F308876

General Info

Members Datasets Scaffolds Average Seq Length
201 146 402 108

Family's Representative Sequence

Representative Sequence 3300044901|Ga0466960_0621302|Ga0466960_0621302_241_624
Length 127
Sequence VAAYRADRAWDALGDPSRRAILECLAERPRAVGELADALPISRPAVSQALAVLKAAGLVTDRAAGTRRIYRLDPAGVAALRDQLDTYWNRALAGFQDAVASPDARPADAPDVGEGHHGTEAPGQERP

Samples

Sample ID Description Type Environment
1 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
2 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
3 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
4 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
15 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
20 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
21 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
24 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
27 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
28 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
35 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
36 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
58 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
59 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
60 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
61 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
62 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
63 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
64 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
65 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
66 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
67 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
68 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
69 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
70 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
71 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
72 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
73 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
74 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
75 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
76 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
77 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
78 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
79 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
80 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
81 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
82 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
86 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
89 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
90 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
91 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
92 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
93 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
94 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
95 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
96 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
102 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
103 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
104 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
105 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
106 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
107 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
108 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
109 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
110 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
111 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
112 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
113 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
114 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
115 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
116 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
117 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
118 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
119 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
120 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
121 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
122 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
123 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
124 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
125 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
126 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
127 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
129 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
130 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
131 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
132 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
133 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
134 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
135 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
136 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
137 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
138 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
139 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
140 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
141 2501939600 Micromonospora sp. L5 Isolate Unclassified
142 2902582711 Micromonospora sp. AP08 Isolate Unclassified
143 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
144 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
145 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
146 649633069 Micromonospora sp. L5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.52
Metatranscriptomes 0.5
Isolates 2.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.98
Nodule 0
Rhizoplane 11.44
Rhizosphere 78.11
Stem 0
Stem Tuber 0
Unclassified 1.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466960_0621302 3300044901 Bacteria 643
2 Ga0070682_100434361 3300005337 Bacteria 1001
3 Ga0070671_102067957 3300005355 Bacteria 507
4 Ga0070688_100462898 3300005365 Bacteria 950
5 Ga0070659_101085040 3300005366 Bacteria 705
6 Ga0070667_100038263 3300005367 Bacteria 4022
7 Ga0070714_101164109 3300005435 Bacteria 752
8 Ga0070713_100050801 3300005436 Bacteria 3427
9 Ga0070710_10050160 3300005437 Bacteria 2338
10 Ga0070710_10115555 3300005437 Bacteria 1617
11 Ga0070678_101298914 3300005456 Bacteria 677
12 Ga0070693_100038569 3300005547 Bacteria 2671
13 Ga0070665_100181613 3300005548 Bacteria 2105
14 Ga0070665_100286932 3300005548 Bacteria 1648
15 Ga0068856_100193914 3300005614 Bacteria 2045
16 Ga0068852_102615769 3300005616 Bacteria 524
17 Ga0068864_102712955 3300005618 Bacteria 501
18 Ga0081455_10223712 3300005937 Bacteria 1393
19 Ga0081539_10000570 3300005985 Bacteria 76158
20 Ga0070717_10210403 3300006028 Bacteria 1706
21 Ga0070717_10270857 3300006028 Bacteria 1504
22 Ga0070717_10335095 3300006028 Bacteria 1350
23 Ga0070715_10018702 3300006163 Bacteria 2645
24 Ga0070716_100092177 3300006173 Bacteria 1836
25 Ga0070716_100284564 3300006173 Bacteria 1142
26 Ga0068871_101245183 3300006358 Bacteria 699
27 Ga0075430_100940394 3300006846 Unclassified 712
28 Ga0068865_101932568 3300006881 Bacteria 535
29 Ga0111539_11982163 3300009094 Bacteria 675
30 Ga0105245_10688922 3300009098 Bacteria 1054
31 Ga0105241_10554369 3300009174 Bacteria 1032
32 Ga0105242_10416993 3300009176 Bacteria 1257
33 Ga0105237_12702553 3300009545 Bacteria 507
34 Ga0105238_11941231 3300009551 Bacteria 622
35 Ga0157370_10215998 3300013104 Bacteria 1777
36 Ga0157369_10763909 3300013105 Bacteria 994
37 Ga0157372_10473486 3300013307 Bacteria 1460
38 Ga0163163_13258814 3300014325 Bacteria 506
39 Ga0157380_10629364 3300014326 Bacteria 1067
40 Ga0157379_10176716 3300014968 Bacteria 1928
41 Ga0224712_10528728 3300022467 Bacteria 572
42 Ga0207692_10003851 3300025898 Bacteria 5893
43 Ga0207692_10098356 3300025898 Bacteria 1601
44 Ga0207688_10997704 3300025901 Bacteria 529
45 Ga0207685_10000698 3300025905 Bacteria 6052
46 Ga0207685_10002213 3300025905 Bacteria 4397
47 Ga0207699_10011915 3300025906 Bacteria 4407
48 Ga0207699_10068129 3300025906 Bacteria 2166
49 Ga0207663_10009915 3300025916 Bacteria 5043
50 Ga0207663_10096671 3300025916 Bacteria 1973
51 Ga0207694_11567629 3300025924 Bacteria 555
52 Ga0207687_10147712 3300025927 Bacteria 1790
53 Ga0207700_10002824 3300025928 Bacteria 9996
54 Ga0207700_10015041 3300025928 Bacteria 5090
55 Ga0207700_10079004 3300025928 Bacteria 2561
56 Ga0207664_10003274 3300025929 Bacteria 10765
57 Ga0207704_11867309 3300025938 Bacteria 517
58 Ga0207711_10053959 3300025941 Bacteria 3448
59 Ga0207661_12149285 3300025944 Bacteria 504
60 Ga0207679_10953008 3300025945 Bacteria 786
61 Ga0207712_11513420 3300025961 Bacteria 601
62 Ga0207658_10041053 3300025986 Bacteria 3348
63 Ga0207641_10473788 3300026088 Bacteria 1213
64 Ga0207676_11616843 3300026095 Unclassified 646
65 Ga0207683_10206143 3300026121 Bacteria 1788
66 Ga0207683_10259476 3300026121 Bacteria 1587
67 Ga0207698_12096144 3300026142 Bacteria 579
68 Ga0268266_10337523 3300028379 Bacteria 1414
69 Ga0268266_10401095 3300028379 Bacteria 1297
70 Ga0307515_10051021 3300028794 Bacteria 6180
71 Ga0307515_10068153 3300028794 Bacteria 4894
72 Ga0307513_10380551 3300031456 Bacteria 1151
73 Ga0307516_10000809 3300031730 Bacteria 42907
74 Ga0307516_10023381 3300031730 Bacteria 6335
75 Ga0307405_10105614 3300031731 Bacteria 1898
76 Ga0307405_11117309 3300031731 Bacteria 678
77 Ga0307413_10427695 3300031824 Bacteria 1045
78 Ga0307413_11319959 3300031824 Unclassified 632
79 Ga0307413_11496811 3300031824 Bacteria 597
80 Ga0307410_10155631 3300031852 Bacteria 1707
81 Ga0307410_10512407 3300031852 Bacteria 989
82 Ga0307410_12025127 3300031852 Bacteria 514
83 Ga0307406_10152161 3300031901 Bacteria 1652
84 Ga0307406_10444976 3300031901 Unclassified 1038
85 Ga0307406_11442648 3300031901 Bacteria 604
86 Ga0307406_11476922 3300031901 Bacteria 598
87 Ga0307407_10077947 3300031903 Bacteria 1995
88 Ga0307407_10275552 3300031903 Bacteria 1163
89 Ga0307412_10968617 3300031911 Bacteria 750
90 Ga0307409_100420701 3300031995 Bacteria 1282
91 Ga0307409_102325483 3300031995 Bacteria 565
92 Ga0307416_100125996 3300032002 Bacteria 2294
93 Ga0307416_100190294 3300032002 Bacteria 1934
94 Ga0307416_100228409 3300032002 Bacteria 1792
95 Ga0307416_101057275 3300032002 Bacteria 916
96 Ga0307416_101990514 3300032002 Bacteria 684
97 Ga0307414_10311121 3300032004 Bacteria 1337
98 Ga0307415_100050083 3300032126 Bacteria 2828
99 Ga0307415_100142468 3300032126 Bacteria 1833
100 Ga0307415_100162166 3300032126 Bacteria 1734
101 Ga0307415_100225961 3300032126 Bacteria 1504
102 Ga0307415_100434677 3300032126 Bacteria 1130
103 Ga0307415_101062240 3300032126 Bacteria 756
104 Ga0307415_101084767 3300032126 Bacteria 749
105 Ga0307415_101869050 3300032126 Bacteria 582
106 Ga0373930_0008509 3300034816 Bacteria 1796
107 Ga0373958_0160743 3300034819 Bacteria 568
108 Ga0373959_0050633 3300034820 Bacteria 896
109 Ga0373938_0009289 3300034957 Bacteria 1778
110 Ga0373929_0022842 3300035085 Bacteria 1280
111 Ga0373949_0018037 3300035090 Bacteria 1596
112 Ga0373951_0006001 3300035091 Bacteria 2799
113 Ga0373952_0027785 3300035092 Bacteria 1237
114 Ga0373960_0007507 3300035121 Bacteria 2585
115 Ga0373960_0340400 3300035121 Bacteria 567
116 Ga0373962_0030221 3300035242 Bacteria 1481
117 Ga0373931_0184850 3300035691 Bacteria 1236
118 Ga0373931_0242263 3300035691 Bacteria 1093
119 Ga0373935_0007361 3300035692 Bacteria 6583
120 Ga0373937_0872692 3300036401 Bacteria 848
121 Ga0395899_0634740 3300037312 Bacteria 677
122 Ga0395900_0190597 3300037418 Bacteria 2080
123 Ga0395898_0036458 3300037466 Bacteria 4883
124 Ga0436364_0627893 3300037853 Bacteria 1018
125 Ga0395901_0219557 3300038443 Bacteria 1987
126 Ga0451791_1902408 3300041451 Bacteria 719
127 Ga0451800_0746960 3300041459 Bacteria 544
128 Ga0451853_2275082 3300041512 Bacteria 560
129 Ga0439459_0028888 3300042438 Bacteria 1116
130 Ga0439464_0121051 3300042439 Bacteria 806
131 Ga0466969_0205963 3300044656 Bacteria 897
132 Ga0466966_0440603 3300044684 Bacteria 783
133 Ga0466963_0415551 3300044694 Bacteria 949
134 Ga0466963_1108648 3300044694 Bacteria 557
135 Ga0466971_0085456 3300044719 Bacteria 1442
136 Ga0466957_0848067 3300044842 Bacteria 651
137 Ga0466959_0154394 3300045049 Bacteria 1616
138 Ga0466958_0207492 3300045836 Bacteria 1248
139 Ga0466958_0632833 3300045836 Bacteria 696
140 Ga0466958_0786884 3300045836 Bacteria 620
141 Ga0466967_0016493 3300045976 Bacteria 5828
142 Ga0466967_0026626 3300045976 Bacteria 4793
143 Ga0466967_0044611 3300045976 Bacteria 3847
144 Ga0466967_1819320 3300045976 Bacteria 606
145 Ga0495592_0110589 3300046454 Bacteria 1945
146 Ga0495638_0065390 3300046460 Bacteria 2238
147 Ga0495651_0009358 3300046462 Bacteria 7521
148 Ga0495594_0080864 3300046499 Bacteria 1814
149 Ga0495618_0288716 3300046514 Bacteria 1021
150 Ga0495628_0065580 3300046516 Bacteria 2839
151 Ga0495632_0034545 3300046519 Bacteria 2587
152 Ga0495652_0002490 3300046529 Bacteria 18913
153 Ga0495652_0594850 3300046529 Bacteria 755
154 Ga0495645_0198055 3300046543 Bacteria 1364
155 Ga0495667_0760479 3300046559 Bacteria 599
156 Ga0495646_0017938 3300046680 Bacteria 4484
157 Ga0495600_0328288 3300046809 Bacteria 961
158 Ga0495680_0453991 3300047322 Bacteria 877
159 Ga0496100_0828221 3300048903 Bacteria 725
160 Ga0496101_0019899 3300048904 Bacteria 4590
161 Ga0496101_0950052 3300048904 Bacteria 676
162 Ga0496102_0022783 3300048905 Bacteria 5552
163 Ga0496104_0089612 3300048907 Bacteria 2938
164 Ga0496104_0294122 3300048907 Bacteria 1536
165 Ga0496104_1166178 3300048907 Bacteria 674
166 Ga0496104_1558294 3300048907 Bacteria 563
167 Ga0496105_0006899 3300048908 Bacteria 8742
168 Ga0496105_0197178 3300048908 Bacteria 1644
169 Ga0496105_0886187 3300048908 Bacteria 673
170 Ga0496106_0120615 3300048909 Bacteria 2049
171 Ga0496107_0150530 3300048910 Bacteria 1721
172 Ga0496109_0851365 3300048912 Bacteria 850
173 Ga0496111_0538804 3300048914 Bacteria 857
174 Ga0496112_0013343 3300048915 Bacteria 7583
175 Ga0496112_0332750 3300048915 Bacteria 1462
176 Ga0496113_0140271 3300048916 Bacteria 1901
177 Ga0496113_1304167 3300048916 Bacteria 564
178 Ga0496114_0074456 3300048917 Bacteria 2858
179 Ga0496115_0008346 3300048918 Bacteria 7663
180 Ga0501034_0206444 3300049571 Bacteria 1921
181 Ga0501069_0393993 3300049585 Bacteria 819
182 nmdc:mga0yw44_1129522_c1 3300050492 Bacteria 529
183 Ga0495601_0000138 3300053077 Bacteria 41055
184 Ga0495601_0011693 3300053077 Bacteria 5259
185 Ga0495612_0026527 3300053078 Bacteria 2328
186 Ga0495612_0081463 3300053078 Bacteria 1360
187 Ga0495619_0053217 3300053085 Bacteria 2677
188 Ga0500644_0088013 3300053088 Bacteria 1156
189 Ga0500646_0084781 3300053090 Bacteria 972
190 Ga0500569_128746 3300053109 Bacteria 846
191 Ga0500594_0034363 3300053118 Bacteria 1354
192 Ga0500577_0486351 3300053142 Bacteria 539
193 Ga0500588_0354403 3300053146 Bacteria 558
194 Ga0500600_0084424 3300053149 Bacteria 1709
195 Ga0530510_0406956 3300061734 Bacteria 1026
196 2501944698 2501939600 Bacteria 6907073
197 2902582896 2902582711 Bacteria 6187705
198 2929230684 2929226422 Bacteria 7248583
199 2996222367 2996221748 Bacteria 6799777
200 3003001284 3002998708 Bacteria 11715108
201 649811125 649633069 Bacteria 6962533
202 Ga0466960_0621302
203 Ga0070682_100434361
204 Ga0070671_102067957
205 Ga0070688_100462898
206 Ga0070659_101085040
207 Ga0070667_100038263
208 Ga0070714_101164109
209 Ga0070713_100050801
210 Ga0070710_10050160
211 Ga0070710_10115555
212 Ga0070678_101298914
213 Ga0070693_100038569
214 Ga0070665_100181613
215 Ga0070665_100286932
216 Ga0068856_100193914
217 Ga0068852_102615769
218 Ga0068864_102712955
219 Ga0081455_10223712
220 Ga0081539_10000570
221 Ga0070717_10210403
222 Ga0070717_10270857
223 Ga0070717_10335095
224 Ga0070715_10018702
225 Ga0070716_100092177
226 Ga0070716_100284564
227 Ga0068871_101245183
228 Ga0075430_100940394
229 Ga0068865_101932568
230 Ga0111539_11982163
231 Ga0105245_10688922
232 Ga0105241_10554369
233 Ga0105242_10416993
234 Ga0105237_12702553
235 Ga0105238_11941231
236 Ga0157370_10215998
237 Ga0157369_10763909
238 Ga0157372_10473486
239 Ga0163163_13258814
240 Ga0157380_10629364
241 Ga0157379_10176716
242 Ga0224712_10528728
243 Ga0207692_10003851
244 Ga0207692_10098356
245 Ga0207688_10997704
246 Ga0207685_10000698
247 Ga0207685_10002213
248 Ga0207699_10011915
249 Ga0207699_10068129
250 Ga0207663_10009915
251 Ga0207663_10096671
252 Ga0207694_11567629
253 Ga0207687_10147712
254 Ga0207700_10002824
255 Ga0207700_10015041
256 Ga0207700_10079004
257 Ga0207664_10003274
258 Ga0207704_11867309
259 Ga0207711_10053959
260 Ga0207661_12149285
261 Ga0207679_10953008
262 Ga0207712_11513420
263 Ga0207658_10041053
264 Ga0207641_10473788
265 Ga0207676_11616843
266 Ga0207683_10206143
267 Ga0207683_10259476
268 Ga0207698_12096144
269 Ga0268266_10337523
270 Ga0268266_10401095
271 Ga0307515_10051021
272 Ga0307515_10068153
273 Ga0307513_10380551
274 Ga0307516_10000809
275 Ga0307516_10023381
276 Ga0307405_10105614
277 Ga0307405_11117309
278 Ga0307413_10427695
279 Ga0307413_11319959
280 Ga0307413_11496811
281 Ga0307410_10155631
282 Ga0307410_10512407
283 Ga0307410_12025127
284 Ga0307406_10152161
285 Ga0307406_10444976
286 Ga0307406_11442648
287 Ga0307406_11476922
288 Ga0307407_10077947
289 Ga0307407_10275552
290 Ga0307412_10968617
291 Ga0307409_100420701
292 Ga0307409_102325483
293 Ga0307416_100125996
294 Ga0307416_100190294
295 Ga0307416_100228409
296 Ga0307416_101057275
297 Ga0307416_101990514
298 Ga0307414_10311121
299 Ga0307415_100050083
300 Ga0307415_100142468
301 Ga0307415_100162166
302 Ga0307415_100225961
303 Ga0307415_100434677
304 Ga0307415_101062240
305 Ga0307415_101084767
306 Ga0307415_101869050
307 Ga0373930_0008509
308 Ga0373958_0160743
309 Ga0373959_0050633
310 Ga0373938_0009289
311 Ga0373929_0022842
312 Ga0373949_0018037
313 Ga0373951_0006001
314 Ga0373952_0027785
315 Ga0373960_0007507
316 Ga0373960_0340400
317 Ga0373962_0030221
318 Ga0373931_0184850
319 Ga0373931_0242263
320 Ga0373935_0007361
321 Ga0373937_0872692
322 Ga0395899_0634740
323 Ga0395900_0190597
324 Ga0395898_0036458
325 Ga0436364_0627893
326 Ga0395901_0219557
327 Ga0451791_1902408
328 Ga0451800_0746960
329 Ga0451853_2275082
330 Ga0439459_0028888
331 Ga0439464_0121051
332 Ga0466969_0205963
333 Ga0466966_0440603
334 Ga0466963_0415551
335 Ga0466963_1108648
336 Ga0466971_0085456
337 Ga0466957_0848067
338 Ga0466959_0154394
339 Ga0466958_0207492
340 Ga0466958_0632833
341 Ga0466958_0786884
342 Ga0466967_0016493
343 Ga0466967_0026626
344 Ga0466967_0044611
345 Ga0466967_1819320
346 Ga0495592_0110589
347 Ga0495638_0065390
348 Ga0495651_0009358
349 Ga0495594_0080864
350 Ga0495618_0288716
351 Ga0495628_0065580
352 Ga0495632_0034545
353 Ga0495652_0002490
354 Ga0495652_0594850
355 Ga0495645_0198055
356 Ga0495667_0760479
357 Ga0495646_0017938
358 Ga0495600_0328288
359 Ga0495680_0453991
360 Ga0496100_0828221
361 Ga0496101_0019899
362 Ga0496101_0950052
363 Ga0496102_0022783
364 Ga0496104_0089612
365 Ga0496104_0294122
366 Ga0496104_1166178
367 Ga0496104_1558294
368 Ga0496105_0006899
369 Ga0496105_0197178
370 Ga0496105_0886187
371 Ga0496106_0120615
372 Ga0496107_0150530
373 Ga0496109_0851365
374 Ga0496111_0538804
375 Ga0496112_0013343
376 Ga0496112_0332750
377 Ga0496113_0140271
378 Ga0496113_1304167
379 Ga0496114_0074456
380 Ga0496115_0008346
381 Ga0501034_0206444
382 Ga0501069_0393993
383 nmdc:mga0yw44_1129522_c1
384 Ga0495601_0000138
385 Ga0495601_0011693
386 Ga0495612_0026527
387 Ga0495612_0081463
388 Ga0495619_0053217
389 Ga0500644_0088013
390 Ga0500646_0084781
391 Ga0500569_128746
392 Ga0500594_0034363
393 Ga0500577_0486351
394 Ga0500588_0354403
395 Ga0500600_0084424
396 Ga0530510_0406956
397 2501944698
398 2902582896
399 2929230684
400 2996222367
401 3003001284
402 649811125

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

15

61

0.98

PF12840

HTH_20

Helix-turn-helix domain

13

62

0.97

PF09339

HTH_IclR

IclR helix-turn-helix domain

20

63

0.96

PF12802

MarR_2

MarR family

15

69

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9604 17 72
4lb5-assembly1.cif.gz_B crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9446 18 71
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.9432 17 71
7ne9-assembly1.cif.gz_CCC a single sensor controls large variations in zinc quotas in a marine cyanobacterium 0.9379 14 71
5zup-assembly1.cif.gz_A crystal structure of bz junction in diverse sequence 0.9353 29 72
ID Description Score Start End Superfamily
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9728 14 70 1.10.10.10
af_Q58793_322_389_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9713 12 71 1.10.10.10
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9604 17 72 1.10.10.10
4lb5B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9446 18 71 1.10.10.10
5j6xB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9432 17 71 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7X8FPS3-F1-model_v4 Winged helix-turn-helix transcriptional regulator 0.9723 4 88 GO:0003700
AF-A0A6M1MB64-F1-model_v4 Winged helix-turn-helix transcriptional regulator 0.9703 3 95 GO:0003700
AF-A0A7C6FGQ4-F1-model_v4 Winged helix-turn-helix transcriptional regulator 0.9686 2 89 GO:0003700
AF-A0A525D6U6-F1-model_v4 ArsR family transcriptional regulator 0.9673 4 79 GO:0003700
AF-A0A5A9ZWG5-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9672 5 86 GO:0003700

Map