F307624

General Info

Members Datasets Scaffolds Average Seq Length
200 122 400 152

Family's Representative Sequence

Representative Sequence 3300046516|Ga0495628_0017621|Ga0495628_0017621_1534_2076
Length 180
Sequence MIKDRSAAKDIVPWTPFEWGALFLSELELSVNSVQIEQKSYEMPPRDGFSVAYFLTVADVDRSARFYETVFGGRILSRGDSNGAPGYIQMANAWLIVNVGGGPTPEKPSVTLSVPDPDKMSSFMNIRVADIQASYELWRSRGAEFITEPREKYGETFCYMRDPDGYIIEVGQSKPDFTYG

Samples

Sample ID Description Type Environment
1 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
15 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
16 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
17 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
18 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
19 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
20 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
24 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
27 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
32 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
33 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
34 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
35 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
36 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
37 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
38 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
39 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
40 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
61 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
62 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
63 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
64 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
65 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
67 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
68 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
69 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
70 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
71 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
72 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
73 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
74 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
75 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
76 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
77 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
78 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
79 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
80 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
81 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
82 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
86 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
87 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
88 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
89 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
90 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
91 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
92 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
93 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
94 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
95 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
96 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
97 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
98 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
99 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
100 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
101 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
102 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
103 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
104 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
105 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
106 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
107 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
108 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
109 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
110 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
111 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
112 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
113 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
114 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
115 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
116 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
117 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
118 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
119 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
120 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
121 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
122 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98
Metatranscriptomes 1
Isolates 1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.5
Nodule 0.5
Rhizoplane 2.5
Rhizosphere 82
Stem 0
Stem Tuber 0
Unclassified 4.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495628_0017621 3300046516 Bacteria 5938
2 JGI25404J52841_10004622 3300003659 Bacteria 2804
3 Ga0070666_10018062 3300005335 Bacteria 4529
4 Ga0068868_100233634 3300005338 Bacteria 1543
5 Ga0070709_11485768 3300005434 Bacteria 550
6 Ga0070713_100004918 3300005436 Bacteria 9067
7 Ga0070713_100019458 3300005436 Bacteria 5185
8 Ga0070713_100189861 3300005436 Bacteria 1851
9 Ga0070713_100809198 3300005436 Bacteria 898
10 Ga0070713_100884787 3300005436 Bacteria 858
11 Ga0070713_101111604 3300005436 Bacteria 764
12 Ga0070710_10282473 3300005437 Bacteria 1077
13 Ga0070710_10496124 3300005437 Unclassified 835
14 Ga0070711_100204565 3300005439 Bacteria 1525
15 Ga0070663_102019700 3300005455 Bacteria 519
16 Ga0070697_100043711 3300005536 Bacteria 3628
17 Ga0070665_100216696 3300005548 Bacteria 1915
18 Ga0068855_100020242 3300005563 Bacteria 7988
19 Ga0068855_100031179 3300005563 Bacteria 6367
20 Ga0068855_100510738 3300005563 Bacteria 1305
21 Ga0068855_100517086 3300005563 Bacteria 1295
22 Ga0068856_100010369 3300005614 Bacteria 9052
23 Ga0068856_100883886 3300005614 Bacteria 912
24 Ga0068852_100004364 3300005616 Bacteria 9990
25 Ga0068866_10419235 3300005718 Bacteria 868
26 Ga0070717_10561622 3300006028 Bacteria 1034
27 Ga0070715_10205986 3300006163 Bacteria 1002
28 Ga0070716_100255603 3300006173 Bacteria 1196
29 Ga0070712_100342420 3300006175 Bacteria 1221
30 Ga0097621_100163556 3300006237 Bacteria 1914
31 Ga0099795_10008374 3300007788 Bacteria 2946
32 Ga0105240_10000119 3300009093 Bacteria 163675
33 Ga0105240_10001985 3300009093 Bacteria 33800
34 Ga0105240_10114584 3300009093 Bacteria 3256
35 Ga0105240_10390035 3300009093 Bacteria 1571
36 Ga0105240_10628758 3300009093 Bacteria 1179
37 Ga0105247_10002504 3300009101 Bacteria 12484
38 Ga0105237_10032828 3300009545 Bacteria 5256
39 Ga0105237_10329928 3300009545 Bacteria 1530
40 Ga0105237_10623717 3300009545 Bacteria 1085
41 Ga0105238_10027464 3300009551 Bacteria 5801
42 Ga0105238_10199208 3300009551 Bacteria 1978
43 Ga0105238_10234642 3300009551 Bacteria 1811
44 Ga0105238_10569279 3300009551 Bacteria 1138
45 Ga0105249_10044438 3300009553 Bacteria 4040
46 Ga0099796_10369309 3300010159 Bacteria 622
47 Ga0105239_10030939 3300010375 Bacteria 5888
48 Ga0157370_11148392 3300013104 Unclassified 701
49 Ga0157369_10081621 3300013105 Bacteria 3460
50 Ga0157374_10000029 3300013296 Bacteria 211547
51 Ga0157374_10035790 3300013296 Bacteria 4544
52 Ga0157378_10520783 3300013297 Bacteria 1191
53 Ga0163162_10001491 3300013306 Bacteria 21814
54 Ga0157375_10904445 3300013308 Bacteria 1026
55 Ga0157379_10651300 3300014968 Bacteria 986
56 Ga0157376_10005784 3300014969 Bacteria 8664
57 Ga0157376_10748514 3300014969 Bacteria 986
58 Ga0213874_10104424 3300021377 Bacteria 946
59 Ga0213876_10319798 3300021384 Bacteria 825
60 Ga0213871_10015530 3300021441 Bacteria 1823
61 Ga0209455_1006350 3300025272 Bacteria 3501
62 Ga0209050_1072411 3300025298 Bacteria 764
63 Ga0207697_10010286 3300025315 Bacteria 4005
64 Ga0207692_10532716 3300025898 Unclassified 749
65 Ga0207710_10033677 3300025900 Bacteria 2248
66 Ga0207680_10000788 3300025903 Bacteria 14969
67 Ga0207699_10141060 3300025906 Bacteria 1584
68 Ga0207699_10603032 3300025906 Bacteria 800
69 Ga0207695_10000139 3300025913 Bacteria 216873
70 Ga0207695_10001631 3300025913 Bacteria 36265
71 Ga0207695_10074320 3300025913 Bacteria 3460
72 Ga0207695_10423618 3300025913 Bacteria 1215
73 Ga0207695_10458899 3300025913 Bacteria 1157
74 Ga0207671_10003901 3300025914 Bacteria 14538
75 Ga0207671_10049875 3300025914 Bacteria 3099
76 Ga0207671_10092122 3300025914 Bacteria 2285
77 Ga0207671_10485713 3300025914 Unclassified 984
78 Ga0207693_10269581 3300025915 Bacteria 1334
79 Ga0207693_10303104 3300025915 Bacteria 1251
80 Ga0207663_10031012 3300025916 Unclassified 3159
81 Ga0207663_10516074 3300025916 Bacteria 930
82 Ga0207694_10080500 3300025924 Bacteria 2556
83 Ga0207694_10165779 3300025924 Bacteria 1787
84 Ga0207694_10379304 3300025924 Bacteria 1173
85 Ga0207694_11154718 3300025924 Bacteria 655
86 Ga0207700_10064134 3300025928 Bacteria 2797
87 Ga0207665_10216940 3300025939 Bacteria 1400
88 Ga0207665_11124993 3300025939 Bacteria 626
89 Ga0207667_10025888 3300025949 Bacteria 6418
90 Ga0207667_10085596 3300025949 Bacteria 3263
91 Ga0207667_10471397 3300025949 Bacteria 1275
92 Ga0207667_10521720 3300025949 Bacteria 1203
93 Ga0207712_10023457 3300025961 Bacteria 4071
94 Ga0207702_10004019 3300026078 Bacteria 13211
95 Ga0207702_11063104 3300026078 Bacteria 803
96 Ga0207674_11283629 3300026116 Bacteria 702
97 Ga0207698_10241124 3300026142 Bacteria 1648
98 Ga0268266_10167657 3300028379 Bacteria 1991
99 Ga0268266_10558251 3300028379 Bacteria 1098
100 Ga0265318_10397493 3300028577 Bacteria 503
101 Ga0265336_10000741 3300028666 Bacteria 17321
102 Ga0265336_10136302 3300028666 Bacteria 730
103 Ga0307517_10031050 3300028786 Bacteria 6235
104 Ga0265338_10000499 3300028800 Bacteria 70016
105 Ga0265338_10073619 3300028800 Bacteria 2910
106 Ga0265770_1013784 3300030878 Bacteria 1213
107 Ga0265760_10021037 3300031090 Bacteria 1885
108 Ga0265325_10059509 3300031241 Unclassified 1942
109 Ga0265340_10027094 3300031247 Bacteria 2891
110 Ga0265340_10073088 3300031247 Bacteria 1623
111 Ga0265340_10472096 3300031247 Bacteria 552
112 Ga0307509_10703801 3300031507 Bacteria 677
113 Ga0307516_10025970 3300031730 Bacteria 5955
114 Ga0307516_10030599 3300031730 Bacteria 5431
115 Ga0307510_10001320 3300033180 Bacteria 27047
116 Ga0316212_1043158 3300033547 Bacteria 639
117 Ga0373934_0186485 3300035086 Bacteria 853
118 Ga0373936_0018888 3300035113 Bacteria 2667
119 Ga0373954_0246037 3300035118 Bacteria 880
120 Ga0373955_0161562 3300035172 Bacteria 1323
121 Ga0373955_0250421 3300035172 Bacteria 1062
122 Ga0373924_0041153 3300035410 Bacteria 1893
123 Ga0373924_0400289 3300035410 Bacteria 614
124 Ga0373935_0020638 3300035692 Bacteria 4027
125 Ga0373935_0128774 3300035692 Bacteria 1699
126 Ga0373927_0018864 3300035695 Bacteria 4526
127 Ga0373933_0050608 3300035724 Bacteria 2481
128 Ga0373947_0234576 3300035725 Bacteria 1209
129 Ga0373947_0689829 3300035725 Bacteria 697
130 Ga0373937_0014006 3300036401 Bacteria 7072
131 Ga0373937_0972717 3300036401 Bacteria 797
132 Ga0373937_1207451 3300036401 Bacteria 705
133 Ga0373937_1310122 3300036401 Bacteria 672
134 Ga0373925_0161193 3300037068 Bacteria 1767
135 Ga0373925_0169579 3300037068 Bacteria 1723
136 Ga0373925_0507347 3300037068 Bacteria 990
137 Ga0373925_1145220 3300037068 Bacteria 640
138 Ga0373925_1493193 3300037068 Bacteria 553
139 Ga0395898_0690461 3300037466 Bacteria 963
140 Ga0395898_1069365 3300037466 Bacteria 741
141 Ga0395905_0016798 3300037471 Bacteria 6953
142 Ga0395905_0054189 3300037471 Bacteria 3753
143 Ga0436364_1125289 3300037853 Unclassified 932
144 Ga0436364_1166341 3300037853 Bacteria 1507
145 Ga0436364_1330499 3300037853 Bacteria 1026
146 Ga0436364_1442494 3300037853 Bacteria 4930
147 Ga0436365_0115233 3300039437 Bacteria 1030
148 Ga0436360_0037145 3300039438 Bacteria 702
149 Ga0436360_0505877 3300039438 Bacteria 630
150 Ga0436360_0603822 3300039438 Bacteria 1231
151 Ga0436361_0669667 3300039447 Bacteria 655
152 Ga0436361_0911010 3300039447 Bacteria 665
153 Ga0436361_0981192 3300039447 Bacteria 1803
154 Ga0436361_1160788 3300039447 Bacteria 3541
155 Ga0436363_0416602 3300039450 Bacteria 4021
156 Ga0436363_0839402 3300039450 Bacteria 611
157 Ga0436363_1241794 3300039450 Bacteria 1073
158 Ga0436363_1243562 3300039450 Unclassified 1016
159 Ga0436363_1449454 3300039450 Bacteria 1044
160 Ga0436362_0796840 3300039453 Bacteria 802
161 Ga0451853_0315389 3300041512 Bacteria 559
162 Ga0466963_0121969 3300044694 Bacteria 1795
163 Ga0451576_1241837 3300045051 Bacteria 778
164 Ga0495592_0235271 3300046454 Bacteria 1218
165 Ga0495664_0039298 3300046477 Bacteria 2795
166 Ga0495585_0075898 3300046492 Bacteria 1827
167 Ga0495606_0070516 3300046507 Bacteria 2203
168 Ga0495630_0030596 3300046517 Bacteria 4006
169 Ga0495630_0211562 3300046517 Bacteria 1480
170 Ga0495630_1306132 3300046517 Bacteria 547
171 Ga0495640_0042381 3300046533 Bacteria 3176
172 Ga0495640_0626410 3300046533 Bacteria 648
173 Ga0495587_0326185 3300046536 Bacteria 857
174 Ga0495624_0210426 3300046690 Bacteria 1180
175 Ga0495674_0024682 3300047319 Bacteria 5518
176 Ga0495674_0105844 3300047319 Bacteria 2389
177 Ga0495674_0648845 3300047319 Bacteria 832
178 Ga0495683_0097848 3300047323 Bacteria 1414
179 Ga0495675_0042910 3300047444 Bacteria 2881
180 Ga0495675_0259799 3300047444 Bacteria 1041
181 Ga0495686_0080337 3300047472 Bacteria 1993
182 Ga0495602_0365549 3300048088 Bacteria 1037
183 Ga0496105_0262578 3300048908 Bacteria 1396
184 Ga0496107_0583404 3300048910 Bacteria 827
185 Ga0496114_0155010 3300048917 Bacteria 1989
186 Ga0496114_1646268 3300048917 Bacteria 530
187 Ga0496115_0117640 3300048918 Bacteria 2186
188 Ga0496126_0191837 3300048929 Bacteria 1730
189 Ga0495601_0002754 3300053077 Bacteria 9981
190 Ga0495601_0285378 3300053077 Bacteria 1076
191 Ga0495612_0026674 3300053078 Bacteria 2321
192 Ga0500635_0000249 3300053080 Bacteria 23486
193 Ga0500595_019281 3300053119 Bacteria 2479
194 Ga0500590_340298 3300053148 Unclassified 542
195 Ga0500619_022128 3300053154 Bacteria 1842
196 Ga0500638_077323 3300053162 Bacteria 1584
197 Ga0500636_0066749 3300053177 Bacteria 2091
198 Ga0500637_0013284 3300053178 Bacteria 4314
199 2503202475 2503198000 Bacteria 6884444
200 2903777344 2903768456 Bacteria 9749579
201 Ga0495628_0017621
202 JGI25404J52841_10004622
203 Ga0070666_10018062
204 Ga0068868_100233634
205 Ga0070709_11485768
206 Ga0070713_100004918
207 Ga0070713_100019458
208 Ga0070713_100189861
209 Ga0070713_100809198
210 Ga0070713_100884787
211 Ga0070713_101111604
212 Ga0070710_10282473
213 Ga0070710_10496124
214 Ga0070711_100204565
215 Ga0070663_102019700
216 Ga0070697_100043711
217 Ga0070665_100216696
218 Ga0068855_100020242
219 Ga0068855_100031179
220 Ga0068855_100510738
221 Ga0068855_100517086
222 Ga0068856_100010369
223 Ga0068856_100883886
224 Ga0068852_100004364
225 Ga0068866_10419235
226 Ga0070717_10561622
227 Ga0070715_10205986
228 Ga0070716_100255603
229 Ga0070712_100342420
230 Ga0097621_100163556
231 Ga0099795_10008374
232 Ga0105240_10000119
233 Ga0105240_10001985
234 Ga0105240_10114584
235 Ga0105240_10390035
236 Ga0105240_10628758
237 Ga0105247_10002504
238 Ga0105237_10032828
239 Ga0105237_10329928
240 Ga0105237_10623717
241 Ga0105238_10027464
242 Ga0105238_10199208
243 Ga0105238_10234642
244 Ga0105238_10569279
245 Ga0105249_10044438
246 Ga0099796_10369309
247 Ga0105239_10030939
248 Ga0157370_11148392
249 Ga0157369_10081621
250 Ga0157374_10000029
251 Ga0157374_10035790
252 Ga0157378_10520783
253 Ga0163162_10001491
254 Ga0157375_10904445
255 Ga0157379_10651300
256 Ga0157376_10005784
257 Ga0157376_10748514
258 Ga0213874_10104424
259 Ga0213876_10319798
260 Ga0213871_10015530
261 Ga0209455_1006350
262 Ga0209050_1072411
263 Ga0207697_10010286
264 Ga0207692_10532716
265 Ga0207710_10033677
266 Ga0207680_10000788
267 Ga0207699_10141060
268 Ga0207699_10603032
269 Ga0207695_10000139
270 Ga0207695_10001631
271 Ga0207695_10074320
272 Ga0207695_10423618
273 Ga0207695_10458899
274 Ga0207671_10003901
275 Ga0207671_10049875
276 Ga0207671_10092122
277 Ga0207671_10485713
278 Ga0207693_10269581
279 Ga0207693_10303104
280 Ga0207663_10031012
281 Ga0207663_10516074
282 Ga0207694_10080500
283 Ga0207694_10165779
284 Ga0207694_10379304
285 Ga0207694_11154718
286 Ga0207700_10064134
287 Ga0207665_10216940
288 Ga0207665_11124993
289 Ga0207667_10025888
290 Ga0207667_10085596
291 Ga0207667_10471397
292 Ga0207667_10521720
293 Ga0207712_10023457
294 Ga0207702_10004019
295 Ga0207702_11063104
296 Ga0207674_11283629
297 Ga0207698_10241124
298 Ga0268266_10167657
299 Ga0268266_10558251
300 Ga0265318_10397493
301 Ga0265336_10000741
302 Ga0265336_10136302
303 Ga0307517_10031050
304 Ga0265338_10000499
305 Ga0265338_10073619
306 Ga0265770_1013784
307 Ga0265760_10021037
308 Ga0265325_10059509
309 Ga0265340_10027094
310 Ga0265340_10073088
311 Ga0265340_10472096
312 Ga0307509_10703801
313 Ga0307516_10025970
314 Ga0307516_10030599
315 Ga0307510_10001320
316 Ga0316212_1043158
317 Ga0373934_0186485
318 Ga0373936_0018888
319 Ga0373954_0246037
320 Ga0373955_0161562
321 Ga0373955_0250421
322 Ga0373924_0041153
323 Ga0373924_0400289
324 Ga0373935_0020638
325 Ga0373935_0128774
326 Ga0373927_0018864
327 Ga0373933_0050608
328 Ga0373947_0234576
329 Ga0373947_0689829
330 Ga0373937_0014006
331 Ga0373937_0972717
332 Ga0373937_1207451
333 Ga0373937_1310122
334 Ga0373925_0161193
335 Ga0373925_0169579
336 Ga0373925_0507347
337 Ga0373925_1145220
338 Ga0373925_1493193
339 Ga0395898_0690461
340 Ga0395898_1069365
341 Ga0395905_0016798
342 Ga0395905_0054189
343 Ga0436364_1125289
344 Ga0436364_1166341
345 Ga0436364_1330499
346 Ga0436364_1442494
347 Ga0436365_0115233
348 Ga0436360_0037145
349 Ga0436360_0505877
350 Ga0436360_0603822
351 Ga0436361_0669667
352 Ga0436361_0911010
353 Ga0436361_0981192
354 Ga0436361_1160788
355 Ga0436363_0416602
356 Ga0436363_0839402
357 Ga0436363_1241794
358 Ga0436363_1243562
359 Ga0436363_1449454
360 Ga0436362_0796840
361 Ga0451853_0315389
362 Ga0466963_0121969
363 Ga0451576_1241837
364 Ga0495592_0235271
365 Ga0495664_0039298
366 Ga0495585_0075898
367 Ga0495606_0070516
368 Ga0495630_0030596
369 Ga0495630_0211562
370 Ga0495630_1306132
371 Ga0495640_0042381
372 Ga0495640_0626410
373 Ga0495587_0326185
374 Ga0495624_0210426
375 Ga0495674_0024682
376 Ga0495674_0105844
377 Ga0495674_0648845
378 Ga0495683_0097848
379 Ga0495675_0042910
380 Ga0495675_0259799
381 Ga0495686_0080337
382 Ga0495602_0365549
383 Ga0496105_0262578
384 Ga0496107_0583404
385 Ga0496114_0155010
386 Ga0496114_1646268
387 Ga0496115_0117640
388 Ga0496126_0191837
389 Ga0495601_0002754
390 Ga0495601_0285378
391 Ga0495612_0026674
392 Ga0500635_0000249
393 Ga0500595_019281
394 Ga0500590_340298
395 Ga0500619_022128
396 Ga0500638_077323
397 Ga0500636_0066749
398 Ga0500637_0013284
399 2503202475
400 2903777344

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

50

170

0.75

PF18029

Glyoxalase_6

Glyoxalase-like domain

52

170

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
1byl-assembly1.cif.gz_A bleomycin resistance protein from streptoalloteichus hindustanus 0.8557 97 143
1bh5-assembly1.cif.gz_B human glyoxalase i q33e, e172q double mutant 0.8406 95 140
7wsz-assembly1.cif.gz_B human glyoxalase i (with c-ter his tag) in glycerol-bound form 0.839 95 140
4kyh-assembly1.cif.gz_A crystal structure of mouse glyoxalase i complexed with zopolrestat 0.8339 95 140
1qip-assembly1.cif.gz_B human glyoxalase i complexed with s-p-nitrobenzyloxycarbonylglutathione 0.8326 95 140
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9152 95 140 3.30.720.110
3sk1A02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8951 100 142 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8695 97 144 3.30.720.110
2pjsB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.844 95 141 3.10.180.10
2qqzB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8346 97 144 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A537E593-F1-model_v4 VOC family protein 0.9722 95 144
AF-A0A328NI79-F1-model_v4 VOC domain-containing protein 0.9634 95 144
AF-A0A2V8R3N7-F1-model_v4 Glyoxalase 0.9502 95 146
AF-A0A411YBP6-F1-model_v4 VOC domain-containing protein 0.9471 95 145
AF-A0A099L0G1-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.9372 95 145 GO:0051213

Map