F308299

General Info

Members Datasets Scaffolds Average Seq Length
201 167 168 260

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_100046120|Ga0068863_1000461203
Length 295
Sequence MTDTPPPANAAMDELLTRITAGIVMAAIACAAAYYGSWPFRALVAIAAFIMLVEWCDMHKVARYWALVGGLVLAVVLLGGVQYFYPDAVPSPDDSLDVDDFLPALTAFAGIAGLGLLFGAATRRIAAGWGFVYLAVPSFALLVLSWAFVGLVFWVMVVTWATDIFAYFAGRAIGGPKLAPAISPNKTWAGLAGGVIGAGLAGWGMSALFDLGFPFQWIGAPMAVVAQAGDLYESWVKRRAGVKDSGTLLPGHGGVLDRLDGLMPVALATLLILVAGLWTPDADMSVSDDMGNQSQ

Samples

Sample ID Description Type Environment
1 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
2 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
3 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
4 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
5 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
6 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
7 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
8 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
9 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
10 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
11 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
12 2643221693 Rhizobium sp. Root491 Isolate Unclassified
13 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
14 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
15 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
16 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
17 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
18 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
19 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
20 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
21 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
22 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
23 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
24 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
25 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
26 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
27 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
28 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
29 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
30 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
31 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
32 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
33 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
34 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
35 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
36 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
37 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
38 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
39 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
40 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
41 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
42 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
43 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
44 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
45 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
73 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
74 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
75 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
80 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
102 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
103 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
104 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
105 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
106 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
107 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
108 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
115 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
116 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
119 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
120 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
121 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
122 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
123 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
124 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
127 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
128 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
129 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
130 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
131 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
132 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
133 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
134 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
135 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
136 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
137 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
138 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
139 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
151 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
152 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
153 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
154 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
155 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
156 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
157 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
158 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
159 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
160 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
161 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
162 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
163 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
164 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
165 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
166 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
167 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.58
Metatranscriptomes 0
Isolates 16.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.37
Nodule 3.48
Rhizoplane 3.48
Rhizosphere 50.25
Stem 0
Stem Tuber 0
Unclassified 16.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10006295 3300001990 Bacteria 4061
2 JGI24735J21928_10009855 3300002067 Bacteria 3059
3 JGI25150J39212_1000315 3300002774 Bacteria 23966
4 JGI25153J46596_10000248 3300003215 Bacteria 44326
5 JGI25153J46596_10000266 3300003215 Bacteria 41550
6 rootH1_10018614 3300003323 Bacteria 3836
7 Ga0055526_1018727 3300003771 Bacteria 2567
8 Ga0055537_1001143 3300003773 Bacteria 11386
9 Ga0055530_10018261 3300003791 Bacteria 2169
10 Ga0055530_10019821 3300003791 Bacteria 2028
11 Ga0055540_1001964 3300003792 Bacteria 11494
12 Ga0055531_10027014 3300003794 Bacteria 2028
13 Ga0055531_10027021 3300003794 Bacteria 2028
14 Ga0058692_1002465 3300003856 Bacteria 6189
15 Ga0065165_1007405 3300005262 Bacteria 5405
16 Ga0065165_1025857 3300005262 Bacteria 1942
17 Ga0070660_100001005 3300005339 Bacteria 18942
18 Ga0070668_100000111 3300005347 Bacteria 50557
19 Ga0070675_100062375 3300005354 Bacteria 3080
20 Ga0070671_100000136 3300005355 Bacteria 47367
21 Ga0070667_100001473 3300005367 Bacteria 21102
22 Ga0070662_100154097 3300005457 Bacteria 1792
23 Ga0070665_100168769 3300005548 Bacteria 2190
24 Ga0068855_100000857 3300005563 Bacteria 37732
25 Ga0068857_100110804 3300005577 Bacteria 2467
26 Ga0068854_100079693 3300005578 Bacteria 2415
27 Ga0068859_100579978 3300005617 Bacteria 1215
28 Ga0068863_100000171 3300005841 Bacteria 69589
29 Ga0068863_100026708 3300005841 Bacteria 5505
30 Ga0068863_100046120 3300005841 Bacteria 4136
31 Ga0068860_100002081 3300005843 Bacteria 21102
32 Ga0068860_100055416 3300005843 Bacteria 3769
33 Ga0075365_10021302 3300006038 Bacteria 4041
34 Ga0075368_10013381 3300006042 Bacteria 3012
35 Ga0075363_100018372 3300006048 Bacteria 3483
36 Ga0075362_10003014 3300006177 Bacteria 5791
37 Ga0075369_10009390 3300006186 Bacteria 3798
38 Ga0075369_10216297 3300006186 Bacteria 886
39 Ga0097620_100579992 3300006931 Bacteria 1215
40 Ga0105245_10025274 3300009098 Bacteria 5222
41 Ga0105243_10013358 3300009148 Bacteria 6211
42 Ga0105237_10010990 3300009545 Bacteria 9607
43 Ga0105249_10001067 3300009553 Bacteria 24310
44 Ga0157371_10000425 3300013102 Bacteria 51804
45 Ga0157370_10003706 3300013104 Bacteria 17854
46 Ga0157369_10194309 3300013105 Bacteria 2131
47 Ga0157378_10538432 3300013297 Bacteria 1171
48 Ga0183363_1004 3300015690 Bacteria 416766
49 Ga0207425_1000026 3300025245 Bacteria 301303
50 Ga0209129_1000834 3300025258 Bacteria 19378
51 Ga0209565_1000240 3300025263 Bacteria 59106
52 Ga0209673_1015906 3300025273 Bacteria 2834
53 Ga0209025_1000744 3300025294 Bacteria 54885
54 Ga0209025_1001326 3300025294 Bacteria 33497
55 Ga0209564_1001139 3300025295 Bacteria 31226
56 Ga0209564_1020757 3300025295 Bacteria 2393
57 Ga0209758_1000004 3300025297 Bacteria 1375322
58 Ga0209050_1000001 3300025298 Bacteria 3563507
59 Ga0209050_1000550 3300025298 Bacteria 61775
60 Ga0209050_1016974 3300025298 Bacteria 2937
61 Ga0207426_1035521 3300025302 Bacteria 1590
62 Ga0209051_1000336 3300025303 Bacteria 70491
63 Ga0209257_1005923 3300025304 Bacteria 8225
64 Ga0209257_1005924 3300025304 Bacteria 8225
65 Ga0207671_10270085 3300025914 Bacteria 1340
66 Ga0207657_10009932 3300025919 Bacteria 9527
67 Ga0207681_10373174 3300025923 Bacteria 1147
68 Ga0207644_10000046 3300025931 Bacteria 103962
69 Ga0207706_10152225 3300025933 Bacteria 2034
70 Ga0207709_10240034 3300025935 Bacteria 1318
71 Ga0207669_10035928 3300025937 Bacteria 2826
72 Ga0207667_10000109 3300025949 Bacteria 132054
73 Ga0207667_10040398 3300025949 Bacteria 4968
74 Ga0207668_10000136 3300025972 Bacteria 50579
75 Ga0207640_10060634 3300025981 Bacteria 2502
76 Ga0207658_10000805 3300025986 Bacteria 26389
77 Ga0207641_10000001 3300026088 Bacteria 1180841
78 Ga0207641_10003399 3300026088 Bacteria 14112
79 Ga0207641_10035176 3300026088 Bacteria 4172
80 Ga0207674_10355917 3300026116 Bacteria 1415
81 Ga0209371_1000021 3300027312 Bacteria 555864
82 Ga0209371_1002249 3300027312 Bacteria 11112
83 Ga0209813_10005304 3300027866 Bacteria 3120
84 Ga0268266_10119569 3300028379 Bacteria 2343
85 Ga0268264_10000229 3300028381 Bacteria 108305
86 Ga0268264_10001400 3300028381 Bacteria 22542
87 Ga0268256_1000020 3300030500 Bacteria 557873
88 Ga0268256_1000786 3300030500 Bacteria 22885
89 Ga0265325_10047017 3300031241 Bacteria 2235
90 Ga0265313_10001120 3300031595 Bacteria 25611
91 Ga0265313_10016129 3300031595 Bacteria 4311
92 Ga0265342_10016375 3300031712 Bacteria 4850
93 Ga0307405_10180325 3300031731 Bacteria 1516
94 Ga0307413_10064632 3300031824 Bacteria 2275
95 Ga0307406_10070878 3300031901 Bacteria 2283
96 Ga0307412_10001832 3300031911 Bacteria 11782
97 Ga0307412_10096817 3300031911 Bacteria 2078
98 Ga0307416_100487504 3300032002 Bacteria 1294
99 Ga0307414_10187528 3300032004 Bacteria 1670
100 Ga0307411_10171160 3300032005 Bacteria 1638
101 Ga0395905_0165014 3300037471 Bacteria 2081
102 Ga0395901_0050758 3300038443 Bacteria 4309
103 Ga0395901_0295766 3300038443 Bacteria 1679
104 Ga0436360_0135968 3300039438 Bacteria 5051
105 Ga0451795_1170440 3300041456 Bacteria 1158
106 Ga0450923_019381 3300042125 Bacteria 1310
107 Ga0466967_0549324 3300045976 Bacteria 1137
108 Ga0495638_0006561 3300046460 Bacteria 8466
109 Ga0495633_0117267 3300046558 Bacteria 1233
110 Ga0495625_0074854 3300046660 Bacteria 2370
111 Ga0495588_0002173 3300046674 Bacteria 8392
112 Ga0495649_0102801 3300046694 Bacteria 1518
113 Ga0495686_0038744 3300047472 Bacteria 3047
114 Ga0496100_0304140 3300048903 Bacteria 1194
115 Ga0496102_0490869 3300048905 Bacteria 1150
116 Ga0496113_0074447 3300048916 Bacteria 2589
117 Ga0496115_0005574 3300048918 Bacteria 9159
118 Ga0496116_0043641 3300048919 Bacteria 3053
119 Ga0496117_0000002 3300048920 Bacteria 2483758
120 Ga0496118_0001483 3300048921 Bacteria 35130
121 Ga0496119_0095552 3300048922 Bacteria 1678
122 Ga0496120_0001101 3300048923 Bacteria 35265
123 Ga0496121_0000681 3300048924 Bacteria 63345
124 Ga0496121_0042347 3300048924 Bacteria 3963
125 Ga0496122_0000001 3300048925 Bacteria 1827766
126 Ga0496122_0076691 3300048925 Bacteria 2351
127 Ga0496123_0000001 3300048926 Bacteria 1831497
128 Ga0496123_0023170 3300048926 Bacteria 4759
129 Ga0496124_0000204 3300048927 Bacteria 116976
130 Ga0496124_0030413 3300048927 Bacteria 4793
131 Ga0496124_0042253 3300048927 Bacteria 3926
132 Ga0496125_0140656 3300048928 Bacteria 1679
133 Ga0496125_0359705 3300048928 Bacteria 866
134 Ga0496126_0256153 3300048929 Bacteria 1457
135 Ga0496126_0361958 3300048929 Bacteria 1184
136 Ga0501031_0004180 3300049568 Bacteria 9325
137 Ga0501032_0000117 3300049569 Bacteria 67270
138 Ga0501033_0000224 3300049570 Bacteria 54346
139 Ga0501034_0008004 3300049571 Bacteria 11219
140 Ga0501034_0061766 3300049571 Bacteria 3763
141 Ga0501036_0000645 3300049572 Bacteria 25508
142 Ga0501036_0330105 3300049572 Bacteria 1274
143 Ga0501037_0001126 3300049573 Bacteria 19773
144 Ga0501038_0000260 3300049574 Bacteria 44473
145 Ga0501039_0000048 3300049575 Bacteria 102012
146 Ga0501043_0000068 3300049579 Bacteria 93023
147 Ga0501043_0007329 3300049579 Bacteria 8758
148 Ga0501047_0051897 3300049581 Bacteria 3963
149 Ga0501035_0001988 3300049822 Bacteria 20436
150 Ga0501044_0072533 3300049823 Bacteria 3500
151 nmdc:mga00v17_307_c1 3300050491 Bacteria 28123
152 nmdc:mga0yw44_1209_c1 3300050492 Bacteria 10109
153 nmdc:mga0k408_78643_c1 3300050493 Bacteria 1930
154 nmdc:mga07m45_71805_c1 3300050496 Bacteria 1970
155 nmdc:mga0sz30_26595_c1 3300050516 Bacteria 2373
156 nmdc:mga0sz30_27756_c1 3300050516 Bacteria 2140
157 Ga0500643_000089 3300053087 Bacteria 93982
158 Ga0500641_0003022 3300053096 Bacteria 5958
159 Ga0500560_000161 3300053107 Bacteria 7607
160 Ga0500572_002228 3300053111 Bacteria 4731
161 Ga0500595_002194 3300053119 Bacteria 9916
162 Ga0500658_0002051 3300053134 Bacteria 7855
163 Ga0500559_0017514 3300053136 Bacteria 3026
164 Ga0500561_0000831 3300053137 Bacteria 4937
165 Ga0500624_001127 3300053157 Bacteria 4972
166 Ga0500634_0071814 3300053161 Bacteria 1808
167 Ga0500636_0000123 3300053177 Bacteria 40230
168 Ga0500636_0048729 3300053177 Bacteria 2493

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_0549324 Ga0466967_0549324_483_1124 208
2 3300049568 Ga0501031_0004180 Ga0501031_0004180_2713_3546 214
3 3300049569 Ga0501032_0000117 Ga0501032_0000117_56295_57128 214
4 3300049570 Ga0501033_0000224 Ga0501033_0000224_43104_43937 214
5 3300049571 Ga0501034_0008004 Ga0501034_0008004_8933_9766 214
6 3300049571 Ga0501034_0061766 Ga0501034_0061766_1947_2813 214
7 3300049572 Ga0501036_0000645 Ga0501036_0000645_20914_21747 214
8 3300049573 Ga0501037_0001126 Ga0501037_0001126_10451_11284 214
9 3300049574 Ga0501038_0000260 Ga0501038_0000260_42315_43148 214
10 3300049575 Ga0501039_0000048 Ga0501039_0000048_10337_11170 214
11 3300049579 Ga0501043_0000068 Ga0501043_0000068_85788_86621 214
12 3300049822 Ga0501035_0001988 Ga0501035_0001988_10568_11401 214
13 3300049823 Ga0501044_0072533 Ga0501044_0072533_1443_2276 214
14 3300031241 Ga0265325_10047017 Ga0265325_100470172 219
15 3300031595 Ga0265313_10016129 Ga0265313_100161295 219
16 3300031712 Ga0265342_10016375 Ga0265342_100163754 219
17 3300049572 Ga0501036_0330105 Ga0501036_0330105_111_917 222
18 3300049579 Ga0501043_0007329 Ga0501043_0007329_876_1682 222
19 3300049581 Ga0501047_0051897 Ga0501047_0051897_2150_2956 222
20 3300006038 Ga0075365_10021302 Ga0075365_100213024 224
21 3300006186 Ga0075369_10216297 Ga0075369_102162971 224
22 3300050516 nmdc:mga0sz30_27756_c1 nmdc:mga0sz30_27756_c1_98_931 224
23 3300005548 Ga0070665_100168769 Ga0070665_1001687692 225
24 3300006042 Ga0075368_10013381 Ga0075368_100133814 225
25 3300006048 Ga0075363_100018372 Ga0075363_1000183722 225
26 3300006177 Ga0075362_10003014 Ga0075362_100030146 225
27 3300006186 Ga0075369_10009390 Ga0075369_100093902 225
28 3300009148 Ga0105243_10013358 Ga0105243_100133583 225
29 3300013102 Ga0157371_10000425 Ga0157371_1000042543 225
30 3300013104 Ga0157370_10003706 Ga0157370_100037063 225
31 3300025923 Ga0207681_10373174 Ga0207681_103731741 225
32 3300025935 Ga0207709_10240034 Ga0207709_102400342 225
33 3300027866 Ga0209813_10005304 Ga0209813_100053042 225
34 3300028379 Ga0268266_10119569 Ga0268266_101195692 225
35 3300048916 Ga0496113_0074447 Ga0496113_0074447_898_1731 225
36 3300048919 Ga0496116_0043641 Ga0496116_0043641_1709_2542 225
37 3300048920 Ga0496117_0000002 Ga0496117_0000002_1207196_1208029 225
38 3300048921 Ga0496118_0001483 Ga0496118_0001483_15637_16470 225
39 3300048922 Ga0496119_0095552 Ga0496119_0095552_469_1302 225
40 3300048923 Ga0496120_0001101 Ga0496120_0001101_31844_32677 225
41 3300048925 Ga0496122_0000001 Ga0496122_0000001_524308_525141 225
42 3300048926 Ga0496123_0000001 Ga0496123_0000001_528039_528872 225
43 3300048929 Ga0496126_0361958 Ga0496126_0361958_232_1065 225
44 3300050491 nmdc:mga00v17_307_c1 nmdc:mga00v17_307_c1_14281_15114 225
45 3300050492 nmdc:mga0yw44_1209_c1 nmdc:mga0yw44_1209_c1_5334_6167 225
46 3300050493 nmdc:mga0k408_78643_c1 nmdc:mga0k408_78643_c1_704_1537 225
47 3300050496 nmdc:mga07m45_71805_c1 nmdc:mga07m45_71805_c1_541_1374 225
48 3300050516 nmdc:mga0sz30_26595_c1 nmdc:mga0sz30_26595_c1_894_1727 225
49 3300053137 Ga0500561_0000831 Ga0500561_0000831_2430_3263 225
50 3300005577 Ga0068857_100110804 Ga0068857_1001108042 226
51 3300009545 Ga0105237_10010990 Ga0105237_1001099011 226
52 3300025914 Ga0207671_10270085 Ga0207671_102700852 227
53 3300026116 Ga0207674_10355917 Ga0207674_103559171 227
54 3300031911 Ga0307412_10096817 Ga0307412_100968172 227
55 3300032005 Ga0307411_10171160 Ga0307411_101711602 227
56 3300048905 Ga0496102_0490869 Ga0496102_0490869_133_933 227
57 3300048925 Ga0496122_0076691 Ga0496122_0076691_885_1685 227
58 3300048926 Ga0496123_0023170 Ga0496123_0023170_2324_3124 227
59 3300048927 Ga0496124_0000204 Ga0496124_0000204_2316_3116 227
60 3300048927 Ga0496124_0030413 Ga0496124_0030413_3163_3963 227
61 3300048927 Ga0496124_0042253 Ga0496124_0042253_712_1512 227
62 3300048928 Ga0496125_0359705 Ga0496125_0359705_30_830 227
63 3300048928 Ga0496125_0140656 Ga0496125_0140656_584_1318 228
64 iso_pu_bacteria 2879163058 2879164507 228
65 3300046460 Ga0495638_0006561 Ga0495638_0006561_3990_4721 229
66 3300053134 Ga0500658_0002051 Ga0500658_0002051_5619_6350 229
67 3300027312 Ga0209371_1002249 Ga0209371_10022492 230
68 3300030500 Ga0268256_1000786 Ga0268256_100078619 230
69 3300053136 Ga0500559_0017514 Ga0500559_0017514_1371_2144 231
70 3300053177 Ga0500636_0000123 Ga0500636_0000123_1430_2263 231
71 iso_pu_bacteria 2937843397 2937846970 231
72 3300053111 Ga0500572_002228 Ga0500572_002228_2016_2849 233
73 3300053177 Ga0500636_0048729 Ga0500636_0048729_1432_2265 233
74 iso_pu_bacteria 2643221564 2643837369 233
75 iso_pu_bacteria 2847686936 2847693037 233
76 iso_pu_bacteria 2871495908 2871500655 233
77 iso_pu_bacteria 2888350351 2888356671 233
78 iso_pu_bacteria 2906354277 2906360840 233
79 iso_pu_bacteria 2977864932 2977867538 233
80 iso_pu_bacteria 2977971508 2977976495 233
81 iso_pu_bacteria 3000135777 3000138393 233
82 3300003856 Ga0058692_1002465 Ga0058692_10024653 234
83 3300027312 Ga0209371_1000021 Ga0209371_1000021204 234
84 3300030500 Ga0268256_1000020 Ga0268256_1000020210 234
85 3300031911 Ga0307412_10001832 Ga0307412_100018323 234
86 3300041456 Ga0451795_1170440 Ga0451795_1170440_225_1019 234
87 3300047472 Ga0495686_0038744 Ga0495686_0038744_1399_2193 234
88 3300042125 Ga0450923_019381 Ga0450923_019381_29_859 236
89 iso_pu_bacteria 2643221551 2643775688 236
90 iso_pu_bacteria 2643221555 2643794135 236
91 3300005347 Ga0070668_100000111 Ga0070668_10000011120 237
92 3300005843 Ga0068860_100055416 Ga0068860_1000554164 237
93 3300009553 Ga0105249_10001067 Ga0105249_100010675 237
94 3300025972 Ga0207668_10000136 Ga0207668_1000013620 237
95 iso_pu_bacteria 2989771324 2989773737 237
96 3300046558 Ga0495633_0117267 Ga0495633_0117267_294_1127 238
97 3300053107 Ga0500560_000161 Ga0500560_000161_1145_1978 238
98 3300053157 Ga0500624_001127 Ga0500624_001127_2500_3333 238
99 3300053161 Ga0500634_0071814 Ga0500634_0071814_619_1452 238
100 iso_pu_bacteria 2537561587 2537874690 238
101 iso_pu_bacteria 2554235003 2554247480 238
102 iso_pu_bacteria 2558860242 2559294611 238
103 iso_pu_bacteria 2643221693 2644518404 238
104 iso_pu_bacteria 2808606387 2808985613 238
105 iso_pu_bacteria 2842922631 2842923905 238
106 iso_pu_bacteria 2899845264 2899850238 238
107 iso_pu_bacteria 2926760298 2926760711 238
108 iso_pu_bacteria 2979089926 2979094012 238
109 iso_pu_bacteria 2979095461 2979098606 238
110 iso_pu_bacteria 650716007 650739813 238
111 3300025294 Ga0209025_1000744 Ga0209025_100074433 239
112 3300005355 Ga0070671_100000136 Ga0070671_10000013642 240
113 3300005841 Ga0068863_100000171 Ga0068863_10000017131 240
114 3300025931 Ga0207644_10000046 Ga0207644_1000004614 240
115 3300026088 Ga0207641_10000001 Ga0207641_10000001314 240
116 3300028381 Ga0268264_10001400 Ga0268264_1000140020 240
117 3300031901 Ga0307406_10070878 Ga0307406_100708783 240
118 iso_pu_bacteria 2599185359 2600224752 240
119 iso_pu_bacteria 2818991466 2819712945 240
120 iso_pu_bacteria 2928526807 2928527483 240
121 iso_pu_bacteria 2928968154 2928969028 240
122 3300003323 rootH1_10018614 rootH1_100186144 241
123 3300013297 Ga0157378_10538432 Ga0157378_105384322 241
124 3300046660 Ga0495625_0074854 Ga0495625_0074854_1119_1916 241
125 3300046674 Ga0495588_0002173 Ga0495588_0002173_7129_7962 241
126 iso_pu_bacteria 2599185156 2599331508 241
127 3300031595 Ga0265313_10001120 Ga0265313_1000112022 242
128 iso_pu_bacteria 2643221541 2643730217 242
129 iso_pu_bacteria 2643221606 2644043386 242
130 iso_pu_bacteria 2643221671 2644393547 242
131 3300005367 Ga0070667_100001473 Ga0070667_10000147310 243
132 3300005617 Ga0068859_100579978 Ga0068859_1005799782 243
133 3300005841 Ga0068863_100026708 Ga0068863_1000267082 243
134 3300005843 Ga0068860_100002081 Ga0068860_1000020819 243
135 3300006931 Ga0097620_100579992 Ga0097620_1005799922 243
136 3300025986 Ga0207658_10000805 Ga0207658_100008054 243
137 3300026088 Ga0207641_10003399 Ga0207641_1000339910 243
138 3300028381 Ga0268264_10000229 Ga0268264_1000022923 243
139 3300032004 Ga0307414_10187528 Ga0307414_101875282 243
140 3300009098 Ga0105245_10025274 Ga0105245_100252744 244
141 3300031731 Ga0307405_10180325 Ga0307405_101803252 244
142 3300032002 Ga0307416_100487504 Ga0307416_1004875042 244
143 3300005262 Ga0065165_1007405 Ga0065165_10074053 245
144 3300037471 Ga0395905_0165014 Ga0395905_0165014_1043_1828 245
145 3300038443 Ga0395901_0050758 Ga0395901_0050758_1053_1838 245
146 3300039438 Ga0436360_0135968 Ga0436360_0135968_900_1724 245
147 3300048924 Ga0496121_0000681 Ga0496121_0000681_58026_58826 245
148 3300053096 Ga0500641_0003022 Ga0500641_0003022_3606_4388 245
149 3300053119 Ga0500595_002194 Ga0500595_002194_5839_6612 245
150 iso_pu_bacteria 2842333319 2842334852 245
151 3300046694 Ga0495649_0102801 Ga0495649_0102801_170_1003 246
152 3300048918 Ga0496115_0005574 Ga0496115_0005574_5105_5884 246
153 3300015690 Ga0183363_1004 Ga0183363_1004333 247
154 3300038443 Ga0395901_0295766 Ga0395901_0295766_229_1020 247
155 3300048929 Ga0496126_0256153 Ga0496126_0256153_181_1008 248
156 3300005354 Ga0070675_100062375 Ga0070675_1000623754 249
157 3300005457 Ga0070662_100154097 Ga0070662_1001540971 249
158 3300025933 Ga0207706_10152225 Ga0207706_101522252 249
159 3300025937 Ga0207669_10035928 Ga0207669_100359282 249
160 3300002774 JGI25150J39212_1000315 JGI25150J39212_100031518 250
161 3300003215 JGI25153J46596_10000248 JGI25153J46596_100002487 250
162 3300003215 JGI25153J46596_10000266 JGI25153J46596_1000026634 250
163 3300003771 Ga0055526_1018727 Ga0055526_10187272 250
164 3300003773 Ga0055537_1001143 Ga0055537_10011434 250
165 3300003791 Ga0055530_10018261 Ga0055530_100182612 250
166 3300003791 Ga0055530_10019821 Ga0055530_100198212 250
167 3300003792 Ga0055540_1001964 Ga0055540_10019644 250
168 3300003794 Ga0055531_10027014 Ga0055531_100270142 250
169 3300003794 Ga0055531_10027021 Ga0055531_100270212 250
170 3300005262 Ga0065165_1025857 Ga0065165_10258572 250
171 3300005841 Ga0068863_100046120 Ga0068863_1000461203 250
172 3300025245 Ga0207425_1000026 Ga0207425_1000026292 250
173 3300025258 Ga0209129_1000834 Ga0209129_10008345 250
174 3300025263 Ga0209565_1000240 Ga0209565_100024042 250
175 3300025273 Ga0209673_1015906 Ga0209673_10159063 250
176 3300025294 Ga0209025_1001326 Ga0209025_100132623 250
177 3300025295 Ga0209564_1001139 Ga0209564_100113926 250
178 3300025295 Ga0209564_1020757 Ga0209564_10207572 250
179 3300025297 Ga0209758_1000004 Ga0209758_10000041234 250
180 3300025298 Ga0209050_1000001 Ga0209050_10000013237 250
181 3300025298 Ga0209050_1000550 Ga0209050_100055018 250
182 3300025298 Ga0209050_1016974 Ga0209050_10169743 250
183 3300025302 Ga0207426_1035521 Ga0207426_10355212 250
184 3300025303 Ga0209051_1000336 Ga0209051_100033645 250
185 3300025304 Ga0209257_1005923 Ga0209257_10059236 250
186 3300025304 Ga0209257_1005924 Ga0209257_10059246 250
187 3300026088 Ga0207641_10035176 Ga0207641_100351764 250
188 3300048903 Ga0496100_0304140 Ga0496100_0304140_240_1034 250
189 3300031824 Ga0307413_10064632 Ga0307413_100646324 251
190 3300053087 Ga0500643_000089 Ga0500643_000089_89652_90422 251
191 3300002067 JGI24735J21928_10009855 JGI24735J21928_100098554 252
192 3300001990 JGI24737J22298_10006295 JGI24737J22298_100062955 254
193 3300005339 Ga0070660_100001005 Ga0070660_1000010055 254
194 3300005563 Ga0068855_100000857 Ga0068855_1000008576 254
195 3300005578 Ga0068854_100079693 Ga0068854_1000796933 254
196 3300013105 Ga0157369_10194309 Ga0157369_101943092 254
197 3300025919 Ga0207657_10009932 Ga0207657_100099327 254
198 3300025949 Ga0207667_10000109 Ga0207667_1000010935 254
199 3300025949 Ga0207667_10040398 Ga0207667_100403984 254
200 3300025981 Ga0207640_10060634 Ga0207640_100606343 254
201 3300048924 Ga0496121_0042347 Ga0496121_0042347_222_1001 254

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01148

CTP_transf_1

Cytidylyltransferase family

16

275

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4q2e-assembly1.cif.gz_A crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s258c, active mutant) 0.7581 34 252
4q2g-assembly1.cif.gz_A crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s223c, inactive mutant) 0.7489 17 252
4q2g-assembly1.cif.gz_A crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s223c, inactive mutant) 0.6993 17 252
4q2e-assembly1.cif.gz_A crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s258c, active mutant) 0.664 34 252
5vgr-assembly1.cif.gz_A human atlastin-3, gdp-bound 0.4653 106 217
ID Description Score Start End Superfamily
af_K7N2M1_4_109_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.5254 124 199 1.20.1080.10
af_Q8MMD0_7_121_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.4574 116 215 1.20.140.150
af_A4I1N6_7_128_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.434 112 211 1.20.140.150
af_Q8MMD0_7_121_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.4179 116 215 1.20.140.150
af_K7N2M1_4_109_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.4039 124 199 1.20.1080.10
ID Description Score Start End GO Terms
AF-A0A1I6JPN3-F1-model_v4 Phosphatidate cytidylyltransferase (EC 2.7.7.41) (CDP-DAG synthase) (CDP-DG synthase) (CDP-diacylglycerol synthase) (CDP-diglyceride pyrophosphorylase) (CDP-diglyceride synthase) (CTP:phosphatidate cytidylyltransferase) 0.8722 7 254 GO:0004605
GO:0005886
GO:0016024
AF-A0A326GT02-F1-model_v4 Phosphatidate cytidylyltransferase (EC 2.7.7.41) 0.8717 24 253 GO:0004605
GO:0005886
GO:0016024
AF-A0A4R2XX65-F1-model_v4 deleted 0.869 24 253
AF-A0A2W6S9Y4-F1-model_v4 Phosphatidate cytidylyltransferase (EC 2.7.7.41) 0.868 1 254 GO:0004605
GO:0005886
GO:0016024
AF-A0A2W6S9Y4-F1-model_v4 Phosphatidate cytidylyltransferase (EC 2.7.7.41) 0.8649 1 254 GO:0004605
GO:0005886
GO:0016024

Feature Viewer

pLDDT pTM Quality
78.98 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map