Bacteria 929
188 Ga0466967_2186030 3300045976 Unclassified 549
189 Ga0495668_0019568 3300046616 Bacteria 3900
190 Ga0495669_0013343 3300046684 Bacteria 3500
191 Ga0495669_0105252 3300046684 Bacteria 1313
192 Ga0496107_0282417 3300048910 Bacteria 1236
193 Ga0496108_0006534 3300048911 Bacteria 9455
194 Ga0496109_1024830 3300048912 Bacteria 763
195 Ga0496109_1075126 3300048912 Bacteria 742
196 Ga0496110_0192444 3300048913 Bacteria 1852
197 Ga0496114_0018860 3300048917 Bacteria 5586
198 Ga0501075_0607831 3300049591 Unclassified 834
199 Ga0500555_001700 3300053103 Bacteria 6624
200 Ga0466962_0029871 3300061719 Bacteria 2609
201 Ga0530510_0011659 3300061734 Bacteria 6168
202 Ga0500658_0000108
203 Ga0070658_10090033
204 Ga0070676_10028360
205 Ga0070670_100019107
206 Ga0070670_100162261
207 Ga0068869_100491752
208 Ga0070680_100326493
209 Ga0070660_100829577
210 Ga0070661_100068731
211 Ga0070661_100363994
212 Ga0070668_100019423
213 Ga0070668_100038266
214 Ga0070668_100395706
215 Ga0070669_100046286
216 Ga0070669_100773972
217 Ga0070675_100326602
218 Ga0070671_100052191
219 Ga0070671_100237101
220 Ga0070671_101885252
221 Ga0070674_100126063
222 Ga0070659_100216626
223 Ga0070659_101019084
224 Ga0070667_100062259
225 Ga0070667_100086057
226 Ga0070667_101395019
227 Ga0070709_10102586
228 Ga0070714_100027531
229 Ga0070714_100447340
230 Ga0070663_100161871
231 Ga0070663_100411319
232 Ga0070678_100208480
233 Ga0070678_100693106
234 Ga0070662_101300636
235 Ga0070662_101474538
236 Ga0068867_100014484
237 Ga0068867_100111587
238 Ga0068853_100471373
239 Ga0070696_100052606
240 Ga0070665_100015884
241 Ga0068854_100025032
242 Ga0068854_100736145
243 Ga0068859_100092000
244 Ga0068859_100514032
245 Ga0068864_100243759
246 Ga0068866_10076038
247 Ga0068861_100282135
248 Ga0068861_100630239
249 Ga0068851_10026779
250 Ga0068851_10168949
251 Ga0068858_100380263
252 Ga0068860_100049059
253 Ga0068860_100229789
254 Ga0068862_100037404
255 Ga0081539_10032922
256 Ga0070712_101178088
257 Ga0097621_100221724
258 Ga0068865_100175192
259 Ga0097620_100092001
260 Ga0097620_100514002
261 Ga0105240_10117316
262 Ga0105243_10525046
263 Ga0105242_11547825
264 Ga0105248_10159737
265 Ga0105248_10452358
266 Ga0105238_10343110
267 Ga0105249_10641094
268 Ga0157370_10009365
269 Ga0157370_10252582
270 Ga0157370_10391497
271 Ga0157369_10590722
272 Ga0157372_10277318
273 Ga0157375_10195322
274 Ga0163163_10270275
275 Ga0163161_10196675
276 Ga0207697_10022884
277 Ga0207656_10021427
278 Ga0207688_10127144
279 Ga0207699_10406338
280 Ga0207645_10001438
281 Ga0207695_10084450
282 Ga0207693_10756497
283 Ga0207681_10007562
284 Ga0207681_10669419
285 Ga0207650_10019777
286 Ga0207650_10138865
287 Ga0207650_10764313
288 Ga0207659_10243733
289 Ga0207700_10135306
290 Ga0207644_10102422
291 Ga0207644_10874313
292 Ga0207709_10453265
293 Ga0207669_10093082
294 Ga0207704_10037869
295 Ga0207665_10020562
296 Ga0207691_11256841
297 Ga0207711_10079069
298 Ga0207711_10099567
299 Ga0207711_10176464
300 Ga0207711_11812826
301 Ga0207689_10174401
302 Ga0207689_10235592
303 Ga0207651_10846553
304 Ga0207668_10000487
305 Ga0207668_10027131
306 Ga0207668_10281661
307 Ga0207640_10018020
308 Ga0207640_10103135
309 Ga0207640_10895100
310 Ga0207658_10011538
311 Ga0207658_10997242
312 Ga0207678_10078577
313 Ga0207678_10352663
314 Ga0207678_10405556
315 Ga0207648_10013250
316 Ga0207648_10048603
317 Ga0207648_10663344
318 Ga0207676_10374827
319 Ga0207675_100288083
320 Ga0207675_101101835
321 Ga0207683_10186685
322 Ga0207698_10262274
323 Ga0209982_1010866
324 Ga0209971_1086677
325 Ga0209974_10003037
326 Ga0268266_10011844
327 Ga0268265_10051887
328 Ga0268264_10130908
329 Ga0268264_11199403
330 Ga0307408_100010384
331 Ga0307408_100069893
332 Ga0307516_10070763
333 Ga0307405_10131397
334 Ga0307405_10227596
335 Ga0307405_10323040
336 Ga0307405_10747964
337 Ga0307413_10003226
338 Ga0307413_10571489
339 Ga0307410_10042657
340 Ga0307410_10081016
341 Ga0307407_10019567
342 Ga0307412_10706507
343 Ga0307412_11108181
344 Ga0307412_11260929
345 Ga0307409_100014640
346 Ga0307409_100066956
347 Ga0307409_100724322
348 Ga0307416_100021461
349 Ga0307416_100809117
350 Ga0307414_10057026
351 Ga0307414_10092555
352 Ga0307414_10202379
353 Ga0307411_10225660
354 Ga0307411_10313428
355 Ga0307411_11053164
356 Ga0373947_0312193
357 Ga0395899_0055228
358 Ga0395900_0002071
359 Ga0395900_0014775
360 Ga0395900_0134235
361 Ga0395900_0415360
362 Ga0395898_0238742
363 Ga0395898_0349301
364 Ga0395898_0350209
365 Ga0395905_0046680
366 Ga0395905_0113192
367 Ga0395901_0009995
368 Ga0395901_0083712
369 Ga0436363_1712800
370 Ga0439465_0081166
371 Ga0439432_218617
372 Ga0439464_0001497
373 Ga0466969_0005310
374 Ga0466966_0006895
375 Ga0466966_0008080
376 Ga0466966_0099037
377 Ga0466961_0017682
378 Ga0466961_0164357
379 Ga0466961_0424489
380 Ga0466963_0003186
381 Ga0466971_0005915
382 Ga0466970_0001157
383 Ga0466957_0008224
384 Ga0466959_0030727
385 Ga0466959_0051100
386 Ga0466958_0004855
387 Ga0466967_0291327
388 Ga0466967_0812279
389 Ga0466967_2186030
390 Ga0495668_0019568
391 Ga0495669_0013343
392 Ga0495669_0105252
393 Ga0496107_0282417
394 Ga0496108_0006534
395 Ga0496109_1024830
396 Ga0496109_1075126
397 Ga0496110_0192444
398 Ga0496114_0018860
399 Ga0501075_0607831
400 Ga0500555_001700
401 Ga0466962_0029871
402 Ga0530510_0011659

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05239

PRC

PRC-barrel domain

110

178

0.95

PF01782

RimM

RimM N-terminal domain

27

104

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dog-assembly1.cif.gz_A solution structure of the n-terminal domain of rimm from thermus thermophilus hb8 0.8498 9 95
3a1p-assembly2.cif.gz_C structure of ribosome maturation protein rimm and ribosomal protein s19 0.8457 9 162
2dog-assembly1.cif.gz_A solution structure of the n-terminal domain of rimm from thermus thermophilus hb8 0.8321 9 95
3a1p-assembly2.cif.gz_C structure of ribosome maturation protein rimm and ribosomal protein s19 0.8078 9 162
7cq1-assembly1.cif.gz_A solution structure of the c-terminal domain of mycobacterium tuberculosis ribosome maturation factor protein rimm 0.7474 98 162
ID Description Score Start End Superfamily
3a1pC02 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.9002 95 161 2.30.30.240
2f1lA01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;RimM 0.8913 9 93 2.40.30.60
3a1pC01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;RimM 0.8903 9 94 2.40.30.60
3a1pC01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;RimM 0.8804 9 94 2.40.30.60
af_P0A7X6_101_182_2.30.30.240 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.8752 94 161 2.30.30.240
ID Description Score Start End GO Terms
AF-A0A7G9L5P4-F1-model_v4 Ribosome maturation factor RimM 0.9394 8 166 GO:0005737
GO:0005840
GO:0006364
GO:0042274
GO:0043022
AF-A0A7G9L5P4-F1-model_v4 Ribosome maturation factor RimM 0.9283 8 166 GO:0005737
GO:0005840
GO:0006364
GO:0042274
GO:0043022
AF-A0A0E9MNR2-F1-model_v4 Ribosome maturation factor RimM 0.9281 6 166 GO:0005737
GO:0005840
GO:0006364
GO:0042274
GO:0043022
AF-A0A7W9F1E1-F1-model_v4 Ribosome maturation factor RimM 0.9273 7 163 GO:0005737
GO:0005840
GO:0006364
GO:0042274
GO:0043022
AF-A0A7W7ADM9-F1-model_v4 Ribosome maturation factor RimM 0.9271 9 166 GO:0005737
GO:0005840
GO:0006364
GO:0042274
GO:0043022

Map