F308299
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 201 | 167 | 168 | 260 |
Family's Representative Sequence
| Representative Sequence | 3300005841|Ga0068863_100046120|Ga0068863_1000461203 |
| Length | 295 |
| Sequence | MTDTPPPANAAMDELLTRITAGIVMAAIACAAAYYGSWPFRALVAIAAFIMLVEWCDMHKVARYWALVGGLVLAVVLLGGVQYFYPDAVPSPDDSLDVDDFLPALTAFAGIAGLGLLFGAATRRIAAGWGFVYLAVPSFALLVLSWAFVGLVFWVMVVTWATDIFAYFAGRAIGGPKLAPAISPNKTWAGLAGGVIGAGLAGWGMSALFDLGFPFQWIGAPMAVVAQAGDLYESWVKRRAGVKDSGTLLPGHGGVLDRLDGLMPVALATLLILVAGLWTPDADMSVSDDMGNQSQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 2 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 3 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 4 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 5 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 6 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 7 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 8 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 9 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 10 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 11 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 12 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 13 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 14 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 15 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 16 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 17 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 18 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 19 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 20 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 21 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 22 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 23 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 24 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 25 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 26 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 27 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 28 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 29 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 30 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 31 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 32 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 33 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 34 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 35 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 36 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 37 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 38 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 39 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 40 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 41 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 42 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 43 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 44 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 45 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 59 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 60 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 61 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 62 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 63 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 73 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 74 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 75 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 76 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 77 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 79 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 102 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 103 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 104 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 105 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 106 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 107 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 108 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 109 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 110 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 111 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 112 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 113 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 114 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 115 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 116 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 117 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 118 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 125 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 126 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 127 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 128 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 129 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 130 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 131 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 132 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 133 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 134 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 135 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 136 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 137 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 138 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 139 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 140 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 141 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 142 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 143 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 144 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 145 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 147 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 148 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 149 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 150 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 152 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 153 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 154 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 155 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 156 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 157 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 158 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 159 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 160 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 161 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 162 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 163 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 164 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 165 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 166 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 167 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.58 |
| Metatranscriptomes | 0 |
| Isolates | 16.42 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 26.37 |
| Nodule | 3.48 |
| Rhizoplane | 3.48 |
| Rhizosphere | 50.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10006295 | 3300001990 | Bacteria | 4061 |
| 2 | JGI24735J21928_10009855 | 3300002067 | Bacteria | 3059 |
| 3 | JGI25150J39212_1000315 | 3300002774 | Bacteria | 23966 |
| 4 | JGI25153J46596_10000248 | 3300003215 | Bacteria | 44326 |
| 5 | JGI25153J46596_10000266 | 3300003215 | Bacteria | 41550 |
| 6 | rootH1_10018614 | 3300003323 | Bacteria | 3836 |
| 7 | Ga0055526_1018727 | 3300003771 | Bacteria | 2567 |
| 8 | Ga0055537_1001143 | 3300003773 | Bacteria | 11386 |
| 9 | Ga0055530_10018261 | 3300003791 | Bacteria | 2169 |
| 10 | Ga0055530_10019821 | 3300003791 | Bacteria | 2028 |
| 11 | Ga0055540_1001964 | 3300003792 | Bacteria | 11494 |
| 12 | Ga0055531_10027014 | 3300003794 | Bacteria | 2028 |
| 13 | Ga0055531_10027021 | 3300003794 | Bacteria | 2028 |
| 14 | Ga0058692_1002465 | 3300003856 | Bacteria | 6189 |
| 15 | Ga0065165_1007405 | 3300005262 | Bacteria | 5405 |
| 16 | Ga0065165_1025857 | 3300005262 | Bacteria | 1942 |
| 17 | Ga0070660_100001005 | 3300005339 | Bacteria | 18942 |
| 18 | Ga0070668_100000111 | 3300005347 | Bacteria | 50557 |
| 19 | Ga0070675_100062375 | 3300005354 | Bacteria | 3080 |
| 20 | Ga0070671_100000136 | 3300005355 | Bacteria | 47367 |
| 21 | Ga0070667_100001473 | 3300005367 | Bacteria | 21102 |
| 22 | Ga0070662_100154097 | 3300005457 | Bacteria | 1792 |
| 23 | Ga0070665_100168769 | 3300005548 | Bacteria | 2190 |
| 24 | Ga0068855_100000857 | 3300005563 | Bacteria | 37732 |
| 25 | Ga0068857_100110804 | 3300005577 | Bacteria | 2467 |
| 26 | Ga0068854_100079693 | 3300005578 | Bacteria | 2415 |
| 27 | Ga0068859_100579978 | 3300005617 | Bacteria | 1215 |
| 28 | Ga0068863_100000171 | 3300005841 | Bacteria | 69589 |
| 29 | Ga0068863_100026708 | 3300005841 | Bacteria | 5505 |
| 30 | Ga0068863_100046120 | 3300005841 | Bacteria | 4136 |
| 31 | Ga0068860_100002081 | 3300005843 | Bacteria | 21102 |
| 32 | Ga0068860_100055416 | 3300005843 | Bacteria | 3769 |
| 33 | Ga0075365_10021302 | 3300006038 | Bacteria | 4041 |
| 34 | Ga0075368_10013381 | 3300006042 | Bacteria | 3012 |
| 35 | Ga0075363_100018372 | 3300006048 | Bacteria | 3483 |
| 36 | Ga0075362_10003014 | 3300006177 | Bacteria | 5791 |
| 37 | Ga0075369_10009390 | 3300006186 | Bacteria | 3798 |
| 38 | Ga0075369_10216297 | 3300006186 | Bacteria | 886 |
| 39 | Ga0097620_100579992 | 3300006931 | Bacteria | 1215 |
| 40 | Ga0105245_10025274 | 3300009098 | Bacteria | 5222 |
| 41 | Ga0105243_10013358 | 3300009148 | Bacteria | 6211 |
| 42 | Ga0105237_10010990 | 3300009545 | Bacteria | 9607 |
| 43 | Ga0105249_10001067 | 3300009553 | Bacteria | 24310 |
| 44 | Ga0157371_10000425 | 3300013102 | Bacteria | 51804 |
| 45 | Ga0157370_10003706 | 3300013104 | Bacteria | 17854 |
| 46 | Ga0157369_10194309 | 3300013105 | Bacteria | 2131 |
| 47 | Ga0157378_10538432 | 3300013297 | Bacteria | 1171 |
| 48 | Ga0183363_1004 | 3300015690 | Bacteria | 416766 |
| 49 | Ga0207425_1000026 | 3300025245 | Bacteria | 301303 |
| 50 | Ga0209129_1000834 | 3300025258 | Bacteria | 19378 |
| 51 | Ga0209565_1000240 | 3300025263 | Bacteria | 59106 |
| 52 | Ga0209673_1015906 | 3300025273 | Bacteria | 2834 |
| 53 | Ga0209025_1000744 | 3300025294 | Bacteria | 54885 |
| 54 | Ga0209025_1001326 | 3300025294 | Bacteria | 33497 |
| 55 | Ga0209564_1001139 | 3300025295 | Bacteria | 31226 |
| 56 | Ga0209564_1020757 | 3300025295 | Bacteria | 2393 |
| 57 | Ga0209758_1000004 | 3300025297 | Bacteria | 1375322 |
| 58 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 59 | Ga0209050_1000550 | 3300025298 | Bacteria | 61775 |
| 60 | Ga0209050_1016974 | 3300025298 | Bacteria | 2937 |
| 61 | Ga0207426_1035521 | 3300025302 | Bacteria | 1590 |
| 62 | Ga0209051_1000336 | 3300025303 | Bacteria | 70491 |
| 63 | Ga0209257_1005923 | 3300025304 | Bacteria | 8225 |
| 64 | Ga0209257_1005924 | 3300025304 | Bacteria | 8225 |
| 65 | Ga0207671_10270085 | 3300025914 | Bacteria | 1340 |
| 66 | Ga0207657_10009932 | 3300025919 | Bacteria | 9527 |
| 67 | Ga0207681_10373174 | 3300025923 | Bacteria | 1147 |
| 68 | Ga0207644_10000046 | 3300025931 | Bacteria | 103962 |
| 69 | Ga0207706_10152225 | 3300025933 | Bacteria | 2034 |
| 70 | Ga0207709_10240034 | 3300025935 | Bacteria | 1318 |
| 71 | Ga0207669_10035928 | 3300025937 | Bacteria | 2826 |
| 72 | Ga0207667_10000109 | 3300025949 | Bacteria | 132054 |
| 73 | Ga0207667_10040398 | 3300025949 | Bacteria | 4968 |
| 74 | Ga0207668_10000136 | 3300025972 | Bacteria | 50579 |
| 75 | Ga0207640_10060634 | 3300025981 | Bacteria | 2502 |
| 76 | Ga0207658_10000805 | 3300025986 | Bacteria | 26389 |
| 77 | Ga0207641_10000001 | 3300026088 | Bacteria | 1180841 |
| 78 | Ga0207641_10003399 | 3300026088 | Bacteria | 14112 |
| 79 | Ga0207641_10035176 | 3300026088 | Bacteria | 4172 |
| 80 | Ga0207674_10355917 | 3300026116 | Bacteria | 1415 |
| 81 | Ga0209371_1000021 | 3300027312 | Bacteria | 555864 |
| 82 | Ga0209371_1002249 | 3300027312 | Bacteria | 11112 |
| 83 | Ga0209813_10005304 | 3300027866 | Bacteria | 3120 |
| 84 | Ga0268266_10119569 | 3300028379 | Bacteria | 2343 |
| 85 | Ga0268264_10000229 | 3300028381 | Bacteria | 108305 |
| 86 | Ga0268264_10001400 | 3300028381 | Bacteria | 22542 |
| 87 | Ga0268256_1000020 | 3300030500 | Bacteria | 557873 |
| 88 | Ga0268256_1000786 | 3300030500 | Bacteria | 22885 |
| 89 | Ga0265325_10047017 | 3300031241 | Bacteria | 2235 |
| 90 | Ga0265313_10001120 | 3300031595 | Bacteria | 25611 |
| 91 | Ga0265313_10016129 | 3300031595 | Bacteria | 4311 |
| 92 | Ga0265342_10016375 | 3300031712 | Bacteria | 4850 |
| 93 | Ga0307405_10180325 | 3300031731 | Bacteria | 1516 |
| 94 | Ga0307413_10064632 | 3300031824 | Bacteria | 2275 |
| 95 | Ga0307406_10070878 | 3300031901 | Bacteria | 2283 |
| 96 | Ga0307412_10001832 | 3300031911 | Bacteria | 11782 |
| 97 | Ga0307412_10096817 | 3300031911 | Bacteria | 2078 |
| 98 | Ga0307416_100487504 | 3300032002 | Bacteria | 1294 |
| 99 | Ga0307414_10187528 | 3300032004 | Bacteria | 1670 |
| 100 | Ga0307411_10171160 | 3300032005 | Bacteria | 1638 |
| 101 | Ga0395905_0165014 | 3300037471 | Bacteria | 2081 |
| 102 | Ga0395901_0050758 | 3300038443 | Bacteria | 4309 |
| 103 | Ga0395901_0295766 | 3300038443 | Bacteria | 1679 |
| 104 | Ga0436360_0135968 | 3300039438 | Bacteria | 5051 |
| 105 | Ga0451795_1170440 | 3300041456 | Bacteria | 1158 |
| 106 | Ga0450923_019381 | 3300042125 | Bacteria | 1310 |
| 107 | Ga0466967_0549324 | 3300045976 | Bacteria | 1137 |
| 108 | Ga0495638_0006561 | 3300046460 | Bacteria | 8466 |
| 109 | Ga0495633_0117267 | 3300046558 | Bacteria | 1233 |
| 110 | Ga0495625_0074854 | 3300046660 | Bacteria | 2370 |
| 111 | Ga0495588_0002173 | 3300046674 | Bacteria | 8392 |
| 112 | Ga0495649_0102801 | 3300046694 | Bacteria | 1518 |
| 113 | Ga0495686_0038744 | 3300047472 | Bacteria | 3047 |
| 114 | Ga0496100_0304140 | 3300048903 | Bacteria | 1194 |
| 115 | Ga0496102_0490869 | 3300048905 | Bacteria | 1150 |
| 116 | Ga0496113_0074447 | 3300048916 | Bacteria | 2589 |
| 117 | Ga0496115_0005574 | 3300048918 | Bacteria | 9159 |
| 118 | Ga0496116_0043641 | 3300048919 | Bacteria | 3053 |
| 119 | Ga0496117_0000002 | 3300048920 | Bacteria | 2483758 |
| 120 | Ga0496118_0001483 | 3300048921 | Bacteria | 35130 |
| 121 | Ga0496119_0095552 | 3300048922 | Bacteria | 1678 |
| 122 | Ga0496120_0001101 | 3300048923 | Bacteria | 35265 |
| 123 | Ga0496121_0000681 | 3300048924 | Bacteria | 63345 |
| 124 | Ga0496121_0042347 | 3300048924 | Bacteria | 3963 |
| 125 | Ga0496122_0000001 | 3300048925 | Bacteria | 1827766 |
| 126 | Ga0496122_0076691 | 3300048925 | Bacteria | 2351 |
| 127 | Ga0496123_0000001 | 3300048926 | Bacteria | 1831497 |
| 128 | Ga0496123_0023170 | 3300048926 | Bacteria | 4759 |
| 129 | Ga0496124_0000204 | 3300048927 | Bacteria | 116976 |
| 130 | Ga0496124_0030413 | 3300048927 | Bacteria | 4793 |
| 131 | Ga0496124_0042253 | 3300048927 | Bacteria | 3926 |
| 132 | Ga0496125_0140656 | 3300048928 | Bacteria | 1679 |
| 133 | Ga0496125_0359705 | 3300048928 | Bacteria | 866 |
| 134 | Ga0496126_0256153 | 3300048929 | Bacteria | 1457 |
| 135 | Ga0496126_0361958 | 3300048929 | Bacteria | 1184 |
| 136 | Ga0501031_0004180 | 3300049568 | Bacteria | 9325 |
| 137 | Ga0501032_0000117 | 3300049569 | Bacteria | 67270 |
| 138 | Ga0501033_0000224 | 3300049570 | Bacteria | 54346 |
| 139 | Ga0501034_0008004 | 3300049571 | Bacteria | 11219 |
| 140 | Ga0501034_0061766 | 3300049571 | Bacteria | 3763 |
| 141 | Ga0501036_0000645 | 3300049572 | Bacteria | 25508 |
| 142 | Ga0501036_0330105 | 3300049572 | Bacteria | 1274 |
| 143 | Ga0501037_0001126 | 3300049573 | Bacteria | 19773 |
| 144 | Ga0501038_0000260 | 3300049574 | Bacteria | 44473 |
| 145 | Ga0501039_0000048 | 3300049575 | Bacteria | 102012 |
| 146 | Ga0501043_0000068 | 3300049579 | Bacteria | 93023 |
| 147 | Ga0501043_0007329 | 3300049579 | Bacteria | 8758 |
| 148 | Ga0501047_0051897 | 3300049581 | Bacteria | 3963 |
| 149 | Ga0501035_0001988 | 3300049822 | Bacteria | 20436 |
| 150 | Ga0501044_0072533 | 3300049823 | Bacteria | 3500 |
| 151 | nmdc:mga00v17_307_c1 | 3300050491 | Bacteria | 28123 |
| 152 | nmdc:mga0yw44_1209_c1 | 3300050492 | Bacteria | 10109 |
| 153 | nmdc:mga0k408_78643_c1 | 3300050493 | Bacteria | 1930 |
| 154 | nmdc:mga07m45_71805_c1 | 3300050496 | Bacteria | 1970 |
| 155 | nmdc:mga0sz30_26595_c1 | 3300050516 | Bacteria | 2373 |
| 156 | nmdc:mga0sz30_27756_c1 | 3300050516 | Bacteria | 2140 |
| 157 | Ga0500643_000089 | 3300053087 | Bacteria | 93982 |
| 158 | Ga0500641_0003022 | 3300053096 | Bacteria | 5958 |
| 159 | Ga0500560_000161 | 3300053107 | Bacteria | 7607 |
| 160 | Ga0500572_002228 | 3300053111 | Bacteria | 4731 |
| 161 | Ga0500595_002194 | 3300053119 | Bacteria | 9916 |
| 162 | Ga0500658_0002051 | 3300053134 | Bacteria | 7855 |
| 163 | Ga0500559_0017514 | 3300053136 | Bacteria | 3026 |
| 164 | Ga0500561_0000831 | 3300053137 | Bacteria | 4937 |
| 165 | Ga0500624_001127 | 3300053157 | Bacteria | 4972 |
| 166 | Ga0500634_0071814 | 3300053161 | Bacteria | 1808 |
| 167 | Ga0500636_0000123 | 3300053177 | Bacteria | 40230 |
| 168 | Ga0500636_0048729 | 3300053177 | Bacteria | 2493 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045976 | Ga0466967_0549324 | Ga0466967_0549324_483_1124 | 208 |
| 2 | 3300049568 | Ga0501031_0004180 | Ga0501031_0004180_2713_3546 | 214 |
| 3 | 3300049569 | Ga0501032_0000117 | Ga0501032_0000117_56295_57128 | 214 |
| 4 | 3300049570 | Ga0501033_0000224 | Ga0501033_0000224_43104_43937 | 214 |
| 5 | 3300049571 | Ga0501034_0008004 | Ga0501034_0008004_8933_9766 | 214 |
| 6 | 3300049571 | Ga0501034_0061766 | Ga0501034_0061766_1947_2813 | 214 |
| 7 | 3300049572 | Ga0501036_0000645 | Ga0501036_0000645_20914_21747 | 214 |
| 8 | 3300049573 | Ga0501037_0001126 | Ga0501037_0001126_10451_11284 | 214 |
| 9 | 3300049574 | Ga0501038_0000260 | Ga0501038_0000260_42315_43148 | 214 |
| 10 | 3300049575 | Ga0501039_0000048 | Ga0501039_0000048_10337_11170 | 214 |
| 11 | 3300049579 | Ga0501043_0000068 | Ga0501043_0000068_85788_86621 | 214 |
| 12 | 3300049822 | Ga0501035_0001988 | Ga0501035_0001988_10568_11401 | 214 |
| 13 | 3300049823 | Ga0501044_0072533 | Ga0501044_0072533_1443_2276 | 214 |
| 14 | 3300031241 | Ga0265325_10047017 | Ga0265325_100470172 | 219 |
| 15 | 3300031595 | Ga0265313_10016129 | Ga0265313_100161295 | 219 |
| 16 | 3300031712 | Ga0265342_10016375 | Ga0265342_100163754 | 219 |
| 17 | 3300049572 | Ga0501036_0330105 | Ga0501036_0330105_111_917 | 222 |
| 18 | 3300049579 | Ga0501043_0007329 | Ga0501043_0007329_876_1682 | 222 |
| 19 | 3300049581 | Ga0501047_0051897 | Ga0501047_0051897_2150_2956 | 222 |
| 20 | 3300006038 | Ga0075365_10021302 | Ga0075365_100213024 | 224 |
| 21 | 3300006186 | Ga0075369_10216297 | Ga0075369_102162971 | 224 |
| 22 | 3300050516 | nmdc:mga0sz30_27756_c1 | nmdc:mga0sz30_27756_c1_98_931 | 224 |
| 23 | 3300005548 | Ga0070665_100168769 | Ga0070665_1001687692 | 225 |
| 24 | 3300006042 | Ga0075368_10013381 | Ga0075368_100133814 | 225 |
| 25 | 3300006048 | Ga0075363_100018372 | Ga0075363_1000183722 | 225 |
| 26 | 3300006177 | Ga0075362_10003014 | Ga0075362_100030146 | 225 |
| 27 | 3300006186 | Ga0075369_10009390 | Ga0075369_100093902 | 225 |
| 28 | 3300009148 | Ga0105243_10013358 | Ga0105243_100133583 | 225 |
| 29 | 3300013102 | Ga0157371_10000425 | Ga0157371_1000042543 | 225 |
| 30 | 3300013104 | Ga0157370_10003706 | Ga0157370_100037063 | 225 |
| 31 | 3300025923 | Ga0207681_10373174 | Ga0207681_103731741 | 225 |
| 32 | 3300025935 | Ga0207709_10240034 | Ga0207709_102400342 | 225 |
| 33 | 3300027866 | Ga0209813_10005304 | Ga0209813_100053042 | 225 |
| 34 | 3300028379 | Ga0268266_10119569 | Ga0268266_101195692 | 225 |
| 35 | 3300048916 | Ga0496113_0074447 | Ga0496113_0074447_898_1731 | 225 |
| 36 | 3300048919 | Ga0496116_0043641 | Ga0496116_0043641_1709_2542 | 225 |
| 37 | 3300048920 | Ga0496117_0000002 | Ga0496117_0000002_1207196_1208029 | 225 |
| 38 | 3300048921 | Ga0496118_0001483 | Ga0496118_0001483_15637_16470 | 225 |
| 39 | 3300048922 | Ga0496119_0095552 | Ga0496119_0095552_469_1302 | 225 |
| 40 | 3300048923 | Ga0496120_0001101 | Ga0496120_0001101_31844_32677 | 225 |
| 41 | 3300048925 | Ga0496122_0000001 | Ga0496122_0000001_524308_525141 | 225 |
| 42 | 3300048926 | Ga0496123_0000001 | Ga0496123_0000001_528039_528872 | 225 |
| 43 | 3300048929 | Ga0496126_0361958 | Ga0496126_0361958_232_1065 | 225 |
| 44 | 3300050491 | nmdc:mga00v17_307_c1 | nmdc:mga00v17_307_c1_14281_15114 | 225 |
| 45 | 3300050492 | nmdc:mga0yw44_1209_c1 | nmdc:mga0yw44_1209_c1_5334_6167 | 225 |
| 46 | 3300050493 | nmdc:mga0k408_78643_c1 | nmdc:mga0k408_78643_c1_704_1537 | 225 |
| 47 | 3300050496 | nmdc:mga07m45_71805_c1 | nmdc:mga07m45_71805_c1_541_1374 | 225 |
| 48 | 3300050516 | nmdc:mga0sz30_26595_c1 | nmdc:mga0sz30_26595_c1_894_1727 | 225 |
| 49 | 3300053137 | Ga0500561_0000831 | Ga0500561_0000831_2430_3263 | 225 |
| 50 | 3300005577 | Ga0068857_100110804 | Ga0068857_1001108042 | 226 |
| 51 | 3300009545 | Ga0105237_10010990 | Ga0105237_1001099011 | 226 |
| 52 | 3300025914 | Ga0207671_10270085 | Ga0207671_102700852 | 227 |
| 53 | 3300026116 | Ga0207674_10355917 | Ga0207674_103559171 | 227 |
| 54 | 3300031911 | Ga0307412_10096817 | Ga0307412_100968172 | 227 |
| 55 | 3300032005 | Ga0307411_10171160 | Ga0307411_101711602 | 227 |
| 56 | 3300048905 | Ga0496102_0490869 | Ga0496102_0490869_133_933 | 227 |
| 57 | 3300048925 | Ga0496122_0076691 | Ga0496122_0076691_885_1685 | 227 |
| 58 | 3300048926 | Ga0496123_0023170 | Ga0496123_0023170_2324_3124 | 227 |
| 59 | 3300048927 | Ga0496124_0000204 | Ga0496124_0000204_2316_3116 | 227 |
| 60 | 3300048927 | Ga0496124_0030413 | Ga0496124_0030413_3163_3963 | 227 |
| 61 | 3300048927 | Ga0496124_0042253 | Ga0496124_0042253_712_1512 | 227 |
| 62 | 3300048928 | Ga0496125_0359705 | Ga0496125_0359705_30_830 | 227 |
| 63 | 3300048928 | Ga0496125_0140656 | Ga0496125_0140656_584_1318 | 228 |
| 64 | iso_pu_bacteria | 2879163058 | 2879164507 | 228 |
| 65 | 3300046460 | Ga0495638_0006561 | Ga0495638_0006561_3990_4721 | 229 |
| 66 | 3300053134 | Ga0500658_0002051 | Ga0500658_0002051_5619_6350 | 229 |
| 67 | 3300027312 | Ga0209371_1002249 | Ga0209371_10022492 | 230 |
| 68 | 3300030500 | Ga0268256_1000786 | Ga0268256_100078619 | 230 |
| 69 | 3300053136 | Ga0500559_0017514 | Ga0500559_0017514_1371_2144 | 231 |
| 70 | 3300053177 | Ga0500636_0000123 | Ga0500636_0000123_1430_2263 | 231 |
| 71 | iso_pu_bacteria | 2937843397 | 2937846970 | 231 |
| 72 | 3300053111 | Ga0500572_002228 | Ga0500572_002228_2016_2849 | 233 |
| 73 | 3300053177 | Ga0500636_0048729 | Ga0500636_0048729_1432_2265 | 233 |
| 74 | iso_pu_bacteria | 2643221564 | 2643837369 | 233 |
| 75 | iso_pu_bacteria | 2847686936 | 2847693037 | 233 |
| 76 | iso_pu_bacteria | 2871495908 | 2871500655 | 233 |
| 77 | iso_pu_bacteria | 2888350351 | 2888356671 | 233 |
| 78 | iso_pu_bacteria | 2906354277 | 2906360840 | 233 |
| 79 | iso_pu_bacteria | 2977864932 | 2977867538 | 233 |
| 80 | iso_pu_bacteria | 2977971508 | 2977976495 | 233 |
| 81 | iso_pu_bacteria | 3000135777 | 3000138393 | 233 |
| 82 | 3300003856 | Ga0058692_1002465 | Ga0058692_10024653 | 234 |
| 83 | 3300027312 | Ga0209371_1000021 | Ga0209371_1000021204 | 234 |
| 84 | 3300030500 | Ga0268256_1000020 | Ga0268256_1000020210 | 234 |
| 85 | 3300031911 | Ga0307412_10001832 | Ga0307412_100018323 | 234 |
| 86 | 3300041456 | Ga0451795_1170440 | Ga0451795_1170440_225_1019 | 234 |
| 87 | 3300047472 | Ga0495686_0038744 | Ga0495686_0038744_1399_2193 | 234 |
| 88 | 3300042125 | Ga0450923_019381 | Ga0450923_019381_29_859 | 236 |
| 89 | iso_pu_bacteria | 2643221551 | 2643775688 | 236 |
| 90 | iso_pu_bacteria | 2643221555 | 2643794135 | 236 |
| 91 | 3300005347 | Ga0070668_100000111 | Ga0070668_10000011120 | 237 |
| 92 | 3300005843 | Ga0068860_100055416 | Ga0068860_1000554164 | 237 |
| 93 | 3300009553 | Ga0105249_10001067 | Ga0105249_100010675 | 237 |
| 94 | 3300025972 | Ga0207668_10000136 | Ga0207668_1000013620 | 237 |
| 95 | iso_pu_bacteria | 2989771324 | 2989773737 | 237 |
| 96 | 3300046558 | Ga0495633_0117267 | Ga0495633_0117267_294_1127 | 238 |
| 97 | 3300053107 | Ga0500560_000161 | Ga0500560_000161_1145_1978 | 238 |
| 98 | 3300053157 | Ga0500624_001127 | Ga0500624_001127_2500_3333 | 238 |
| 99 | 3300053161 | Ga0500634_0071814 | Ga0500634_0071814_619_1452 | 238 |
| 100 | iso_pu_bacteria | 2537561587 | 2537874690 | 238 |
| 101 | iso_pu_bacteria | 2554235003 | 2554247480 | 238 |
| 102 | iso_pu_bacteria | 2558860242 | 2559294611 | 238 |
| 103 | iso_pu_bacteria | 2643221693 | 2644518404 | 238 |
| 104 | iso_pu_bacteria | 2808606387 | 2808985613 | 238 |
| 105 | iso_pu_bacteria | 2842922631 | 2842923905 | 238 |
| 106 | iso_pu_bacteria | 2899845264 | 2899850238 | 238 |
| 107 | iso_pu_bacteria | 2926760298 | 2926760711 | 238 |
| 108 | iso_pu_bacteria | 2979089926 | 2979094012 | 238 |
| 109 | iso_pu_bacteria | 2979095461 | 2979098606 | 238 |
| 110 | iso_pu_bacteria | 650716007 | 650739813 | 238 |
| 111 | 3300025294 | Ga0209025_1000744 | Ga0209025_100074433 | 239 |
| 112 | 3300005355 | Ga0070671_100000136 | Ga0070671_10000013642 | 240 |
| 113 | 3300005841 | Ga0068863_100000171 | Ga0068863_10000017131 | 240 |
| 114 | 3300025931 | Ga0207644_10000046 | Ga0207644_1000004614 | 240 |
| 115 | 3300026088 | Ga0207641_10000001 | Ga0207641_10000001314 | 240 |
| 116 | 3300028381 | Ga0268264_10001400 | Ga0268264_1000140020 | 240 |
| 117 | 3300031901 | Ga0307406_10070878 | Ga0307406_100708783 | 240 |
| 118 | iso_pu_bacteria | 2599185359 | 2600224752 | 240 |
| 119 | iso_pu_bacteria | 2818991466 | 2819712945 | 240 |
| 120 | iso_pu_bacteria | 2928526807 | 2928527483 | 240 |
| 121 | iso_pu_bacteria | 2928968154 | 2928969028 | 240 |
| 122 | 3300003323 | rootH1_10018614 | rootH1_100186144 | 241 |
| 123 | 3300013297 | Ga0157378_10538432 | Ga0157378_105384322 | 241 |
| 124 | 3300046660 | Ga0495625_0074854 | Ga0495625_0074854_1119_1916 | 241 |
| 125 | 3300046674 | Ga0495588_0002173 | Ga0495588_0002173_7129_7962 | 241 |
| 126 | iso_pu_bacteria | 2599185156 | 2599331508 | 241 |
| 127 | 3300031595 | Ga0265313_10001120 | Ga0265313_1000112022 | 242 |
| 128 | iso_pu_bacteria | 2643221541 | 2643730217 | 242 |
| 129 | iso_pu_bacteria | 2643221606 | 2644043386 | 242 |
| 130 | iso_pu_bacteria | 2643221671 | 2644393547 | 242 |
| 131 | 3300005367 | Ga0070667_100001473 | Ga0070667_10000147310 | 243 |
| 132 | 3300005617 | Ga0068859_100579978 | Ga0068859_1005799782 | 243 |
| 133 | 3300005841 | Ga0068863_100026708 | Ga0068863_1000267082 | 243 |
| 134 | 3300005843 | Ga0068860_100002081 | Ga0068860_1000020819 | 243 |
| 135 | 3300006931 | Ga0097620_100579992 | Ga0097620_1005799922 | 243 |
| 136 | 3300025986 | Ga0207658_10000805 | Ga0207658_100008054 | 243 |
| 137 | 3300026088 | Ga0207641_10003399 | Ga0207641_1000339910 | 243 |
| 138 | 3300028381 | Ga0268264_10000229 | Ga0268264_1000022923 | 243 |
| 139 | 3300032004 | Ga0307414_10187528 | Ga0307414_101875282 | 243 |
| 140 | 3300009098 | Ga0105245_10025274 | Ga0105245_100252744 | 244 |
| 141 | 3300031731 | Ga0307405_10180325 | Ga0307405_101803252 | 244 |
| 142 | 3300032002 | Ga0307416_100487504 | Ga0307416_1004875042 | 244 |
| 143 | 3300005262 | Ga0065165_1007405 | Ga0065165_10074053 | 245 |
| 144 | 3300037471 | Ga0395905_0165014 | Ga0395905_0165014_1043_1828 | 245 |
| 145 | 3300038443 | Ga0395901_0050758 | Ga0395901_0050758_1053_1838 | 245 |
| 146 | 3300039438 | Ga0436360_0135968 | Ga0436360_0135968_900_1724 | 245 |
| 147 | 3300048924 | Ga0496121_0000681 | Ga0496121_0000681_58026_58826 | 245 |
| 148 | 3300053096 | Ga0500641_0003022 | Ga0500641_0003022_3606_4388 | 245 |
| 149 | 3300053119 | Ga0500595_002194 | Ga0500595_002194_5839_6612 | 245 |
| 150 | iso_pu_bacteria | 2842333319 | 2842334852 | 245 |
| 151 | 3300046694 | Ga0495649_0102801 | Ga0495649_0102801_170_1003 | 246 |
| 152 | 3300048918 | Ga0496115_0005574 | Ga0496115_0005574_5105_5884 | 246 |
| 153 | 3300015690 | Ga0183363_1004 | Ga0183363_1004333 | 247 |
| 154 | 3300038443 | Ga0395901_0295766 | Ga0395901_0295766_229_1020 | 247 |
| 155 | 3300048929 | Ga0496126_0256153 | Ga0496126_0256153_181_1008 | 248 |
| 156 | 3300005354 | Ga0070675_100062375 | Ga0070675_1000623754 | 249 |
| 157 | 3300005457 | Ga0070662_100154097 | Ga0070662_1001540971 | 249 |
| 158 | 3300025933 | Ga0207706_10152225 | Ga0207706_101522252 | 249 |
| 159 | 3300025937 | Ga0207669_10035928 | Ga0207669_100359282 | 249 |
| 160 | 3300002774 | JGI25150J39212_1000315 | JGI25150J39212_100031518 | 250 |
| 161 | 3300003215 | JGI25153J46596_10000248 | JGI25153J46596_100002487 | 250 |
| 162 | 3300003215 | JGI25153J46596_10000266 | JGI25153J46596_1000026634 | 250 |
| 163 | 3300003771 | Ga0055526_1018727 | Ga0055526_10187272 | 250 |
| 164 | 3300003773 | Ga0055537_1001143 | Ga0055537_10011434 | 250 |
| 165 | 3300003791 | Ga0055530_10018261 | Ga0055530_100182612 | 250 |
| 166 | 3300003791 | Ga0055530_10019821 | Ga0055530_100198212 | 250 |
| 167 | 3300003792 | Ga0055540_1001964 | Ga0055540_10019644 | 250 |
| 168 | 3300003794 | Ga0055531_10027014 | Ga0055531_100270142 | 250 |
| 169 | 3300003794 | Ga0055531_10027021 | Ga0055531_100270212 | 250 |
| 170 | 3300005262 | Ga0065165_1025857 | Ga0065165_10258572 | 250 |
| 171 | 3300005841 | Ga0068863_100046120 | Ga0068863_1000461203 | 250 |
| 172 | 3300025245 | Ga0207425_1000026 | Ga0207425_1000026292 | 250 |
| 173 | 3300025258 | Ga0209129_1000834 | Ga0209129_10008345 | 250 |
| 174 | 3300025263 | Ga0209565_1000240 | Ga0209565_100024042 | 250 |
| 175 | 3300025273 | Ga0209673_1015906 | Ga0209673_10159063 | 250 |
| 176 | 3300025294 | Ga0209025_1001326 | Ga0209025_100132623 | 250 |
| 177 | 3300025295 | Ga0209564_1001139 | Ga0209564_100113926 | 250 |
| 178 | 3300025295 | Ga0209564_1020757 | Ga0209564_10207572 | 250 |
| 179 | 3300025297 | Ga0209758_1000004 | Ga0209758_10000041234 | 250 |
| 180 | 3300025298 | Ga0209050_1000001 | Ga0209050_10000013237 | 250 |
| 181 | 3300025298 | Ga0209050_1000550 | Ga0209050_100055018 | 250 |
| 182 | 3300025298 | Ga0209050_1016974 | Ga0209050_10169743 | 250 |
| 183 | 3300025302 | Ga0207426_1035521 | Ga0207426_10355212 | 250 |
| 184 | 3300025303 | Ga0209051_1000336 | Ga0209051_100033645 | 250 |
| 185 | 3300025304 | Ga0209257_1005923 | Ga0209257_10059236 | 250 |
| 186 | 3300025304 | Ga0209257_1005924 | Ga0209257_10059246 | 250 |
| 187 | 3300026088 | Ga0207641_10035176 | Ga0207641_100351764 | 250 |
| 188 | 3300048903 | Ga0496100_0304140 | Ga0496100_0304140_240_1034 | 250 |
| 189 | 3300031824 | Ga0307413_10064632 | Ga0307413_100646324 | 251 |
| 190 | 3300053087 | Ga0500643_000089 | Ga0500643_000089_89652_90422 | 251 |
| 191 | 3300002067 | JGI24735J21928_10009855 | JGI24735J21928_100098554 | 252 |
| 192 | 3300001990 | JGI24737J22298_10006295 | JGI24737J22298_100062955 | 254 |
| 193 | 3300005339 | Ga0070660_100001005 | Ga0070660_1000010055 | 254 |
| 194 | 3300005563 | Ga0068855_100000857 | Ga0068855_1000008576 | 254 |
| 195 | 3300005578 | Ga0068854_100079693 | Ga0068854_1000796933 | 254 |
| 196 | 3300013105 | Ga0157369_10194309 | Ga0157369_101943092 | 254 |
| 197 | 3300025919 | Ga0207657_10009932 | Ga0207657_100099327 | 254 |
| 198 | 3300025949 | Ga0207667_10000109 | Ga0207667_1000010935 | 254 |
| 199 | 3300025949 | Ga0207667_10040398 | Ga0207667_100403984 | 254 |
| 200 | 3300025981 | Ga0207640_10060634 | Ga0207640_100606343 | 254 |
| 201 | 3300048924 | Ga0496121_0042347 | Ga0496121_0042347_222_1001 | 254 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4q2e-assembly1.cif.gz_A | crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s258c, active mutant) | 0.7581 | 34 | 252 |
| 4q2g-assembly1.cif.gz_A | crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s223c, inactive mutant) | 0.7489 | 17 | 252 |
| 4q2g-assembly1.cif.gz_A | crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s223c, inactive mutant) | 0.6993 | 17 | 252 |
| 4q2e-assembly1.cif.gz_A | crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s258c, active mutant) | 0.664 | 34 | 252 |
| 5vgr-assembly1.cif.gz_A | human atlastin-3, gdp-bound | 0.4653 | 106 | 217 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_K7N2M1_4_109_1.20.1080.10 | Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. | 0.5254 | 124 | 199 | 1.20.1080.10 |
| af_Q8MMD0_7_121_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.4574 | 116 | 215 | 1.20.140.150 |
| af_A4I1N6_7_128_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.434 | 112 | 211 | 1.20.140.150 |
| af_Q8MMD0_7_121_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.4179 | 116 | 215 | 1.20.140.150 |
| af_K7N2M1_4_109_1.20.1080.10 | Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. | 0.4039 | 124 | 199 | 1.20.1080.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1I6JPN3-F1-model_v4 | Phosphatidate cytidylyltransferase (EC 2.7.7.41) (CDP-DAG synthase) (CDP-DG synthase) (CDP-diacylglycerol synthase) (CDP-diglyceride pyrophosphorylase) (CDP-diglyceride synthase) (CTP:phosphatidate cytidylyltransferase) | 0.8722 | 7 | 254 |
GO:0004605
GO:0005886 GO:0016024 |
| AF-A0A326GT02-F1-model_v4 | Phosphatidate cytidylyltransferase (EC 2.7.7.41) | 0.8717 | 24 | 253 |
GO:0004605
GO:0005886 GO:0016024 |
| AF-A0A4R2XX65-F1-model_v4 | deleted | 0.869 | 24 | 253 |
|
| AF-A0A2W6S9Y4-F1-model_v4 | Phosphatidate cytidylyltransferase (EC 2.7.7.41) | 0.868 | 1 | 254 |
GO:0004605
GO:0005886 GO:0016024 |
| AF-A0A2W6S9Y4-F1-model_v4 | Phosphatidate cytidylyltransferase (EC 2.7.7.41) | 0.8649 | 1 | 254 |
GO:0004605
GO:0005886 GO:0016024 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar