F307859

General Info

Members Datasets Scaffolds Average Seq Length
200 121 200 153

Family's Representative Sequence

Representative Sequence 3300059424|Ga0590075_128945|Ga0590075_128945_85_531
Length 148
Sequence MRHSAAELVRDLQATRDETLGYFSLGEDALERTYGPGKWSVRYLLHHLADAETVLYERIRRVISEPPQTLIVLDYSRVPLEISRQVFESVRGAHIHLAGRFYESHGHLGFTHSELGPRTLKQEFDKVADHNAHHLDQIRRALSGGGGP

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
73 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
74 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
75 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
76 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
77 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
78 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
79 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
80 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
81 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
82 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
83 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
84 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
85 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
86 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
87 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
88 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
89 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
90 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
91 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
92 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
93 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
94 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
95 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
96 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
97 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
98 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
99 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
100 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
101 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
102 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
103 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
104 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
105 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
106 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
107 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
108 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
109 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
110 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
111 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
112 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
113 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
114 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
115 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
116 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
117 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
118 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
119 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
120 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
121 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1
Rhizosphere 98
Stem 0
Stem Tuber 0
Unclassified 1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_2606717 2162886012 Bacteria 1837
2 rootH1_10128128 3300003316 Bacteria 1594
3 rootL2_10204124 3300003322 Unclassified 2551
4 Ga0065704_10531495 3300005289 Bacteria 647
5 Ga0065715_10111742 3300005293 Bacteria 2561
6 Ga0065715_10395047 3300005293 Unclassified 889
7 Ga0065707_10116428 3300005295 Bacteria 2238
8 Ga0065707_10207461 3300005295 Unclassified 1281
9 Ga0065707_10218262 3300005295 Bacteria 1236
10 Ga0070676_10239796 3300005328 Unclassified 1205
11 Ga0070680_100230458 3300005336 Bacteria 1564
12 Ga0068868_100256358 3300005338 Bacteria 1474
13 Ga0070669_100140469 3300005353 Bacteria 1862
14 Ga0070669_100460399 3300005353 Bacteria 1050
15 Ga0070671_100179101 3300005355 Bacteria 1794
16 Ga0070673_100293485 3300005364 Bacteria 1429
17 Ga0070688_100143693 3300005365 Bacteria 1624
18 Ga0070667_100085232 3300005367 Bacteria 2709
19 Ga0070667_101917063 3300005367 Unclassified 558
20 Ga0070700_100218562 3300005441 Bacteria 1349
21 Ga0070694_100026258 3300005444 Bacteria 3774
22 Ga0070694_100107808 3300005444 Bacteria 1980
23 Ga0070694_100448682 3300005444 Bacteria 1018
24 Ga0070694_100465703 3300005444 Unclassified 1000
25 Ga0070662_100138427 3300005457 Bacteria 1884
26 Ga0070685_10417943 3300005466 Unclassified 932
27 Ga0070707_100102317 3300005468 Bacteria 2776
28 Ga0070707_100349034 3300005468 Unclassified 1437
29 Ga0070698_100092137 3300005471 Unclassified 3012
30 Ga0070698_100137696 3300005471 Bacteria 2394
31 Ga0070698_100988267 3300005471 Unclassified 789
32 Ga0070699_100024213 3300005518 Bacteria 5231
33 Ga0070699_100153548 3300005518 Bacteria 2037
34 Ga0070679_101022803 3300005530 Bacteria 770
35 Ga0070697_100149338 3300005536 Bacteria 1969
36 Ga0070697_100565773 3300005536 Bacteria 997
37 Ga0070672_100161982 3300005543 Bacteria 1856
38 Ga0070695_101013811 3300005545 Bacteria 676
39 Ga0070696_100002798 3300005546 Bacteria 11577
40 Ga0070696_100012632 3300005546 Bacteria 5669
41 Ga0070704_100183358 3300005549 Bacteria 1676
42 Ga0070704_100356997 3300005549 Bacteria 1235
43 Ga0070702_100063300 3300005615 Bacteria 2159
44 Ga0068859_100282788 3300005617 Bacteria 1752
45 Ga0068859_100551778 3300005617 Bacteria 1247
46 Ga0068861_100289930 3300005719 Bacteria 1413
47 Ga0068863_101437743 3300005841 Unclassified 697
48 Ga0068860_101885747 3300005843 Bacteria 619
49 Ga0068871_100818359 3300006358 Unclassified 859
50 Ga0075428_100154023 3300006844 Unclassified 2497
51 Ga0075428_100249581 3300006844 Bacteria 1913
52 Ga0075428_100344436 3300006844 Bacteria 1600
53 Ga0075430_100065408 3300006846 Bacteria 3055
54 Ga0075430_100104252 3300006846 Unclassified 2367
55 Ga0075430_100829618 3300006846 Bacteria 762
56 Ga0075431_100029741 3300006847 Bacteria 5625
57 Ga0075431_100088930 3300006847 Unclassified 3188
58 Ga0075431_100140098 3300006847 Bacteria 2493
59 Ga0075431_100324012 3300006847 Bacteria 1553
60 Ga0075431_100477342 3300006847 Unclassified 1240
61 Ga0075431_100806491 3300006847 Unclassified 912
62 Ga0075433_10000037 3300006852 Bacteria 53492
63 Ga0075433_10033368 3300006852 Bacteria 4413
64 Ga0075433_10225173 3300006852 Bacteria 1666
65 Ga0075434_100000541 3300006871 Bacteria 28796
66 Ga0075434_100009704 3300006871 Bacteria 8995
67 Ga0075434_100150260 3300006871 Bacteria 2349
68 Ga0075434_100191575 3300006871 Unclassified 2065
69 Ga0075429_100074865 3300006880 Bacteria 2949
70 Ga0075429_100341519 3300006880 Unclassified 1311
71 Ga0075429_101083758 3300006880 Unclassified 700
72 Ga0075436_100339948 3300006914 Bacteria 1080
73 Ga0075436_100637584 3300006914 Unclassified 786
74 Ga0097620_100282796 3300006931 Bacteria 1752
75 Ga0097620_100551745 3300006931 Bacteria 1247
76 Ga0075435_100034259 3300007076 Bacteria 4022
77 Ga0075435_100251130 3300007076 Bacteria 1506
78 Ga0099795_10077586 3300007788 Bacteria 1265
79 Ga0111539_10131026 3300009094 Bacteria 2936
80 Ga0114129_10219808 3300009147 Bacteria 2563
81 Ga0114129_10656856 3300009147 Bacteria 1353
82 Ga0114129_11587841 3300009147 Unclassified 801
83 Ga0105248_10187506 3300009177 Bacteria 2331
84 Ga0157378_10213684 3300013297 Bacteria 1830
85 Ga0157375_10865188 3300013308 Bacteria 1050
86 Ga0157380_10044161 3300014326 Bacteria 3491
87 Ga0157379_11293858 3300014968 Unclassified 704
88 Ga0163161_10773387 3300017792 Unclassified 805
89 Ga0207660_10785689 3300025917 Unclassified 777
90 Ga0207660_10922829 3300025917 Bacteria 712
91 Ga0207646_11126389 3300025922 Bacteria 690
92 Ga0207681_10055256 3300025923 Bacteria 2704
93 Ga0207650_10597523 3300025925 Unclassified 928
94 Ga0207644_10474719 3300025931 Unclassified 1029
95 Ga0207706_10364605 3300025933 Unclassified 1255
96 Ga0207670_10184277 3300025936 Unclassified 1575
97 Ga0207691_10020995 3300025940 Bacteria 6173
98 Ga0207711_10314611 3300025941 Bacteria 1446
99 Ga0207711_10358437 3300025941 Bacteria 1351
100 Ga0207689_10970822 3300025942 Unclassified 717
101 Ga0207651_11503052 3300025960 Unclassified 606
102 Ga0207640_11192079 3300025981 Unclassified 677
103 Ga0207640_11700062 3300025981 Unclassified 570
104 Ga0207708_10654096 3300026075 Unclassified 895
105 Ga0207648_10103624 3300026089 Bacteria 2495
106 Ga0207675_100239292 3300026118 Unclassified 1754
107 Ga0207698_10209843 3300026142 Bacteria 1751
108 Ga0209967_1040664 3300027364 Unclassified 706
109 Ga0210000_1003483 3300027462 Bacteria 2270
110 Ga0207428_10021337 3300027907 Bacteria 5486
111 Ga0207428_10066704 3300027907 Bacteria 2835
112 Ga0268264_10264459 3300028381 Unclassified 1604
113 Ga0268264_11820620 3300028381 Bacteria 619
114 Ga0307408_100135371 3300031548 Unclassified 1927
115 Ga0307408_100633717 3300031548 Unclassified 954
116 Ga0307408_101149126 3300031548 Bacteria 722
117 Ga0307405_10157017 3300031731 Bacteria 1607
118 Ga0307405_10640434 3300031731 Unclassified 873
119 Ga0307413_10064675 3300031824 Bacteria 2274
120 Ga0307413_10126497 3300031824 Bacteria 1741
121 Ga0307410_10042244 3300031852 Bacteria 3012
122 Ga0307410_10247819 3300031852 Bacteria 1384
123 Ga0307406_10115314 3300031901 Bacteria 1857
124 Ga0307406_10155911 3300031901 Bacteria 1635
125 Ga0307406_10543356 3300031901 Unclassified 949
126 Ga0307407_10312902 3300031903 Bacteria 1099
127 Ga0307412_10458784 3300031911 Bacteria 1052
128 Ga0307409_100107126 3300031995 Bacteria 2334
129 Ga0307409_100227947 3300031995 Bacteria 1686
130 Ga0307409_100307959 3300031995 Unclassified 1477
131 Ga0307416_100037918 3300032002 Bacteria 3713
132 Ga0307416_100075654 3300032002 Bacteria 2818
133 Ga0307416_100608629 3300032002 Bacteria 1173
134 Ga0307414_10101419 3300032004 Bacteria 2167
135 Ga0307414_10489783 3300032004 Bacteria 1086
136 Ga0307414_10690614 3300032004 Unclassified 923
137 Ga0307411_10018125 3300032005 Bacteria 4031
138 Ga0307411_10122977 3300032005 Unclassified 1881
139 Ga0307415_100343043 3300032126 Bacteria 1254
140 Ga0307415_100416465 3300032126 Unclassified 1151
141 Ga0373954_0009837 3300035118 Bacteria 4209
142 Ga0373935_0002953 3300035692 Bacteria 9802
143 Ga0395905_0093022 3300037471 Bacteria 2828
144 Ga0395905_0634903 3300037471 Unclassified 970
145 Ga0439462_0027969 3300042015 Unclassified 1489
146 Ga0439434_0041250 3300042435 Unclassified 1418
147 Ga0451577_0029533 3300042876 Bacteria 4956
148 Ga0453684_0845160 3300044712 Unclassified 984
149 Ga0451576_0199807 3300045051 Unclassified 2088
150 Ga0451576_0848744 3300045051 Unclassified 959
151 Ga0495645_0787611 3300046543 Unclassified 571
152 Ga0496100_0496962 3300048903 Unclassified 939
153 Ga0496104_0308606 3300048907 Bacteria 1495
154 Ga0501292_082448 3300049515 Bacteria 614
155 Ga0501293_018254 3300049516 Unclassified 668
156 Ga0501075_1034061 3300049591 Unclassified 624
157 Ga0501077_0442902 3300049593 Bacteria 832
158 Ga0501199_018455 3300049650 Unclassified 796
159 Ga0501202_066883 3300049652 Unclassified 822
160 Ga0501216_029334 3300049660 Unclassified 1008
161 Ga0501239_007468 3300049672 Unclassified 1147
162 Ga0501252_015672 3300049682 Unclassified 948
163 Ga0501229_029375 3300049706 Unclassified 750
164 Ga0501234_026450 3300049707 Unclassified 932
165 Ga0501080_0175238 3300049742 Bacteria 1976
166 Ga0501080_0612725 3300049742 Bacteria 966
167 Ga0501263_010656 3300049760 Unclassified 1131
168 Ga0501267_020974 3300049764 Unclassified 722
169 Ga0501271_038114 3300049768 Unclassified 617
170 nmdc:mga05p37_17815_c2 3300050507 Bacteria 3275
171 nmdc:mga05p37_762200_c1 3300050507 Unclassified 1065
172 nmdc:mga05p37_844898_c1 3300050507 Bacteria 995
173 nmdc:mga05p37_851563_c1 3300050507 Bacteria 990
174 nmdc:mga0qj67_463718_c1 3300050509 Bacteria 1020
175 nmdc:mga0qj67_56549_c1 3300050509 Bacteria 3109
176 nmdc:mga06r32_1095616_c1 3300050510 Unclassified 746
177 nmdc:mga06r32_1111156_c1 3300050510 Unclassified 739
178 nmdc:mga06r32_130169_c1 3300050510 Bacteria 2488
179 nmdc:mga06r32_27123_c1 3300050510 Bacteria 5347
180 nmdc:mga06r32_907092_c1 3300050510 Unclassified 837
181 nmdc:mga08y16_11521_c1 3300050511 Bacteria 9291
182 nmdc:mga08y16_1413528_c1 3300050511 Unclassified 659
183 nmdc:mga08y16_1426800_c1 3300050511 Unclassified 655
184 nmdc:mga08y16_412192_c1 3300050511 Unclassified 1382
185 nmdc:mga0n895_178299_c1 3300050512 Bacteria 2156
186 nmdc:mga0n895_2966_c1 3300050512 Bacteria 13466
187 nmdc:mga0n895_432038_c1 3300050512 Bacteria 1331
188 nmdc:mga0n895_470652_c1 3300050512 Unclassified 1268
189 nmdc:mga0rr50_13533_c1 3300050513 Bacteria 5316
190 nmdc:mga0rr50_42769_c1 3300050513 Bacteria 3311
191 nmdc:mga08x19_14627_c1 3300050514 Bacteria 4763
192 nmdc:mga08x19_64345_c1 3300050514 Bacteria 2381
193 nmdc:mga0a205_234649_c1 3300050515 Bacteria 1717
194 nmdc:mga0a205_7400_c1 3300050515 Bacteria 9944
195 nmdc:mga0a205_905389_c1 3300050515 Unclassified 729
196 nmdc:mga0a205_93567_c1 3300050515 Bacteria 2904
197 Ga0501084_0250947 3300054114 Bacteria 1494
198 Ga0590071_051041 3300059421 Bacteria 1003
199 Ga0590075_128945 3300059424 Bacteria 664
200 Ga0530510_0256385 3300061734 Bacteria 1304

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006871 Ga0075434_100150260 Ga0075434_1001502602 137
2 3300050507 nmdc:mga05p37_844898_c1 nmdc:mga05p37_844898_c1_184_597 137
3 3300050515 nmdc:mga0a205_93567_c1 nmdc:mga0a205_93567_c1_1053_1466 137
4 3300059424 Ga0590075_128945 Ga0590075_128945_85_531 143
5 3300007076 Ga0075435_100251130 Ga0075435_1002511302 144
6 3300006847 Ga0075431_100477342 Ga0075431_1004773422 146
7 3300050510 nmdc:mga06r32_1111156_c1 nmdc:mga06r32_1111156_c1_75_515 146
8 3300005289 Ga0065704_10531495 Ga0065704_105314951 147
9 3300005546 Ga0070696_100012632 Ga0070696_1000126324 147
10 3300006852 Ga0075433_10225173 Ga0075433_102251732 147
11 3300014326 Ga0157380_10044161 Ga0157380_100441613 147
12 3300005293 Ga0065715_10395047 Ga0065715_103950471 148
13 3300005295 Ga0065707_10207461 Ga0065707_102074611 148
14 3300005336 Ga0070680_100230458 Ga0070680_1002304583 148
15 3300005353 Ga0070669_100460399 Ga0070669_1004603991 148
16 3300005365 Ga0070688_100143693 Ga0070688_1001436933 148
17 3300005444 Ga0070694_100107808 Ga0070694_1001078084 148
18 3300005471 Ga0070698_100092137 Ga0070698_1000921373 148
19 3300005471 Ga0070698_100988267 Ga0070698_1009882671 148
20 3300005530 Ga0070679_101022803 Ga0070679_1010228031 148
21 3300005549 Ga0070704_100183358 Ga0070704_1001833583 148
22 3300006852 Ga0075433_10000037 Ga0075433_100000377 148
23 3300006871 Ga0075434_100000541 Ga0075434_10000054120 148
24 3300007076 Ga0075435_100034259 Ga0075435_1000342593 148
25 3300025917 Ga0207660_10785689 Ga0207660_107856891 148
26 3300025917 Ga0207660_10922829 Ga0207660_109228291 148
27 3300025981 Ga0207640_11700062 Ga0207640_117000621 148
28 3300027364 Ga0209967_1040664 Ga0209967_10406641 148
29 3300027462 Ga0210000_1003483 Ga0210000_10034832 148
30 3300031548 Ga0307408_100633717 Ga0307408_1006337172 148
31 3300031852 Ga0307410_10247819 Ga0307410_102478192 148
32 3300031903 Ga0307407_10312902 Ga0307407_103129022 148
33 3300031995 Ga0307409_100227947 Ga0307409_1002279472 148
34 3300032002 Ga0307416_100608629 Ga0307416_1006086292 148
35 3300032004 Ga0307414_10489783 Ga0307414_104897832 148
36 3300032126 Ga0307415_100343043 Ga0307415_1003430432 148
37 3300048903 Ga0496100_0496962 Ga0496100_0496962_440_886 148
38 3300048907 Ga0496104_0308606 Ga0496104_0308606_556_1002 148
39 3300050511 nmdc:mga08y16_1426800_c1 nmdc:mga08y16_1426800_c1_32_478 148
40 3300050512 nmdc:mga0n895_2966_c1 nmdc:mga0n895_2966_c1_5680_6138 148
41 3300050513 nmdc:mga0rr50_13533_c1 nmdc:mga0rr50_13533_c1_2072_2530 148
42 3300050515 nmdc:mga0a205_7400_c1 nmdc:mga0a205_7400_c1_4484_4942 148
43 3300003316 rootH1_10128128 rootH1_101281282 149
44 3300003322 rootL2_10204124 rootL2_102041242 149
45 3300005295 Ga0065707_10116428 Ga0065707_101164284 149
46 3300005444 Ga0070694_100026258 Ga0070694_1000262584 149
47 3300005518 Ga0070699_100024213 Ga0070699_1000242133 149
48 3300005545 Ga0070695_101013811 Ga0070695_1010138111 149
49 3300006844 Ga0075428_100249581 Ga0075428_1002495812 149
50 3300006846 Ga0075430_100104252 Ga0075430_1001042522 149
51 3300006847 Ga0075431_100088930 Ga0075431_1000889302 149
52 3300006847 Ga0075431_100324012 Ga0075431_1003240122 149
53 3300006880 Ga0075429_100074865 Ga0075429_1000748652 149
54 3300006880 Ga0075429_100341519 Ga0075429_1003415191 149
55 3300009147 Ga0114129_10219808 Ga0114129_102198082 149
56 3300049591 Ga0501075_1034061 Ga0501075_1034061_104_559 149
57 3300049742 Ga0501080_0175238 Ga0501080_0175238_1454_1909 149
58 3300050507 nmdc:mga05p37_851563_c1 nmdc:mga05p37_851563_c1_211_672 149
59 3300050509 nmdc:mga0qj67_463718_c1 nmdc:mga0qj67_463718_c1_392_841 149
60 3300050510 nmdc:mga06r32_1095616_c1 nmdc:mga06r32_1095616_c1_233_682 149
61 3300050510 nmdc:mga06r32_907092_c1 nmdc:mga06r32_907092_c1_86_535 149
62 3300005471 Ga0070698_100137696 Ga0070698_1001376964 150
63 3300006846 Ga0075430_100065408 Ga0075430_1000654084 150
64 3300006846 Ga0075430_100829618 Ga0075430_1008296181 150
65 3300031911 Ga0307412_10458784 Ga0307412_104587842 150
66 3300035692 Ga0373935_0002953 Ga0373935_0002953_8726_9178 150
67 3300042876 Ga0451577_0029533 Ga0451577_0029533_3182_3634 150
68 3300044712 Ga0453684_0845160 Ga0453684_0845160_220_672 150
69 3300045051 Ga0451576_0199807 Ga0451576_0199807_1293_1754 150
70 3300046543 Ga0495645_0787611 Ga0495645_0787611_22_474 150
71 3300050509 nmdc:mga0qj67_56549_c1 nmdc:mga0qj67_56549_c1_1339_1797 150
72 3300050510 nmdc:mga06r32_130169_c1 nmdc:mga06r32_130169_c1_1544_1996 150
73 3300050511 nmdc:mga08y16_412192_c1 nmdc:mga08y16_412192_c1_109_561 150
74 3300061734 Ga0530510_0256385 Ga0530510_0256385_272_724 150
75 3300005468 Ga0070707_100102317 Ga0070707_1001023171 151
76 3300005536 Ga0070697_100149338 Ga0070697_1001493382 151
77 3300005536 Ga0070697_100565773 Ga0070697_1005657732 151
78 3300006847 Ga0075431_100140098 Ga0075431_1001400984 151
79 3300006914 Ga0075436_100339948 Ga0075436_1003399481 151
80 3300007788 Ga0099795_10077586 Ga0099795_100775862 151
81 3300045051 Ga0451576_0848744 Ga0451576_0848744_310_786 151
82 3300050511 nmdc:mga08y16_1413528_c1 nmdc:mga08y16_1413528_c1_89_544 151
83 3300050514 nmdc:mga08x19_64345_c1 nmdc:mga08x19_64345_c1_382_837 151
84 2162886012 MBSR1b_contig_2606717 MBSR1b_0132.00007080 152
85 3300005293 Ga0065715_10111742 Ga0065715_101117422 152
86 3300005295 Ga0065707_10218262 Ga0065707_102182621 152
87 3300005328 Ga0070676_10239796 Ga0070676_102397962 152
88 3300005338 Ga0068868_100256358 Ga0068868_1002563582 152
89 3300005353 Ga0070669_100140469 Ga0070669_1001404692 152
90 3300005355 Ga0070671_100179101 Ga0070671_1001791013 152
91 3300005364 Ga0070673_100293485 Ga0070673_1002934852 152
92 3300005367 Ga0070667_100085232 Ga0070667_1000852324 152
93 3300005367 Ga0070667_101917063 Ga0070667_1019170631 152
94 3300005441 Ga0070700_100218562 Ga0070700_1002185622 152
95 3300005444 Ga0070694_100448682 Ga0070694_1004486822 152
96 3300005444 Ga0070694_100465703 Ga0070694_1004657032 152
97 3300005457 Ga0070662_100138427 Ga0070662_1001384273 152
98 3300005466 Ga0070685_10417943 Ga0070685_104179432 152
99 3300005468 Ga0070707_100349034 Ga0070707_1003490342 152
100 3300005518 Ga0070699_100153548 Ga0070699_1001535482 152
101 3300005543 Ga0070672_100161982 Ga0070672_1001619823 152
102 3300005546 Ga0070696_100002798 Ga0070696_10000279810 152
103 3300005549 Ga0070704_100356997 Ga0070704_1003569972 152
104 3300005615 Ga0070702_100063300 Ga0070702_1000633002 152
105 3300005617 Ga0068859_100282788 Ga0068859_1002827882 152
106 3300005617 Ga0068859_100551778 Ga0068859_1005517782 152
107 3300005719 Ga0068861_100289930 Ga0068861_1002899301 152
108 3300005841 Ga0068863_101437743 Ga0068863_1014377432 152
109 3300005843 Ga0068860_101885747 Ga0068860_1018857471 152
110 3300006358 Ga0068871_100818359 Ga0068871_1008183592 152
111 3300006844 Ga0075428_100154023 Ga0075428_1001540232 152
112 3300006844 Ga0075428_100344436 Ga0075428_1003444363 152
113 3300006847 Ga0075431_100029741 Ga0075431_1000297413 152
114 3300006847 Ga0075431_100806491 Ga0075431_1008064912 152
115 3300006852 Ga0075433_10033368 Ga0075433_100333682 152
116 3300006871 Ga0075434_100009704 Ga0075434_1000097044 152
117 3300006871 Ga0075434_100191575 Ga0075434_1001915753 152
118 3300006880 Ga0075429_101083758 Ga0075429_1010837582 152
119 3300006914 Ga0075436_100637584 Ga0075436_1006375842 152
120 3300006931 Ga0097620_100282796 Ga0097620_1002827962 152
121 3300006931 Ga0097620_100551745 Ga0097620_1005517452 152
122 3300009094 Ga0111539_10131026 Ga0111539_101310262 152
123 3300009147 Ga0114129_10656856 Ga0114129_106568561 152
124 3300009147 Ga0114129_11587841 Ga0114129_115878412 152
125 3300009177 Ga0105248_10187506 Ga0105248_101875063 152
126 3300013297 Ga0157378_10213684 Ga0157378_102136842 152
127 3300013308 Ga0157375_10865188 Ga0157375_108651882 152
128 3300014968 Ga0157379_11293858 Ga0157379_112938582 152
129 3300017792 Ga0163161_10773387 Ga0163161_107733872 152
130 3300025922 Ga0207646_11126389 Ga0207646_111263892 152
131 3300025923 Ga0207681_10055256 Ga0207681_100552561 152
132 3300025925 Ga0207650_10597523 Ga0207650_105975232 152
133 3300025931 Ga0207644_10474719 Ga0207644_104747192 152
134 3300025933 Ga0207706_10364605 Ga0207706_103646052 152
135 3300025936 Ga0207670_10184277 Ga0207670_101842773 152
136 3300025940 Ga0207691_10020995 Ga0207691_100209959 152
137 3300025941 Ga0207711_10314611 Ga0207711_103146111 152
138 3300025941 Ga0207711_10358437 Ga0207711_103584372 152
139 3300025942 Ga0207689_10970822 Ga0207689_109708222 152
140 3300025960 Ga0207651_11503052 Ga0207651_115030521 152
141 3300025981 Ga0207640_11192079 Ga0207640_111920792 152
142 3300026075 Ga0207708_10654096 Ga0207708_106540962 152
143 3300026089 Ga0207648_10103624 Ga0207648_101036242 152
144 3300026118 Ga0207675_100239292 Ga0207675_1002392924 152
145 3300026142 Ga0207698_10209843 Ga0207698_102098433 152
146 3300027907 Ga0207428_10021337 Ga0207428_100213374 152
147 3300027907 Ga0207428_10066704 Ga0207428_100667042 152
148 3300028381 Ga0268264_10264459 Ga0268264_102644592 152
149 3300028381 Ga0268264_11820620 Ga0268264_118206202 152
150 3300031548 Ga0307408_100135371 Ga0307408_1001353712 152
151 3300031548 Ga0307408_101149126 Ga0307408_1011491261 152
152 3300031731 Ga0307405_10157017 Ga0307405_101570172 152
153 3300031731 Ga0307405_10640434 Ga0307405_106404342 152
154 3300031824 Ga0307413_10064675 Ga0307413_100646752 152
155 3300031824 Ga0307413_10126497 Ga0307413_101264972 152
156 3300031852 Ga0307410_10042244 Ga0307410_100422442 152
157 3300031901 Ga0307406_10115314 Ga0307406_101153142 152
158 3300031901 Ga0307406_10155911 Ga0307406_101559111 152
159 3300031901 Ga0307406_10543356 Ga0307406_105433562 152
160 3300031995 Ga0307409_100107126 Ga0307409_1001071262 152
161 3300031995 Ga0307409_100307959 Ga0307409_1003079593 152
162 3300032002 Ga0307416_100037918 Ga0307416_1000379184 152
163 3300032002 Ga0307416_100075654 Ga0307416_1000756542 152
164 3300032004 Ga0307414_10101419 Ga0307414_101014192 152
165 3300032004 Ga0307414_10690614 Ga0307414_106906142 152
166 3300032005 Ga0307411_10018125 Ga0307411_100181253 152
167 3300032005 Ga0307411_10122977 Ga0307411_101229772 152
168 3300032126 Ga0307415_100416465 Ga0307415_1004164651 152
169 3300035118 Ga0373954_0009837 Ga0373954_0009837_1977_2456 152
170 3300037471 Ga0395905_0093022 Ga0395905_0093022_816_1304 152
171 3300037471 Ga0395905_0634903 Ga0395905_0634903_113_607 152
172 3300042015 Ga0439462_0027969 Ga0439462_0027969_498_1013 152
173 3300042435 Ga0439434_0041250 Ga0439434_0041250_517_1032 152
174 3300049515 Ga0501292_082448 Ga0501292_082448_145_603 152
175 3300049516 Ga0501293_018254 Ga0501293_018254_18_476 152
176 3300049593 Ga0501077_0442902 Ga0501077_0442902_307_801 152
177 3300049650 Ga0501199_018455 Ga0501199_018455_83_541 152
178 3300049652 Ga0501202_066883 Ga0501202_066883_72_530 152
179 3300049660 Ga0501216_029334 Ga0501216_029334_498_956 152
180 3300049672 Ga0501239_007468 Ga0501239_007468_561_1019 152
181 3300049682 Ga0501252_015672 Ga0501252_015672_178_636 152
182 3300049706 Ga0501229_029375 Ga0501229_029375_66_524 152
183 3300049707 Ga0501234_026450 Ga0501234_026450_40_498 152
184 3300049742 Ga0501080_0612725 Ga0501080_0612725_322_816 152
185 3300049760 Ga0501263_010656 Ga0501263_010656_181_639 152
186 3300049764 Ga0501267_020974 Ga0501267_020974_227_685 152
187 3300049768 Ga0501271_038114 Ga0501271_038114_135_593 152
188 3300050507 nmdc:mga05p37_17815_c2 nmdc:mga05p37_17815_c2_2774_3247 152
189 3300050507 nmdc:mga05p37_762200_c1 nmdc:mga05p37_762200_c1_462_926 152
190 3300050510 nmdc:mga06r32_27123_c1 nmdc:mga06r32_27123_c1_4331_4804 152
191 3300050511 nmdc:mga08y16_11521_c1 nmdc:mga08y16_11521_c1_3788_4297 152
192 3300050512 nmdc:mga0n895_178299_c1 nmdc:mga0n895_178299_c1_347_820 152
193 3300050512 nmdc:mga0n895_432038_c1 nmdc:mga0n895_432038_c1_534_992 152
194 3300050512 nmdc:mga0n895_470652_c1 nmdc:mga0n895_470652_c1_246_704 152
195 3300050513 nmdc:mga0rr50_42769_c1 nmdc:mga0rr50_42769_c1_1689_2147 152
196 3300050514 nmdc:mga08x19_14627_c1 nmdc:mga08x19_14627_c1_653_1111 152
197 3300050515 nmdc:mga0a205_234649_c1 nmdc:mga0a205_234649_c1_137_610 152
198 3300050515 nmdc:mga0a205_905389_c1 nmdc:mga0a205_905389_c1_116_574 152
199 3300054114 Ga0501084_0250947 Ga0501084_0250947_768_1262 152
200 3300059421 Ga0590071_051041 Ga0590071_051041_368_838 152

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12867

DinB_2

DinB superfamily

11

138

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rxq-assembly1.cif.gz_B yfit from bacillus subtilis is a probable metal-dependent hydrolase with an unusual four-helix bundle topology 0.867 2 152
1rxq-assembly1.cif.gz_B yfit from bacillus subtilis is a probable metal-dependent hydrolase with an unusual four-helix bundle topology 0.8568 2 152
2rd9-assembly3.cif.gz_B crystal structure of a putative yfit-like metal-dependent hydrolase (bh0186) from bacillus halodurans c-125 at 2.30 a resolution 0.7883 2 146
2yqy-assembly1.cif.gz_A crystal structure of tt2238, a four-helix bundle protein 0.7764 2 144
2yqy-assembly2.cif.gz_B crystal structure of tt2238, a four-helix bundle protein 0.7675 2 143
ID Description Score Start End Superfamily
1rxqD00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8914 2 150 1.20.120.450
1rxqD00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8698 2 150 1.20.120.450
2yqyB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7675 2 143 1.20.120.450
2rd9B01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.765 2 150 1.20.120.450
2rd9B01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7385 2 150 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A3A0CQM1-F1-model_v4 Metal-dependent hydrolase 0.9953 1 146 GO:0016787
AF-A0A286IV73-F1-model_v4 DinB superfamily protein 0.9884 1 147
AF-A0A2V7KS94-F1-model_v4 Metal-dependent hydrolase 0.9829 1 150 GO:0016787
AF-A0A2V7EK25-F1-model_v4 Metal-dependent hydrolase 0.9827 5 150 GO:0016787
AF-A0A1Q7PT64-F1-model_v4 DinB-like domain-containing protein 0.9824 6 133

Feature Viewer

pLDDT pTM Quality
95.49 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map