F308564

General Info

Members Datasets Scaffolds Average Seq Length
201 152 402 350

Family's Representative Sequence

Representative Sequence 3300025284|Ga0209130_1000148|Ga0209130_100014880
Length 349
Sequence MSIHAANFRELKLDRLCRDFGTHNAVKDVSLTIRQGEFIALLGPSGCGKSTTLNLLAGLLPATGGGIWLDEKRIDPLRPEERGFGMVFQSYALFPHMSVRKNIGFGLKMRGIAKAESDRRVAEAVAMVRLQGQEDKLPGQLSGGQQQRVAIARAIAVQPPLVLMDEPLSNLDAKLRLEMRAEIRRIHNTLGATTVYVTHDQRIVVMRDGQIRQVGGPEDLFSRPDHLDVAEFMGFRNKVAGRVASVAGEQATVTVGEVDVAGRVRSPVAAGQGAHISIRPEDLHPVADGASGLKAKVVSTEFHGREFVGFARMADDTPLTFLAESRIAPGTEIRLAAAPDRVLVFGGGA

Samples

Sample ID Description Type Environment
1 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
18 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
21 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
22 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
29 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
30 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
31 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
32 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
33 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
34 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
35 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
36 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
37 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
52 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
53 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
54 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
55 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
56 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
57 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
58 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
59 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
60 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
61 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
62 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
63 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
64 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
65 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
66 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
67 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
68 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
69 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
70 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
71 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
72 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
73 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
74 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
75 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
76 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
77 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
78 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
79 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
80 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
90 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
91 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
92 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
93 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
94 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
95 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
96 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
97 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
98 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
99 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
100 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
101 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
102 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
103 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
104 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
105 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
106 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
107 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
108 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
109 2508501050 Microvirga lupini Lut6 Isolate Nodule
110 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
111 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
112 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
113 2534681786 Brucella suis 92/29 Isolate Unclassified
114 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
115 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
116 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
117 2643221733 Bosea sp. Root381 Isolate Unclassified
118 2643221734 Bosea sp. Root670 Isolate Unclassified
119 2643221736 Bosea sp. Root483D1 Isolate Unclassified
120 2751185800 Brucella pituitosa AA2 Isolate Unclassified
121 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
122 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
123 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
124 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
125 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
126 2818991467 Bosea vestrisii 3192 Isolate Unclassified
127 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
128 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
129 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
130 2841760612 Bosea sp. Tri-49 Isolate Nodule
131 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
132 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
133 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
134 2844104063 Bosea sp. Tri-39 Isolate Nodule
135 2851182111 Bosea sp. Tri-44 Isolate Nodule
136 2851246043 Bosea sp. Tri-54 Isolate Nodule
137 2854911287 Brucella lupini LUP21 Isolate Unclassified
138 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
139 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
140 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
141 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
142 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
143 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
144 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
145 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
146 2932401849 Devosia sp. 2618 Isolate Rhizosphere
147 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
148 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
149 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
150 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
151 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
152 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 78.11
Metatranscriptomes 0
Isolates 21.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.94
Nodule 5.97
Rhizoplane 0.5
Rhizosphere 68.16
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209130_1000148 3300025284 Bacteria 109763
2 JGI25159J45721_1002954 3300002987 Bacteria 6186
3 JGI25151J46595_10000040 3300003187 Bacteria 176750
4 Ga0055526_1000216 3300003771 Bacteria 49843
5 Ga0055526_1001693 3300003771 Bacteria 15409
6 Ga0055524_1000023 3300003775 Bacteria 221408
7 Ga0065165_1000139 3300005262 Bacteria 126209
8 Ga0065165_1003097 3300005262 Bacteria 12383
9 Ga0070660_100076201 3300005339 Bacteria 2627
10 Ga0070661_100001193 3300005344 Bacteria 18336
11 Ga0070668_100416975 3300005347 Bacteria 1149
12 Ga0070659_100031437 3300005366 Bacteria 4111
13 Ga0070681_10144287 3300005458 Bacteria 2310
14 Ga0068853_100000840 3300005539 Bacteria 21448
15 Ga0068855_100007729 3300005563 Bacteria 12985
16 Ga0068855_100060029 3300005563 Bacteria 4448
17 Ga0068854_100008132 3300005578 Bacteria 6729
18 Ga0068856_100048037 3300005614 Bacteria 4205
19 Ga0068852_100023174 3300005616 Bacteria 4992
20 Ga0068852_100025084 3300005616 Bacteria 4826
21 Ga0068852_100093876 3300005616 Bacteria 2690
22 Ga0068851_10002009 3300005834 Bacteria 8964
23 Ga0081540_1002724 3300005983 Bacteria 14381
24 Ga0081539_10124349 3300005985 Bacteria 1276
25 Ga0075364_10032489 3300006051 Bacteria 3355
26 Ga0075366_10141686 3300006195 Bacteria 1454
27 Ga0075370_10020890 3300006353 Bacteria 3584
28 Ga0105240_10110986 3300009093 Bacteria 3318
29 Ga0105243_10101624 3300009148 Bacteria 2388
30 Ga0105238_10068085 3300009551 Bacteria 3561
31 Ga0105238_10104844 3300009551 Bacteria 2808
32 Ga0105239_10031987 3300010375 Bacteria 5781
33 Ga0105239_10064329 3300010375 Bacteria 4027
34 Ga0157370_10018611 3300013104 Bacteria 6983
35 Ga0171462_1073 3300013250 Bacteria 8246
36 Ga0157380_10030489 3300014326 Bacteria 4131
37 Ga0182005_1001320 3300015265 Bacteria 10136
38 Ga0209675_1002169 3300025291 Bacteria 10338
39 Ga0209025_1000016 3300025294 Bacteria 770739
40 Ga0209025_1012145 3300025294 Bacteria 5563
41 Ga0209025_1013892 3300025294 Bacteria 5015
42 Ga0209564_1000075 3300025295 Bacteria 285760
43 Ga0209564_1000076 3300025295 Bacteria 283602
44 Ga0209758_1024789 3300025297 Bacteria 2659
45 Ga0209256_1000083 3300025299 Bacteria 221460
46 Ga0209256_1000359 3300025299 Bacteria 74498
47 Ga0207426_1007938 3300025302 Bacteria 4373
48 Ga0207656_10002402 3300025321 Bacteria 6303
49 Ga0207705_10115870 3300025909 Bacteria 1983
50 Ga0207707_10083784 3300025912 Bacteria 2784
51 Ga0207695_10034259 3300025913 Bacteria 5526
52 Ga0207695_10087439 3300025913 Bacteria 3139
53 Ga0207657_10023192 3300025919 Bacteria 5784
54 Ga0207657_10028892 3300025919 Bacteria 5052
55 Ga0207657_10056839 3300025919 Bacteria 3374
56 Ga0207649_10047287 3300025920 Bacteria 2647
57 Ga0207649_10059127 3300025920 Bacteria 2404
58 Ga0207652_10108224 3300025921 Bacteria 2463
59 Ga0207694_10008057 3300025924 Bacteria 7970
60 Ga0207694_10017676 3300025924 Bacteria 5390
61 Ga0207667_10008389 3300025949 Bacteria 12278
62 Ga0207667_10046697 3300025949 Bacteria 4586
63 Ga0207667_10192145 3300025949 Bacteria 2095
64 Ga0207668_10411970 3300025972 Bacteria 1145
65 Ga0207640_10019880 3300025981 Bacteria 3977
66 Ga0207639_10001963 3300026041 Bacteria 13822
67 Ga0207702_10009766 3300026078 Bacteria 8054
68 Ga0207702_10012431 3300026078 Bacteria 7085
69 Ga0207702_10098478 3300026078 Bacteria 2576
70 Ga0207698_10011473 3300026142 Bacteria 5750
71 Ga0207698_10032288 3300026142 Bacteria 3791
72 Ga0207698_10038340 3300026142 Bacteria 3540
73 Ga0265318_10007282 3300028577 Bacteria 5017
74 Ga0265314_10090892 3300031711 Bacteria 1988
75 Ga0265342_10000687 3300031712 Bacteria 35389
76 Ga0307410_10142621 3300031852 Bacteria 1774
77 Ga0307406_10054020 3300031901 Bacteria 2562
78 Ga0307406_10133232 3300031901 Bacteria 1748
79 Ga0307407_10022233 3300031903 Bacteria 3286
80 Ga0307414_10163895 3300032004 Bacteria 1769
81 Ga0307415_100027042 3300032126 Bacteria 3629
82 Ga0373943_0113414 3300035170 Bacteria 1432
83 Ga0373927_0014370 3300035695 Bacteria 5242
84 Ga0373937_0010664 3300036401 Bacteria 8035
85 Ga0395900_0158465 3300037418 Bacteria 2310
86 Ga0395898_0207300 3300037466 Bacteria 1870
87 Ga0395901_0157046 3300038443 Bacteria 2389
88 Ga0395901_0396354 3300038443 Bacteria 1418
89 Ga0466972_0000382 3300044658 Bacteria 23692
90 Ga0466965_0034797 3300044683 Bacteria 2466
91 Ga0466960_0014149 3300044901 Bacteria 3407
92 Ga0495653_0106379 3300046463 Bacteria 2023
93 Ga0495640_0044158 3300046533 Bacteria 3100
94 Ga0495587_0046640 3300046536 Bacteria 2571
95 Ga0495657_0072763 3300046675 Bacteria 2241
96 Ga0495658_0047561 3300046683 Bacteria 2416
97 Ga0495680_0034789 3300047322 Bacteria 4064
98 Ga0495684_0122571 3300047471 Bacteria 1957
99 Ga0496117_0060196 3300048920 Bacteria 2619
100 Ga0496119_0003028 3300048922 Bacteria 17790
101 Ga0496122_0045562 3300048925 Bacteria 3407
102 Ga0496122_0067803 3300048925 Bacteria 2567
103 Ga0496123_0030041 3300048926 Bacteria 3985
104 Ga0496126_0107837 3300048929 Bacteria 2429
105 Ga0501033_0149691 3300049570 Bacteria 1684
106 Ga0501034_0029502 3300049571 Bacteria 5576
107 Ga0501034_0073110 3300049571 Bacteria 3437
108 Ga0501034_0093073 3300049571 Bacteria 3010
109 Ga0501034_0111210 3300049571 Bacteria 2730
110 Ga0501034_0234454 3300049571 Bacteria 1783
111 Ga0501036_0017495 3300049572 Bacteria 5993
112 Ga0501037_0012221 3300049573 Bacteria 6319
113 Ga0501038_0004987 3300049574 Bacteria 12332
114 Ga0501039_0052043 3300049575 Bacteria 3168
115 Ga0501043_0065421 3300049579 Bacteria 2855
116 Ga0501046_0179354 3300049580 Bacteria 1585
117 Ga0501047_0022327 3300049581 Bacteria 6079
118 Ga0501047_0209519 3300049581 Bacteria 1808
119 Ga0501067_0010717 3300049583 Bacteria 5071
120 Ga0501069_0026497 3300049585 Bacteria 3174
121 Ga0501069_0030194 3300049585 Bacteria 2976
122 Ga0501070_0002811 3300049586 Bacteria 15192
123 Ga0501070_0106240 3300049586 Bacteria 2320
124 Ga0501070_0138390 3300049586 Bacteria 2010
125 Ga0501072_0116053 3300049588 Bacteria 2132
126 Ga0501073_0001733 3300049589 Bacteria 16214
127 Ga0501073_0110571 3300049589 Bacteria 1906
128 Ga0501073_0114315 3300049589 Bacteria 1871
129 Ga0501074_0003043 3300049590 Bacteria 11819
130 Ga0501076_0084545 3300049592 Bacteria 2549
131 Ga0501076_0287186 3300049592 Bacteria 1348
132 Ga0501077_0019036 3300049593 Bacteria 4341
133 Ga0501077_0050846 3300049593 Bacteria 2634
134 Ga0501238_002361 3300049671 Bacteria 2248
135 Ga0501080_0014229 3300049742 Bacteria 7325
136 Ga0501080_0223413 3300049742 Bacteria 1723
137 Ga0501083_0000105 3300049744 Bacteria 56997
138 Ga0501083_0004374 3300049744 Bacteria 9955
139 Ga0501083_0022408 3300049744 Bacteria 4384
140 Ga0501044_0006496 3300049823 Bacteria 12918
141 Ga0501044_0066843 3300049823 Bacteria 3664
142 Ga0501044_0465781 3300049823 Bacteria 1168
143 nmdc:mga0sz30_55955_c1 3300050516 Bacteria 1679
144 Ga0495601_0004567 3300053077 Bacteria 8007
145 Ga0495595_0001657 3300053084 Bacteria 8708
146 Ga0495619_0000048 3300053085 Bacteria 102117
147 Ga0500616_0000294 3300053153 Bacteria 72551
148 Ga0500622_0004828 3300053156 Bacteria 8270
149 Ga0501084_0001717 3300054114 Bacteria 17403
150 Ga0501084_0010663 3300054114 Bacteria 7606
151 Ga0501084_0018160 3300054114 Bacteria 5856
152 Ga0501084_0150000 3300054114 Bacteria 1965
153 Ga0501084_0198186 3300054114 Bacteria 1694
154 Ga0501084_0240928 3300054114 Bacteria 1527
155 Ga0501082_0001282 3300060353 Bacteria 22071
156 Ga0501082_0003674 3300060353 Bacteria 13411
157 Ga0501082_0033430 3300060353 Bacteria 4437
158 2508732980 2508501050 Bacteria 9633614
159 2509078757 2508501114 Bacteria 7082538
160 2511391969 2511231027 Bacteria 5013807
161 2513591942 2513237087 Bacteria 5817514
162 2535486757 2534681786 Bacteria 3308809
163 2643775402 2643221551 Bacteria 3750538
164 2643793848 2643221555 Bacteria 3749717
165 2643837094 2643221564 Bacteria 4193379
166 2644727655 2643221733 Bacteria 5690728
167 2644733471 2643221734 Bacteria 5365412
168 2644744651 2643221736 Bacteria 6608466
169 2753360548 2751185800 Bacteria 5467370
170 2758642988 2758568016 Bacteria 5645291
171 2770196426 2767802442 Bacteria 5747986
172 2776260033 2775506901 Bacteria 9631051
173 2776269437 2775506902 Bacteria 6208009
174 2776282367 2775506904 Bacteria 5954060
175 2819717278 2818991467 Bacteria 5893227
176 2835319256 2835312727 Bacteria 7413381
177 2839993493 2839993093 Bacteria 5512535
178 2840766503 2840764183 Bacteria 6358399
179 2841763133 2841760612 Bacteria 6454112
180 2841915968 2841911363 Bacteria 6173697
181 2841921652 2841917233 Bacteria 6173500
182 2842875082 2842871566 Bacteria 4827117
183 2844108997 2844104063 Bacteria 6440972
184 2851182374 2851182111 Bacteria 6047226
185 2851251104 2851246043 Bacteria 6439203
186 2854913366 2854911287 Bacteria 5582813
187 2881670043 2881665667 Bacteria 8175609
188 2894242793 2894232714 Bacteria 8834183
189 2894653541 2894652903 Bacteria 4587256
190 2904579860 2904578770 Bacteria 5302906
191 2915653827 2915650412 Bacteria 4288180
192 2917701237 2917699015 Bacteria 7043791
193 2919120470 2919119836 Bacteria 5208557
194 2928522627 2928521798 Bacteria 4960112
195 2932405146 2932401849 Bacteria 4262978
196 2939674177 2939669807 Bacteria 5028511
197 2954013992 2954011201 Bacteria 4762601
198 2996314635 2996310559 Bacteria 6357320
199 3002141845 3002141150 Bacteria 5254435
200 3003672264 3003665799 Bacteria 7279786
201 8057534947 8057529695 Bacteria 6306553
202 Ga0209130_1000148
203 JGI25159J45721_1002954
204 JGI25151J46595_10000040
205 Ga0055526_1000216
206 Ga0055526_1001693
207 Ga0055524_1000023
208 Ga0065165_1000139
209 Ga0065165_1003097
210 Ga0070660_100076201
211 Ga0070661_100001193
212 Ga0070668_100416975
213 Ga0070659_100031437
214 Ga0070681_10144287
215 Ga0068853_100000840
216 Ga0068855_100007729
217 Ga0068855_100060029
218 Ga0068854_100008132
219 Ga0068856_100048037
220 Ga0068852_100023174
221 Ga0068852_100025084
222 Ga0068852_100093876
223 Ga0068851_10002009
224 Ga0081540_1002724
225 Ga0081539_10124349
226 Ga0075364_10032489
227 Ga0075366_10141686
228 Ga0075370_10020890
229 Ga0105240_10110986
230 Ga0105243_10101624
231 Ga0105238_10068085
232 Ga0105238_10104844
233 Ga0105239_10031987
234 Ga0105239_10064329
235 Ga0157370_10018611
236 Ga0171462_1073
237 Ga0157380_10030489
238 Ga0182005_1001320
239 Ga0209675_1002169
240 Ga0209025_1000016
241 Ga0209025_1012145
242 Ga0209025_1013892
243 Ga0209564_1000075
244 Ga0209564_1000076
245 Ga0209758_1024789
246 Ga0209256_1000083
247 Ga0209256_1000359
248 Ga0207426_1007938
249 Ga0207656_10002402
250 Ga0207705_10115870
251 Ga0207707_10083784
252 Ga0207695_10034259
253 Ga0207695_10087439
254 Ga0207657_10023192
255 Ga0207657_10028892
256 Ga0207657_10056839
257 Ga0207649_10047287
258 Ga0207649_10059127
259 Ga0207652_10108224
260 Ga0207694_10008057
261 Ga0207694_10017676
262 Ga0207667_10008389
263 Ga0207667_10046697
264 Ga0207667_10192145
265 Ga0207668_10411970
266 Ga0207640_10019880
267 Ga0207639_10001963
268 Ga0207702_10009766
269 Ga0207702_10012431
270 Ga0207702_10098478
271 Ga0207698_10011473
272 Ga0207698_10032288
273 Ga0207698_10038340
274 Ga0265318_10007282
275 Ga0265314_10090892
276 Ga0265342_10000687
277 Ga0307410_10142621
278 Ga0307406_10054020
279 Ga0307406_10133232
280 Ga0307407_10022233
281 Ga0307414_10163895
282 Ga0307415_100027042
283 Ga0373943_0113414
284 Ga0373927_0014370
285 Ga0373937_0010664
286 Ga0395900_0158465
287 Ga0395898_0207300
288 Ga0395901_0157046
289 Ga0395901_0396354
290 Ga0466972_0000382
291 Ga0466965_0034797
292 Ga0466960_0014149
293 Ga0495653_0106379
294 Ga0495640_0044158
295 Ga0495587_0046640
296 Ga0495657_0072763
297 Ga0495658_0047561
298 Ga0495680_0034789
299 Ga0495684_0122571
300 Ga0496117_0060196
301 Ga0496119_0003028
302 Ga0496122_0045562
303 Ga0496122_0067803
304 Ga0496123_0030041
305 Ga0496126_0107837
306 Ga0501033_0149691
307 Ga0501034_0029502
308 Ga0501034_0073110
309 Ga0501034_0093073
310 Ga0501034_0111210
311 Ga0501034_0234454
312 Ga0501036_0017495
313 Ga0501037_0012221
314 Ga0501038_0004987
315 Ga0501039_0052043
316 Ga0501043_0065421
317 Ga0501046_0179354
318 Ga0501047_0022327
319 Ga0501047_0209519
320 Ga0501067_0010717
321 Ga0501069_0026497
322 Ga0501069_0030194
323 Ga0501070_0002811
324 Ga0501070_0106240
325 Ga0501070_0138390
326 Ga0501072_0116053
327 Ga0501073_0001733
328 Ga0501073_0110571
329 Ga0501073_0114315
330 Ga0501074_0003043
331 Ga0501076_0084545
332 Ga0501076_0287186
333 Ga0501077_0019036
334 Ga0501077_0050846
335 Ga0501238_002361
336 Ga0501080_0014229
337 Ga0501080_0223413
338 Ga0501083_0000105
339 Ga0501083_0004374
340 Ga0501083_0022408
341 Ga0501044_0006496
342 Ga0501044_0066843
343 Ga0501044_0465781
344 nmdc:mga0sz30_55955_c1
345 Ga0495601_0004567
346 Ga0495595_0001657
347 Ga0495619_0000048
348 Ga0500616_0000294
349 Ga0500622_0004828
350 Ga0501084_0001717
351 Ga0501084_0010663
352 Ga0501084_0018160
353 Ga0501084_0150000
354 Ga0501084_0198186
355 Ga0501084_0240928
356 Ga0501082_0001282
357 Ga0501082_0003674
358 Ga0501082_0033430
359 2508732980
360 2509078757
361 2511391969
362 2513591942
363 2535486757
364 2643775402
365 2643793848
366 2643837094
367 2644727655
368 2644733471
369 2644744651
370 2753360548
371 2758642988
372 2770196426
373 2776260033
374 2776269437
375 2776282367
376 2819717278
377 2835319256
378 2839993493
379 2840766503
380 2841763133
381 2841915968
382 2841921652
383 2842875082
384 2844108997
385 2851182374
386 2851251104
387 2854913366
388 2881670043
389 2894242793
390 2894653541
391 2904579860
392 2915653827
393 2917701237
394 2919120470
395 2928522627
396 2932405146
397 2939674177
398 2954013992
399 2996314635
400 3002141845
401 3003672264
402 8057534947

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

26

169

0.98

PF08402

TOBE_2

TOBE domain

276

345

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9468 11 224
2onk-assembly1.cif.gz_B abc transporter modbc in complex with its binding protein moda 0.9437 11 245
4u00-assembly1.cif.gz_A crystal structure of ttha1159 in complex with adp 0.9415 11 241
4yms-assembly1.cif.gz_A crystal structure of an amino acid abc transporter 0.9413 11 241
7z17-assembly1.cif.gz_J e. coli c-p lyase bound to a phnk abc dimer in an open conformation 0.9381 11 241
ID Description Score Start End Superfamily
af_P33360_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.973 11 242 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9726 10 223 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9717 7 224 3.40.50.300
af_Q58762_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.969 11 243 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9673 7 224 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7J9YE84-F1-model_v4 ATP-binding cassette domain-containing protein 0.9896 10 228 GO:0005524
GO:0016887
GO:0055052
AF-A0A7J3BDG1-F1-model_v4 Molybdate/tungstate import ATP-binding protein WtpC (EC 7.3.2.6) 0.9861 10 232 GO:0005524
GO:0016887
AF-A0A519YL00-F1-model_v4 deleted 0.9848 11 240
AF-A0A0D6JVA7-F1-model_v4 Molybdate/tungstate import ATP-binding protein WtpC (EC 7.3.2.6) 0.9845 10 242 GO:0005524
GO:0016887
AF-A0A2N6DB41-F1-model_v4 Glycine betaine ABC transporter ATP-binding protein 0.9778 11 242 GO:0005524
GO:0016020
GO:0016887
GO:0031460

Map