F308882

General Info

Members Datasets Scaffolds Average Seq Length
201 124 402 157

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0056726|Ga0466967_0056726_1557_2060
Length 167
Sequence MEIVVRAVIVFVFLWGITRITGKATLGELSTFQLLLYVTMGDLIQQGVTQQDYSLTAATLAVSVFAVLTTVLSVVNFRWPRLRPLVHGAPVVVVSDGEVLHDALKSERLSMDDLYEAAREQGIRRIAQVELAVLEADGKVSFFQRQDESGDRSGSDDDARERPRAGE

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
9 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
12 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
13 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
14 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
18 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
19 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
20 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
21 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
22 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
23 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
24 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
25 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
26 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
46 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
47 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
48 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
49 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
50 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
51 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
52 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
53 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
54 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
55 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
56 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
57 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
58 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
59 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
60 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
61 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
62 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
63 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
64 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
65 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
66 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
67 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
68 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
69 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
70 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
71 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
72 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
73 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
74 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
75 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
76 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
77 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
78 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
79 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
80 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
81 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
82 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
83 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
84 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
85 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
86 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
87 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
101 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
102 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
103 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
104 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
105 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
106 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
107 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
108 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
109 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
110 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
111 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
112 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
113 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
114 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
115 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
118 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
119 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
120 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
121 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
122 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
123 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
124 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.49
Nodule 0
Rhizoplane 7.96
Rhizosphere 86.57
Stem 0
Stem Tuber 0
Unclassified 9.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0056726 3300045976 Bacteria 3455
2 JGI25405J52794_10010357 3300003911 Bacteria 1772
3 Ga0070666_10002562 3300005335 Bacteria 10985
4 Ga0070682_101541317 3300005337 Bacteria 573
5 Ga0070668_100138990 3300005347 Bacteria 1956
6 Ga0070671_100044344 3300005355 Bacteria 3696
7 Ga0070667_100003950 3300005367 Bacteria 12584
8 Ga0070665_100005632 3300005548 Bacteria 12882
9 Ga0068855_100047386 3300005563 Bacteria 5078
10 Ga0068856_100044854 3300005614 Bacteria 4351
11 Ga0068852_100002846 3300005616 Bacteria 11998
12 Ga0068852_100904342 3300005616 Bacteria 900
13 Ga0068859_100003277 3300005617 Bacteria 16469
14 Ga0068864_101758741 3300005618 Bacteria 625
15 Ga0068860_100000067 3300005843 Bacteria 180176
16 Ga0081455_10000064 3300005937 Bacteria 115735
17 Ga0081455_10144054 3300005937 Unclassified 1846
18 Ga0081455_10287034 3300005937 Bacteria 1186
19 Ga0081539_10172148 3300005985 Bacteria 1023
20 Ga0081539_10285417 3300005985 Unclassified 716
21 Ga0097620_100003277 3300006931 Bacteria 16469
22 Ga0105240_10707139 3300009093 Bacteria 1099
23 Ga0105247_10002901 3300009101 Bacteria 11420
24 Ga0105247_10124416 3300009101 Bacteria 1674
25 Ga0105241_10081856 3300009174 Bacteria 2530
26 Ga0105241_10430462 3300009174 Bacteria 1163
27 Ga0105237_10282053 3300009545 Bacteria 1664
28 Ga0105237_10557923 3300009545 Bacteria 1152
29 Ga0105249_10039673 3300009553 Bacteria 4275
30 Ga0105249_10554752 3300009553 Bacteria 1200
31 Ga0105239_10211141 3300010375 Bacteria 2176
32 Ga0105239_10961402 3300010375 Bacteria 981
33 Ga0163162_11579221 3300013306 Bacteria 748
34 Ga0163162_12898894 3300013306 Bacteria 552
35 Ga0157379_10016846 3300014968 Bacteria 6432
36 Ga0207680_10007314 3300025903 Bacteria 5375
37 Ga0207647_10079242 3300025904 Bacteria 1972
38 Ga0207647_10419429 3300025904 Bacteria 753
39 Ga0207654_10062126 3300025911 Bacteria 2187
40 Ga0207695_10696109 3300025913 Bacteria 897
41 Ga0207671_10343422 3300025914 Bacteria 1183
42 Ga0207671_10549258 3300025914 Bacteria 921
43 Ga0207694_10211115 3300025924 Bacteria 1581
44 Ga0207644_10001667 3300025931 Bacteria 14304
45 Ga0207644_10074005 3300025931 Bacteria 2499
46 Ga0207711_10812983 3300025941 Bacteria 870
47 Ga0207667_10030718 3300025949 Bacteria 5807
48 Ga0207667_10034119 3300025949 Bacteria 5467
49 Ga0207712_10340852 3300025961 Unclassified 1243
50 Ga0207668_10085497 3300025972 Bacteria 2302
51 Ga0207668_10174996 3300025972 Unclassified 1687
52 Ga0207658_10006649 3300025986 Bacteria 7875
53 Ga0207703_10007914 3300026035 Bacteria 8406
54 Ga0207639_10834880 3300026041 Bacteria 860
55 Ga0207702_10025003 3300026078 Bacteria 4953
56 Ga0207641_10002071 3300026088 Bacteria 19015
57 Ga0207698_10001924 3300026142 Bacteria 12176
58 Ga0268266_10001247 3300028379 Bacteria 31089
59 Ga0268264_10000114 3300028381 Bacteria 203211
60 Ga0307408_100517162 3300031548 Bacteria 1048
61 Ga0307415_100413986 3300032126 Bacteria 1155
62 Ga0395899_0325348 3300037312 Bacteria 1034
63 Ga0395900_0130019 3300037418 Bacteria 2581
64 Ga0395900_0562419 3300037418 Bacteria 1084
65 Ga0395900_1111915 3300037418 Bacteria 707
66 Ga0395898_0096448 3300037466 Bacteria 2841
67 Ga0395898_0439331 3300037466 Bacteria 1243
68 Ga0395905_0563771 3300037471 Bacteria 1040
69 Ga0395901_0103432 3300038443 Bacteria 2988
70 Ga0439465_0180910 3300041413 Bacteria 763
71 Ga0451797_1525913 3300041453 Bacteria 1003
72 Ga0451797_1558970 3300041453 Unclassified 583
73 Ga0451795_1549572 3300041456 Bacteria 720
74 Ga0451841_1080614 3300041498 Bacteria 989
75 Ga0451845_0901118 3300041501 Bacteria 729
76 Ga0451843_0969349 3300041509 Bacteria 759
77 Ga0439434_0078212 3300042435 Bacteria 1047
78 Ga0466972_0041188 3300044658 Bacteria 2249
79 Ga0466972_0276768 3300044658 Bacteria 784
80 Ga0466965_0047015 3300044683 Bacteria 2137
81 Ga0466961_0014249 3300044693 Bacteria 5103
82 Ga0466961_0417584 3300044693 Unclassified 813
83 Ga0466963_0004178 3300044694 Bacteria 8360
84 Ga0466963_0044682 3300044694 Bacteria 2916
85 Ga0466963_0853635 3300044694 Unclassified 642
86 Ga0466964_0002343 3300044706 Bacteria 6725
87 Ga0466964_0019111 3300044706 Bacteria 2632
88 Ga0466964_0409252 3300044706 Unclassified 710
89 Ga0466971_0022924 3300044719 Bacteria 2783
90 Ga0466971_0164327 3300044719 Bacteria 1040
91 Ga0466971_0281002 3300044719 Bacteria 797
92 Ga0466968_0225393 3300044735 Unclassified 884
93 Ga0466970_0100596 3300044765 Bacteria 1574
94 Ga0466970_0150227 3300044765 Bacteria 1286
95 Ga0466970_0161156 3300044765 Bacteria 1241
96 Ga0466970_0184333 3300044765 Bacteria 1159
97 Ga0466957_0008273 3300044842 Bacteria 5912
98 Ga0466957_0085014 3300044842 Bacteria 1975
99 Ga0466957_0515402 3300044842 Bacteria 830
100 Ga0466957_0696282 3300044842 Bacteria 717
101 Ga0466960_0011056 3300044901 Bacteria 3761
102 Ga0466960_0019016 3300044901 Bacteria 3019
103 Ga0466959_0209821 3300045049 Bacteria 1354
104 Ga0466959_0249337 3300045049 Bacteria 1225
105 Ga0466958_0004978 3300045836 Bacteria 7088
106 Ga0466958_0234467 3300045836 Bacteria 1172
107 Ga0466958_0517276 3300045836 Unclassified 775
108 Ga0466967_0000736 3300045976 Bacteria 16786
109 Ga0466967_0043185 3300045976 Bacteria 3902
110 Ga0466967_0377827 3300045976 Bacteria 1375
111 Ga0466967_0847988 3300045976 Bacteria 908
112 Ga0466967_1356497 3300045976 Bacteria 708
113 Ga0466967_1428904 3300045976 Bacteria 689
114 Ga0466967_1874315 3300045976 Bacteria 596
115 Ga0495584_0335968 3300046491 Bacteria 767
116 Ga0495637_0273418 3300046520 Bacteria 604
117 Ga0495669_0006240 3300046684 Bacteria 4974
118 Ga0496101_0119283 3300048904 Bacteria 1993
119 Ga0496101_1593843 3300048904 Unclassified 507
120 Ga0496102_0000818 3300048905 Bacteria 30275
121 Ga0496102_0269018 3300048905 Bacteria 1607
122 Ga0496103_0000313 3300048906 Bacteria 44848
123 Ga0496104_0498546 3300048907 Bacteria 1129
124 Ga0496104_1227119 3300048907 Bacteria 653
125 Ga0496105_0586316 3300048908 Bacteria 867
126 Ga0496109_0039687 3300048912 Bacteria 4262
127 Ga0496109_1126876 3300048912 Bacteria 722
128 Ga0496111_0954785 3300048914 Bacteria 616
129 Ga0496114_0514258 3300048917 Unclassified 1059
130 Ga0496115_0414873 3300048918 Bacteria 1091
131 Ga0496118_0065329 3300048921 Bacteria 2663
132 Ga0496119_0064961 3300048922 Bacteria 2164
133 Ga0496121_0401165 3300048924 Unclassified 898
134 Ga0496126_0001416 3300048929 Bacteria 37926
135 Ga0496126_0081487 3300048929 Bacteria 2861
136 Ga0501031_0082370 3300049568 Unclassified 2097
137 Ga0501032_0033440 3300049569 Bacteria 3523
138 Ga0501033_0094927 3300049570 Bacteria 2180
139 Ga0501033_0549783 3300049570 Unclassified 795
140 Ga0501034_0221558 3300049571 Bacteria 1844
141 Ga0501034_0825807 3300049571 Bacteria 818
142 Ga0501036_1626061 3300049572 Bacteria 521
143 Ga0501038_0095103 3300049574 Bacteria 2489
144 Ga0501039_0004265 3300049575 Bacteria 10768
145 Ga0501039_0011408 3300049575 Bacteria 6765
146 Ga0501040_0008355 3300049576 Bacteria 6730
147 Ga0501040_0409949 3300049576 Unclassified 973
148 Ga0501041_0008407 3300049577 Bacteria 6069
149 Ga0501041_0010450 3300049577 Bacteria 5469
150 Ga0501042_0002391 3300049578 Bacteria 11504
151 Ga0501042_0012932 3300049578 Bacteria 5669
152 Ga0501046_0031901 3300049580 Bacteria 4269
153 Ga0501047_0000168 3300049581 Bacteria 80293
154 Ga0501048_0009202 3300049582 Bacteria 7422
155 Ga0501048_0011553 3300049582 Bacteria 6584
156 Ga0501067_0048986 3300049583 Bacteria 2342
157 Ga0501068_0046441 3300049584 Bacteria 2619
158 Ga0501068_0133342 3300049584 Unclassified 1554
159 Ga0501069_0045845 3300049585 Bacteria 2423
160 Ga0501069_0272622 3300049585 Bacteria 989
161 Ga0501069_0580281 3300049585 Bacteria 672
162 Ga0501070_0047458 3300049586 Bacteria 3569
163 Ga0501070_0098460 3300049586 Bacteria 2419
164 Ga0501071_0009760 3300049587 Bacteria 6404
165 Ga0501072_0010953 3300049588 Bacteria 6914
166 Ga0501072_0034965 3300049588 Bacteria 3938
167 Ga0501073_0073332 3300049589 Bacteria 2384
168 Ga0501073_0435759 3300049589 Unclassified 906
169 Ga0501074_0011342 3300049590 Bacteria 6476
170 Ga0501075_0013711 3300049591 Bacteria 5792
171 Ga0501075_0080698 3300049591 Bacteria 2462
172 Ga0501076_0002923 3300049592 Bacteria 11845
173 Ga0501077_0027616 3300049593 Bacteria 3603
174 Ga0501077_0044541 3300049593 Bacteria 2818
175 Ga0501079_0007261 3300049741 Bacteria 8365
176 Ga0501080_0173877 3300049742 Bacteria 1985
177 Ga0501080_0850900 3300049742 Bacteria 797
178 Ga0501081_0005035 3300049743 Bacteria 8504
179 Ga0501081_0023679 3300049743 Bacteria 4117
180 Ga0501083_0060872 3300049744 Bacteria 2522
181 Ga0501035_0093776 3300049822 Unclassified 2641
182 Ga0501035_0178209 3300049822 Bacteria 1832
183 Ga0501044_0288269 3300049823 Bacteria 1574
184 Ga0501045_0004045 3300049824 Bacteria 10113
185 nmdc:mga0yw44_602215_c1 3300050492 Bacteria 746
186 Ga0500568_0000094 3300053139 Bacteria 83123
187 Ga0500616_0007330 3300053153 Bacteria 7032
188 Ga0501084_0047744 3300054114 Bacteria 3585
189 Ga0501084_0837049 3300054114 Bacteria 774
190 Ga0501082_0016338 3300060353 Bacteria 6389
191 Ga0501082_0041621 3300060353 Bacteria 3961
192 Ga0501082_0712916 3300060353 Bacteria 878
193 Ga0501082_1492511 3300060353 Bacteria 590
194 Ga0466962_0021613 3300061719 Bacteria 3088
195 Ga0466962_0038740 3300061719 Bacteria 2283
196 Ga0466962_0049116 3300061719 Bacteria 2017
197 Ga0466962_0307081 3300061719 Bacteria 785
198 Ga0466962_0387008 3300061719 Bacteria 699
199 Ga0530510_0007335 3300061734 Bacteria 7675
200 Ga0530510_0013061 3300061734 Bacteria 5841
201 Ga0530510_0652311 3300061734 Bacteria 801
202 Ga0466967_0056726
203 JGI25405J52794_10010357
204 Ga0070666_10002562
205 Ga0070682_101541317
206 Ga0070668_100138990
207 Ga0070671_100044344
208 Ga0070667_100003950
209 Ga0070665_100005632
210 Ga0068855_100047386
211 Ga0068856_100044854
212 Ga0068852_100002846
213 Ga0068852_100904342
214 Ga0068859_100003277
215 Ga0068864_101758741
216 Ga0068860_100000067
217 Ga0081455_10000064
218 Ga0081455_10144054
219 Ga0081455_10287034
220 Ga0081539_10172148
221 Ga0081539_10285417
222 Ga0097620_100003277
223 Ga0105240_10707139
224 Ga0105247_10002901
225 Ga0105247_10124416
226 Ga0105241_10081856
227 Ga0105241_10430462
228 Ga0105237_10282053
229 Ga0105237_10557923
230 Ga0105249_10039673
231 Ga0105249_10554752
232 Ga0105239_10211141
233 Ga0105239_10961402
234 Ga0163162_11579221
235 Ga0163162_12898894
236 Ga0157379_10016846
237 Ga0207680_10007314
238 Ga0207647_10079242
239 Ga0207647_10419429
240 Ga0207654_10062126
241 Ga0207695_10696109
242 Ga0207671_10343422
243 Ga0207671_10549258
244 Ga0207694_10211115
245 Ga0207644_10001667
246 Ga0207644_10074005
247 Ga0207711_10812983
248 Ga0207667_10030718
249 Ga0207667_10034119
250 Ga0207712_10340852
251 Ga0207668_10085497
252 Ga0207668_10174996
253 Ga0207658_10006649
254 Ga0207703_10007914
255 Ga0207639_10834880
256 Ga0207702_10025003
257 Ga0207641_10002071
258 Ga0207698_10001924
259 Ga0268266_10001247
260 Ga0268264_10000114
261 Ga0307408_100517162
262 Ga0307415_100413986
263 Ga0395899_0325348
264 Ga0395900_0130019
265 Ga0395900_0562419
266 Ga0395900_1111915
267 Ga0395898_0096448
268 Ga0395898_0439331
269 Ga0395905_0563771
270 Ga0395901_0103432
271 Ga0439465_0180910
272 Ga0451797_1525913
273 Ga0451797_1558970
274 Ga0451795_1549572
275 Ga0451841_1080614
276 Ga0451845_0901118
277 Ga0451843_0969349
278 Ga0439434_0078212
279 Ga0466972_0041188
280 Ga0466972_0276768
281 Ga0466965_0047015
282 Ga0466961_0014249
283 Ga0466961_0417584
284 Ga0466963_0004178
285 Ga0466963_0044682
286 Ga0466963_0853635
287 Ga0466964_0002343
288 Ga0466964_0019111
289 Ga0466964_0409252
290 Ga0466971_0022924
291 Ga0466971_0164327
292 Ga0466971_0281002
293 Ga0466968_0225393
294 Ga0466970_0100596
295 Ga0466970_0150227
296 Ga0466970_0161156
297 Ga0466970_0184333
298 Ga0466957_0008273
299 Ga0466957_0085014
300 Ga0466957_0515402
301 Ga0466957_0696282
302 Ga0466960_0011056
303 Ga0466960_0019016
304 Ga0466959_0209821
305 Ga0466959_0249337
306 Ga0466958_0004978
307 Ga0466958_0234467
308 Ga0466958_0517276
309 Ga0466967_0000736
310 Ga0466967_0043185
311 Ga0466967_0377827
312 Ga0466967_0847988
313 Ga0466967_1356497
314 Ga0466967_1428904
315 Ga0466967_1874315
316 Ga0495584_0335968
317 Ga0495637_0273418
318 Ga0495669_0006240
319 Ga0496101_0119283
320 Ga0496101_1593843
321 Ga0496102_0000818
322 Ga0496102_0269018
323 Ga0496103_0000313
324 Ga0496104_0498546
325 Ga0496104_1227119
326 Ga0496105_0586316
327 Ga0496109_0039687
328 Ga0496109_1126876
329 Ga0496111_0954785
330 Ga0496114_0514258
331 Ga0496115_0414873
332 Ga0496118_0065329
333 Ga0496119_0064961
334 Ga0496121_0401165
335 Ga0496126_0001416
336 Ga0496126_0081487
337 Ga0501031_0082370
338 Ga0501032_0033440
339 Ga0501033_0094927
340 Ga0501033_0549783
341 Ga0501034_0221558
342 Ga0501034_0825807
343 Ga0501036_1626061
344 Ga0501038_0095103
345 Ga0501039_0004265
346 Ga0501039_0011408
347 Ga0501040_0008355
348 Ga0501040_0409949
349 Ga0501041_0008407
350 Ga0501041_0010450
351 Ga0501042_0002391
352 Ga0501042_0012932
353 Ga0501046_0031901
354 Ga0501047_0000168
355 Ga0501048_0009202
356 Ga0501048_0011553
357 Ga0501067_0048986
358 Ga0501068_0046441
359 Ga0501068_0133342
360 Ga0501069_0045845
361 Ga0501069_0272622
362 Ga0501069_0580281
363 Ga0501070_0047458
364 Ga0501070_0098460
365 Ga0501071_0009760
366 Ga0501072_0010953
367 Ga0501072_0034965
368 Ga0501073_0073332
369 Ga0501073_0435759
370 Ga0501074_0011342
371 Ga0501075_0013711
372 Ga0501075_0080698
373 Ga0501076_0002923
374 Ga0501077_0027616
375 Ga0501077_0044541
376 Ga0501079_0007261
377 Ga0501080_0173877
378 Ga0501080_0850900
379 Ga0501081_0005035
380 Ga0501081_0023679
381 Ga0501083_0060872
382 Ga0501035_0093776
383 Ga0501035_0178209
384 Ga0501044_0288269
385 Ga0501045_0004045
386 nmdc:mga0yw44_602215_c1
387 Ga0500568_0000094
388 Ga0500616_0007330
389 Ga0501084_0047744
390 Ga0501084_0837049
391 Ga0501082_0016338
392 Ga0501082_0041621
393 Ga0501082_0712916
394 Ga0501082_1492511
395 Ga0466962_0021613
396 Ga0466962_0038740
397 Ga0466962_0049116
398 Ga0466962_0307081
399 Ga0466962_0387008
400 Ga0530510_0007335
401 Ga0530510_0013061
402 Ga0530510_0652311

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04239

DUF421

YetF C-terminal domain

77

160

0.95

Map