F307324

General Info

Members Datasets Scaffolds Average Seq Length
200 114 200 116

Family's Representative Sequence

Representative Sequence 3300028563|Ga0265319_1002159|Ga0265319_10021592
Length 133
Sequence MTRRLTRTQGKSSFTWKRMTETTTTESVVGLTTRAIEECKSLLSSPENAGKSFRIYVEQGGCSGMQYGMVFDEKRDGDLVAEQNGFSVLVDAISAQYLRGTVVDFSDALVAGGFKISNPNAKQSCGCGKSFEA

Samples

Sample ID Description Type Environment
1 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
21 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
34 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
37 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
47 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
48 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
49 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
50 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
51 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
52 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
53 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
54 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
55 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
56 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
57 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
58 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
59 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
60 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
61 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
62 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
63 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
64 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
65 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
66 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
67 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
68 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
69 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
70 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
71 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
72 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
73 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
74 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
75 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
76 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
77 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
78 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
80 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
81 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
82 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
83 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
84 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
85 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
86 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
87 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
88 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
89 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
90 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
91 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
92 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
93 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
94 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
95 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
96 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
97 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
98 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
99 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
100 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
101 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
102 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
103 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
104 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
105 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
106 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
107 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
108 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
109 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
110 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
111 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
112 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
113 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
114 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1
Nodule 0
Rhizoplane 1
Rhizosphere 97.5
Stem 0
Stem Tuber 0
Unclassified 0.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1000457 3300000545 Unclassified 2873
2 rootH2_10065146 3300003320 Bacteria 1963
3 Ga0065707_10539772 3300005295 Unclassified 729
4 Ga0070690_100001870 3300005330 Bacteria 11162
5 Ga0070690_100102250 3300005330 Bacteria 1901
6 Ga0070680_101724583 3300005336 Unclassified 543
7 Ga0070689_100093618 3300005340 Bacteria 2372
8 Ga0070689_100620277 3300005340 Unclassified 938
9 Ga0070688_100047601 3300005365 Bacteria 2661
10 Ga0070688_100791021 3300005365 Bacteria 741
11 Ga0070713_101722769 3300005436 Unclassified 608
12 Ga0070711_100244704 3300005439 Unclassified 1404
13 Ga0070708_100037638 3300005445 Bacteria 4223
14 Ga0070707_101733718 3300005468 Unclassified 592
15 Ga0070684_101217499 3300005535 Bacteria 708
16 Ga0070696_101498357 3300005546 Unclassified 577
17 Ga0068855_100056472 3300005563 Bacteria 4606
18 Ga0068855_100192568 3300005563 Bacteria 2299
19 Ga0068856_101152087 3300005614 Bacteria 792
20 Ga0068859_100018715 3300005617 Bacteria 6959
21 Ga0068859_100251485 3300005617 Bacteria 1858
22 Ga0068859_100375213 3300005617 Bacteria 1518
23 Ga0068863_100787034 3300005841 Unclassified 948
24 Ga0068858_100043310 3300005842 Bacteria 4174
25 Ga0068858_101889166 3300005842 Unclassified 590
26 Ga0081455_10150678 3300005937 Unclassified 1794
27 Ga0081455_10758090 3300005937 Unclassified 613
28 Ga0070716_100159576 3300006173 Unclassified 1460
29 Ga0097621_101253416 3300006237 Bacteria 699
30 Ga0068871_101853351 3300006358 Bacteria 573
31 Ga0075431_100653363 3300006847 Bacteria 1032
32 Ga0075434_100197536 3300006871 Bacteria 2031
33 Ga0075434_100673581 3300006871 Bacteria 1052
34 Ga0097620_100018715 3300006931 Bacteria 6959
35 Ga0097620_100251497 3300006931 Bacteria 1858
36 Ga0097620_100375166 3300006931 Bacteria 1518
37 Ga0099795_10506048 3300007788 Unclassified 564
38 Ga0099795_10634385 3300007788 Unclassified 510
39 Ga0105240_10062753 3300009093 Unclassified 4625
40 Ga0105240_10129843 3300009093 Bacteria 3024
41 Ga0105240_10694087 3300009093 Unclassified 1112
42 Ga0111539_10825991 3300009094 Bacteria 1078
43 Ga0105242_10624801 3300009176 Bacteria 1044
44 Ga0105248_12986040 3300009177 Unclassified 539
45 Ga0105238_10058933 3300009551 Unclassified 3848
46 Ga0105238_10062508 3300009551 Bacteria 3724
47 Ga0105238_10083828 3300009551 Bacteria 3177
48 Ga0105238_11214496 3300009551 Unclassified 778
49 Ga0105249_11295286 3300009553 Unclassified 800
50 Ga0157374_10152420 3300013296 Unclassified 2248
51 Ga0157374_10212434 3300013296 Bacteria 1897
52 Ga0157378_12753713 3300013297 Unclassified 544
53 Ga0163162_10520140 3300013306 Bacteria 1319
54 Ga0157376_10627894 3300014969 Bacteria 1072
55 Ga0157376_11092869 3300014969 Unclassified 823
56 Ga0207695_10236075 3300025913 Bacteria 1731
57 Ga0207695_10874078 3300025913 Unclassified 779
58 Ga0207695_11134877 3300025913 Bacteria 662
59 Ga0207646_11597822 3300025922 Unclassified 562
60 Ga0207694_10040594 3300025924 Bacteria 3583
61 Ga0207694_10055270 3300025924 Unclassified 3082
62 Ga0207694_10321019 3300025924 Unclassified 1278
63 Ga0207694_10836539 3300025924 Unclassified 778
64 Ga0207670_10010052 3300025936 Bacteria 5430
65 Ga0207689_10546420 3300025942 Bacteria 973
66 Ga0207661_12087412 3300025944 Unclassified 513
67 Ga0207667_10161969 3300025949 Bacteria 2301
68 Ga0207702_10022808 3300026078 Bacteria 5192
69 Ga0207702_11213748 3300026078 Bacteria 748
70 Ga0207641_11501760 3300026088 Unclassified 675
71 Ga0265326_10010650 3300028558 Bacteria 2726
72 Ga0265326_10125078 3300028558 Unclassified 732
73 Ga0265319_1002159 3300028563 Bacteria 10986
74 Ga0265319_1006998 3300028563 Bacteria 5132
75 Ga0265334_10342938 3300028573 Unclassified 511
76 Ga0265318_10022072 3300028577 Bacteria 2549
77 Ga0265323_10060431 3300028653 Bacteria 1319
78 Ga0265322_10070656 3300028654 Bacteria 990
79 Ga0265336_10082378 3300028666 Bacteria 960
80 Ga0265336_10170399 3300028666 Unclassified 648
81 Ga0265338_10000293 3300028800 Bacteria 90033
82 Ga0265338_10001068 3300028800 Bacteria 45548
83 Ga0265338_10001974 3300028800 Bacteria 31940
84 Ga0265338_10028525 3300028800 Bacteria 5564
85 Ga0265338_10033777 3300028800 Bacteria 4958
86 Ga0265338_10034939 3300028800 Bacteria 4844
87 Ga0265338_10040153 3300028800 Bacteria 4400
88 Ga0265338_10050273 3300028800 Unclassified 3770
89 Ga0265338_10069805 3300028800 Bacteria 3016
90 Ga0265338_10159792 3300028800 Bacteria 1741
91 Ga0265338_10180749 3300028800 Bacteria 1608
92 Ga0265338_10542331 3300028800 Bacteria 815
93 Ga0265324_10001441 3300029957 Bacteria 13625
94 Ga0265324_10012596 3300029957 Unclassified 3185
95 Ga0265324_10206190 3300029957 Unclassified 667
96 Ga0265328_10077528 3300031239 Unclassified 1224
97 Ga0265328_10438833 3300031239 Bacteria 515
98 Ga0265320_10005261 3300031240 Bacteria 8339
99 Ga0265320_10090916 3300031240 Bacteria 1414
100 Ga0265320_10124381 3300031240 Unclassified 1174
101 Ga0265320_10156265 3300031240 Bacteria 1028
102 Ga0265325_10063850 3300031241 Bacteria 1862
103 Ga0265325_10350807 3300031241 Unclassified 652
104 Ga0265340_10001303 3300031247 Bacteria 14291
105 Ga0265340_10107982 3300031247 Unclassified 1289
106 Ga0265340_10417343 3300031247 Unclassified 592
107 Ga0265339_10005532 3300031249 Bacteria 8398
108 Ga0265339_10246423 3300031249 Bacteria 866
109 Ga0265339_10367891 3300031249 Unclassified 675
110 Ga0265331_10043560 3300031250 Bacteria 2173
111 Ga0265327_10001666 3300031251 Bacteria 26718
112 Ga0265327_10002951 3300031251 Bacteria 16999
113 Ga0265327_10094908 3300031251 Bacteria 1449
114 Ga0265316_10002412 3300031344 Bacteria 19444
115 Ga0265316_10011879 3300031344 Bacteria 7829
116 Ga0265316_10434096 3300031344 Bacteria 943
117 Ga0265316_10977875 3300031344 Unclassified 589
118 Ga0265313_10004923 3300031595 Bacteria 10006
119 Ga0265314_10012497 3300031711 Bacteria 6922
120 Ga0265314_10110489 3300031711 Unclassified 1747
121 Ga0265314_10198408 3300031711 Unclassified 1188
122 Ga0265342_10162983 3300031712 Bacteria 1231
123 Ga0307412_11530518 3300031911 Unclassified 607
124 Ga0307412_12080641 3300031911 Unclassified 527
125 Ga0373926_0004840 3300035083 Bacteria 4427
126 Ga0373945_0197657 3300035116 Unclassified 834
127 Ga0373954_0010315 3300035118 Bacteria 4122
128 Ga0373954_0402784 3300035118 Unclassified 677
129 Ga0373956_0063382 3300035119 Bacteria 1677
130 Ga0373943_0030081 3300035170 Bacteria 2569
131 Ga0373946_0203564 3300035171 Unclassified 949
132 Ga0373955_0863262 3300035172 Unclassified 557
133 Ga0373955_0921947 3300035172 Unclassified 538
134 Ga0373935_0045834 3300035692 Bacteria 2760
135 Ga0373935_0857900 3300035692 Bacteria 672
136 Ga0373927_0680335 3300035695 Unclassified 680
137 Ga0373933_0076167 3300035724 Unclassified 2049
138 Ga0373933_0399065 3300035724 Unclassified 897
139 Ga0373947_0003021 3300035725 Bacteria 10028
140 Ga0373947_0489411 3300035725 Unclassified 835
141 Ga0373937_0119485 3300036401 Bacteria 2455
142 Ga0373937_0458445 3300036401 Bacteria 1211
143 Ga0373925_0001464 3300037068 Bacteria 20369
144 Ga0373925_1401007 3300037068 Unclassified 573
145 Ga0451800_1257068 3300041459 Bacteria 904
146 Ga0451807_0930642 3300041486 Unclassified 700
147 Ga0451577_0009530 3300042876 Bacteria 9343
148 Ga0451577_0539063 3300042876 Unclassified 1060
149 Ga0453684_1150465 3300044712 Unclassified 817
150 Ga0453684_1437443 3300044712 Unclassified 714
151 Ga0453684_1713245 3300044712 Unclassified 642
152 Ga0451576_0270602 3300045051 Bacteria 1776
153 Ga0451576_0391594 3300045051 Bacteria 1457
154 Ga0451576_0430035 3300045051 Unclassified 1385
155 Ga0451576_0504450 3300045051 Bacteria 1271
156 Ga0451576_0614727 3300045051 Unclassified 1142
157 Ga0451576_0756799 3300045051 Bacteria 1020
158 Ga0451576_1329501 3300045051 Bacteria 749
159 Ga0451576_1392482 3300045051 Unclassified 730
160 Ga0495629_0038928 3300046459 Bacteria 3348
161 Ga0495651_0488590 3300046462 Unclassified 790
162 Ga0495580_0560612 3300046472 Bacteria 758
163 Ga0495580_0904509 3300046472 Unclassified 567
164 Ga0495639_0411260 3300046475 Bacteria 684
165 Ga0495608_0831468 3300046511 Unclassified 544
166 Ga0495618_0017085 3300046514 Bacteria 4446
167 Ga0495628_0165159 3300046516 Bacteria 1681
168 Ga0495628_0431377 3300046516 Bacteria 959
169 Ga0495630_0166114 3300046517 Bacteria 1680
170 Ga0495630_0341573 3300046517 Unclassified 1146
171 Ga0495630_1197780 3300046517 Bacteria 574
172 Ga0495586_0062769 3300046535 Bacteria 2023
173 Ga0495586_0186750 3300046535 Bacteria 1173
174 Ga0495586_0299864 3300046535 Bacteria 921
175 Ga0495598_0411857 3300046537 Bacteria 530
176 Ga0495621_0178875 3300046539 Bacteria 846
177 Ga0495645_0148108 3300046543 Unclassified 1633
178 Ga0495667_0023091 3300046559 Bacteria 4191
179 Ga0495634_0000394 3300046642 Bacteria 42845
180 Ga0495634_0272867 3300046642 Bacteria 1029
181 Ga0495635_0143165 3300046663 Bacteria 1628
182 Ga0495588_0328621 3300046674 Unclassified 804
183 Ga0495657_0057108 3300046675 Unclassified 2597
184 Ga0495657_0521624 3300046675 Bacteria 692
185 Ga0495658_0622897 3300046683 Unclassified 691
186 Ga0495613_0017897 3300046689 Bacteria 5283
187 Ga0495600_0185873 3300046809 Unclassified 1338
188 Ga0495581_0326836 3300047315 Unclassified 896
189 Ga0495674_0259896 3300047319 Bacteria 1427
190 Ga0495676_0216174 3300047321 Unclassified 1323
191 Ga0495680_0001810 3300047322 Bacteria 22585
192 Ga0495680_0533603 3300047322 Unclassified 793
193 Ga0495675_0229801 3300047444 Bacteria 1120
194 Ga0495675_0348482 3300047444 Bacteria 871
195 Ga0495602_1021220 3300048088 Unclassified 545
196 Ga0501261_020348 3300049690 Bacteria 948
197 nmdc:mga06r32_355162_c2 3300050510 Bacteria 1051
198 nmdc:mga0n895_61358_c1 3300050512 Bacteria 3711
199 Ga0500650_0159027 3300053098 Bacteria 1042
200 Ga0500650_0454950 3300053098 Unclassified 548

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045051 Ga0451576_0391594 Ga0451576_0391594_1079_1426 112
2 3300003320 rootH2_10065146 rootH2_100651462 113
3 3300005295 Ga0065707_10539772 Ga0065707_105397721 113
4 3300005340 Ga0070689_100093618 Ga0070689_1000936182 113
5 3300005365 Ga0070688_100047601 Ga0070688_1000476012 113
6 3300005436 Ga0070713_101722769 Ga0070713_1017227691 113
7 3300005535 Ga0070684_101217499 Ga0070684_1012174991 113
8 3300006847 Ga0075431_100653363 Ga0075431_1006533632 113
9 3300009093 Ga0105240_10694087 Ga0105240_106940872 113
10 3300009551 Ga0105238_10083828 Ga0105238_100838282 113
11 3300025913 Ga0207695_10874078 Ga0207695_108740782 113
12 3300025924 Ga0207694_10321019 Ga0207694_103210192 113
13 3300025936 Ga0207670_10010052 Ga0207670_100100525 113
14 3300026078 Ga0207702_10022808 Ga0207702_100228084 113
15 3300031247 Ga0265340_10107982 Ga0265340_101079822 113
16 3300031250 Ga0265331_10043560 Ga0265331_100435602 113
17 3300031251 Ga0265327_10002951 Ga0265327_100029515 113
18 3300037068 Ga0373925_1401007 Ga0373925_1401007_126_473 113
19 3300045051 Ga0451576_1329501 Ga0451576_1329501_310_654 113
20 3300045051 Ga0451576_1392482 Ga0451576_1392482_24_368 113
21 3300046516 Ga0495628_0165159 Ga0495628_0165159_22_366 113
22 3300046543 Ga0495645_0148108 Ga0495645_0148108_202_579 113
23 3300050510 nmdc:mga06r32_355162_c2 nmdc:mga06r32_355162_c2_503_850 113
24 3300005330 Ga0070690_100001870 Ga0070690_1000018706 114
25 3300005340 Ga0070689_100620277 Ga0070689_1006202771 114
26 3300005439 Ga0070711_100244704 Ga0070711_1002447042 114
27 3300005546 Ga0070696_101498357 Ga0070696_1014983571 114
28 3300005563 Ga0068855_100056472 Ga0068855_1000564722 114
29 3300005563 Ga0068855_100192568 Ga0068855_1001925682 114
30 3300005614 Ga0068856_101152087 Ga0068856_1011520871 114
31 3300005617 Ga0068859_100018715 Ga0068859_1000187153 114
32 3300005841 Ga0068863_100787034 Ga0068863_1007870342 114
33 3300005842 Ga0068858_100043310 Ga0068858_1000433102 114
34 3300005842 Ga0068858_101889166 Ga0068858_1018891661 114
35 3300005937 Ga0081455_10150678 Ga0081455_101506782 114
36 3300005937 Ga0081455_10758090 Ga0081455_107580902 114
37 3300006237 Ga0097621_101253416 Ga0097621_1012534161 114
38 3300006871 Ga0075434_100673581 Ga0075434_1006735812 114
39 3300006931 Ga0097620_100018715 Ga0097620_1000187153 114
40 3300007788 Ga0099795_10506048 Ga0099795_105060481 114
41 3300007788 Ga0099795_10634385 Ga0099795_106343851 114
42 3300009093 Ga0105240_10062753 Ga0105240_100627533 114
43 3300009093 Ga0105240_10129843 Ga0105240_101298434 114
44 3300009177 Ga0105248_12986040 Ga0105248_129860402 114
45 3300009551 Ga0105238_10058933 Ga0105238_100589332 114
46 3300009551 Ga0105238_10062508 Ga0105238_100625082 114
47 3300009551 Ga0105238_11214496 Ga0105238_112144961 114
48 3300009553 Ga0105249_11295286 Ga0105249_112952861 114
49 3300013296 Ga0157374_10152420 Ga0157374_101524204 114
50 3300013296 Ga0157374_10212434 Ga0157374_102124342 114
51 3300014969 Ga0157376_11092869 Ga0157376_110928691 114
52 3300025913 Ga0207695_10236075 Ga0207695_102360753 114
53 3300025913 Ga0207695_11134877 Ga0207695_111348772 114
54 3300025924 Ga0207694_10040594 Ga0207694_100405942 114
55 3300025924 Ga0207694_10055270 Ga0207694_100552702 114
56 3300025924 Ga0207694_10836539 Ga0207694_108365392 114
57 3300025944 Ga0207661_12087412 Ga0207661_120874121 114
58 3300025949 Ga0207667_10161969 Ga0207667_101619692 114
59 3300026078 Ga0207702_11213748 Ga0207702_112137482 114
60 3300026088 Ga0207641_11501760 Ga0207641_115017601 114
61 3300028558 Ga0265326_10010650 Ga0265326_100106502 114
62 3300028558 Ga0265326_10125078 Ga0265326_101250781 114
63 3300028563 Ga0265319_1002159 Ga0265319_10021592 114
64 3300028563 Ga0265319_1006998 Ga0265319_10069982 114
65 3300028573 Ga0265334_10342938 Ga0265334_103429381 114
66 3300028577 Ga0265318_10022072 Ga0265318_100220722 114
67 3300028653 Ga0265323_10060431 Ga0265323_100604311 114
68 3300028654 Ga0265322_10070656 Ga0265322_100706562 114
69 3300028666 Ga0265336_10082378 Ga0265336_100823781 114
70 3300028666 Ga0265336_10170399 Ga0265336_101703991 114
71 3300028800 Ga0265338_10000293 Ga0265338_1000029378 114
72 3300028800 Ga0265338_10001068 Ga0265338_1000106835 114
73 3300028800 Ga0265338_10001974 Ga0265338_1000197415 114
74 3300028800 Ga0265338_10028525 Ga0265338_100285252 114
75 3300028800 Ga0265338_10033777 Ga0265338_100337772 114
76 3300028800 Ga0265338_10034939 Ga0265338_100349392 114
77 3300028800 Ga0265338_10050273 Ga0265338_100502732 114
78 3300028800 Ga0265338_10069805 Ga0265338_100698052 114
79 3300028800 Ga0265338_10159792 Ga0265338_101597922 114
80 3300028800 Ga0265338_10180749 Ga0265338_101807492 114
81 3300028800 Ga0265338_10542331 Ga0265338_105423311 114
82 3300029957 Ga0265324_10001441 Ga0265324_100014415 114
83 3300029957 Ga0265324_10012596 Ga0265324_100125962 114
84 3300029957 Ga0265324_10206190 Ga0265324_102061902 114
85 3300031239 Ga0265328_10077528 Ga0265328_100775282 114
86 3300031239 Ga0265328_10438833 Ga0265328_104388331 114
87 3300031240 Ga0265320_10090916 Ga0265320_100909162 114
88 3300031240 Ga0265320_10124381 Ga0265320_101243812 114
89 3300031240 Ga0265320_10156265 Ga0265320_101562651 114
90 3300031241 Ga0265325_10063850 Ga0265325_100638502 114
91 3300031241 Ga0265325_10350807 Ga0265325_103508071 114
92 3300031247 Ga0265340_10001303 Ga0265340_100013035 114
93 3300031247 Ga0265340_10417343 Ga0265340_104173431 114
94 3300031249 Ga0265339_10005532 Ga0265339_100055323 114
95 3300031249 Ga0265339_10246423 Ga0265339_102464232 114
96 3300031251 Ga0265327_10001666 Ga0265327_1000166623 114
97 3300031251 Ga0265327_10094908 Ga0265327_100949082 114
98 3300031344 Ga0265316_10002412 Ga0265316_100024122 114
99 3300031344 Ga0265316_10011879 Ga0265316_100118792 114
100 3300031344 Ga0265316_10434096 Ga0265316_104340961 114
101 3300031595 Ga0265313_10004923 Ga0265313_100049232 114
102 3300031711 Ga0265314_10012497 Ga0265314_100124974 114
103 3300031711 Ga0265314_10110489 Ga0265314_101104893 114
104 3300031711 Ga0265314_10198408 Ga0265314_101984082 114
105 3300031712 Ga0265342_10162983 Ga0265342_101629832 114
106 3300035083 Ga0373926_0004840 Ga0373926_0004840_3937_4284 114
107 3300035116 Ga0373945_0197657 Ga0373945_0197657_108_455 114
108 3300035118 Ga0373954_0010315 Ga0373954_0010315_2461_2808 114
109 3300035118 Ga0373954_0402784 Ga0373954_0402784_161_508 114
110 3300035119 Ga0373956_0063382 Ga0373956_0063382_213_560 114
111 3300035170 Ga0373943_0030081 Ga0373943_0030081_853_1200 114
112 3300035171 Ga0373946_0203564 Ga0373946_0203564_144_491 114
113 3300035172 Ga0373955_0863262 Ga0373955_0863262_84_431 114
114 3300035172 Ga0373955_0921947 Ga0373955_0921947_104_451 114
115 3300035692 Ga0373935_0045834 Ga0373935_0045834_2087_2434 114
116 3300035692 Ga0373935_0857900 Ga0373935_0857900_11_358 114
117 3300035724 Ga0373933_0076167 Ga0373933_0076167_591_938 114
118 3300035724 Ga0373933_0399065 Ga0373933_0399065_432_779 114
119 3300035725 Ga0373947_0003021 Ga0373947_0003021_6868_7215 114
120 3300035725 Ga0373947_0489411 Ga0373947_0489411_460_807 114
121 3300036401 Ga0373937_0119485 Ga0373937_0119485_897_1244 114
122 3300036401 Ga0373937_0458445 Ga0373937_0458445_202_549 114
123 3300037068 Ga0373925_0001464 Ga0373925_0001464_422_769 114
124 3300041486 Ga0451807_0930642 Ga0451807_0930642_204_551 114
125 3300042876 Ga0451577_0009530 Ga0451577_0009530_5616_5969 114
126 3300044712 Ga0453684_1713245 Ga0453684_1713245_111_464 114
127 3300045051 Ga0451576_0270602 Ga0451576_0270602_1312_1665 114
128 3300045051 Ga0451576_0430035 Ga0451576_0430035_105_458 114
129 3300045051 Ga0451576_0614727 Ga0451576_0614727_727_1074 114
130 3300046459 Ga0495629_0038928 Ga0495629_0038928_105_452 114
131 3300046462 Ga0495651_0488590 Ga0495651_0488590_425_772 114
132 3300046472 Ga0495580_0560612 Ga0495580_0560612_91_438 114
133 3300046472 Ga0495580_0904509 Ga0495580_0904509_38_385 114
134 3300046475 Ga0495639_0411260 Ga0495639_0411260_147_494 114
135 3300046511 Ga0495608_0831468 Ga0495608_0831468_81_428 114
136 3300046514 Ga0495618_0017085 Ga0495618_0017085_2269_2616 114
137 3300046517 Ga0495630_0166114 Ga0495630_0166114_824_1171 114
138 3300046517 Ga0495630_0341573 Ga0495630_0341573_595_945 114
139 3300046517 Ga0495630_1197780 Ga0495630_1197780_114_461 114
140 3300046535 Ga0495586_0062769 Ga0495586_0062769_1425_1781 114
141 3300046535 Ga0495586_0186750 Ga0495586_0186750_300_647 114
142 3300046539 Ga0495621_0178875 Ga0495621_0178875_272_619 114
143 3300046559 Ga0495667_0023091 Ga0495667_0023091_2842_3189 114
144 3300046642 Ga0495634_0000394 Ga0495634_0000394_19643_19990 114
145 3300046642 Ga0495634_0272867 Ga0495634_0272867_413_760 114
146 3300046663 Ga0495635_0143165 Ga0495635_0143165_809_1156 114
147 3300046674 Ga0495588_0328621 Ga0495588_0328621_87_434 114
148 3300046675 Ga0495657_0521624 Ga0495657_0521624_91_438 114
149 3300046683 Ga0495658_0622897 Ga0495658_0622897_294_650 114
150 3300046689 Ga0495613_0017897 Ga0495613_0017897_2929_3276 114
151 3300046809 Ga0495600_0185873 Ga0495600_0185873_904_1251 114
152 3300047315 Ga0495581_0326836 Ga0495581_0326836_191_538 114
153 3300047319 Ga0495674_0259896 Ga0495674_0259896_57_404 114
154 3300047321 Ga0495676_0216174 Ga0495676_0216174_120_467 114
155 3300047322 Ga0495680_0001810 Ga0495680_0001810_2491_2838 114
156 3300047322 Ga0495680_0533603 Ga0495680_0533603_229_576 114
157 3300047444 Ga0495675_0229801 Ga0495675_0229801_201_548 114
158 3300047444 Ga0495675_0348482 Ga0495675_0348482_111_458 114
159 3300048088 Ga0495602_1021220 Ga0495602_1021220_165_512 114
160 3300053098 Ga0500650_0159027 Ga0500650_0159027_507_854 114
161 3300053098 Ga0500650_0454950 Ga0500650_0454950_169_516 114
162 3300005330 Ga0070690_100102250 Ga0070690_1001022502 115
163 3300005336 Ga0070680_101724583 Ga0070680_1017245831 115
164 3300005365 Ga0070688_100791021 Ga0070688_1007910211 115
165 3300005445 Ga0070708_100037638 Ga0070708_1000376384 115
166 3300005468 Ga0070707_101733718 Ga0070707_1017337181 115
167 3300005617 Ga0068859_100251485 Ga0068859_1002514852 115
168 3300006173 Ga0070716_100159576 Ga0070716_1001595762 115
169 3300006871 Ga0075434_100197536 Ga0075434_1001975362 115
170 3300006931 Ga0097620_100251497 Ga0097620_1002514972 115
171 3300009094 Ga0111539_10825991 Ga0111539_108259911 115
172 3300028800 Ga0265338_10040153 Ga0265338_100401532 115
173 3300031240 Ga0265320_10005261 Ga0265320_100052616 115
174 3300031249 Ga0265339_10367891 Ga0265339_103678911 115
175 3300031344 Ga0265316_10977875 Ga0265316_109778752 115
176 3300035695 Ga0373927_0680335 Ga0373927_0680335_115_465 115
177 3300042876 Ga0451577_0539063 Ga0451577_0539063_562_912 115
178 3300044712 Ga0453684_1150465 Ga0453684_1150465_439_795 115
179 3300044712 Ga0453684_1437443 Ga0453684_1437443_157_507 115
180 3300045051 Ga0451576_0504450 Ga0451576_0504450_183_533 115
181 3300045051 Ga0451576_0756799 Ga0451576_0756799_594_947 115
182 3300046516 Ga0495628_0431377 Ga0495628_0431377_392_748 115
183 3300046535 Ga0495586_0299864 Ga0495586_0299864_227_580 115
184 3300046537 Ga0495598_0411857 Ga0495598_0411857_111_458 115
185 3300046675 Ga0495657_0057108 Ga0495657_0057108_347_697 115
186 3300050512 nmdc:mga0n895_61358_c1 nmdc:mga0n895_61358_c1_454_804 115
187 3300000545 CNXas_1000457 CNXas_10004574 116
188 3300005617 Ga0068859_100375213 Ga0068859_1003752135 116
189 3300006358 Ga0068871_101853351 Ga0068871_1018533511 116
190 3300006931 Ga0097620_100375166 Ga0097620_1003751665 116
191 3300009176 Ga0105242_10624801 Ga0105242_106248012 116
192 3300013297 Ga0157378_12753713 Ga0157378_127537131 116
193 3300013306 Ga0163162_10520140 Ga0163162_105201402 116
194 3300014969 Ga0157376_10627894 Ga0157376_106278941 116
195 3300025922 Ga0207646_11597822 Ga0207646_115978221 116
196 3300025942 Ga0207689_10546420 Ga0207689_105464202 116
197 3300031911 Ga0307412_11530518 Ga0307412_115305182 116
198 3300031911 Ga0307412_12080641 Ga0307412_120806412 116
199 3300041459 Ga0451800_1257068 Ga0451800_1257068_168_518 116
200 3300049690 Ga0501261_020348 Ga0501261_020348_246_596 116

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01521

Fe-S_biosyn

Iron-sulphur cluster biosynthesis

28

129

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d2a-assembly2.cif.gz_B-2 crystal structure of escherichia coli sufa involved in biosynthesis of iron-sulfur clusters 0.884 12 104
1r94-assembly1.cif.gz_A crystal structure of isca (mercury derivative) 0.8456 11 106
1s98-assembly1.cif.gz_A e.coli isca crystal structure to 2.3 a 0.8438 12 105
2d2a-assembly2.cif.gz_A crystal structure of escherichia coli sufa involved in biosynthesis of iron-sulfur clusters 0.8358 12 116
1r94-assembly1.cif.gz_A crystal structure of isca (mercury derivative) 0.8299 11 106
ID Description Score Start End Superfamily
2d2aB01 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.884 12 104 2.60.300.12
2d2aB01 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8659 12 104 2.60.300.12
af_P78859_82_189_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8531 12 115 2.60.300.12
af_A0A0R0F1L8_21_105_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8517 12 90 2.60.300.12
af_O43045_97_205_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8514 12 110 2.60.300.12
ID Description Score Start End GO Terms
AF-A0A537GS23-F1-model_v4 Iron-sulfur cluster assembly accessory protein 0.926 12 90 GO:0005506
GO:0016226
GO:0051537
GO:0051539
GO:0106035
AF-A0A537GSW7-F1-model_v4 Iron-sulfur cluster assembly accessory protein 0.9159 13 79 GO:0005506
GO:0016226
GO:0051537
GO:0051539
GO:0106035
AF-A0A382RI87-F1-model_v4 FeS cluster biogenesis domain-containing protein 0.8961 12 90 GO:0009570
GO:0016226
GO:0030674
GO:0051536
AF-A0A0S8BLN5-F1-model_v4 FeS cluster biogenesis domain-containing protein 0.8957 12 107
AF-A0A2T4TWD0-F1-model_v4 Iron-sulfur cluster assembly accessory protein 0.8941 12 110 GO:0005506
GO:0016226
GO:0051537
GO:0051539
GO:0106035

Feature Viewer

pLDDT pTM Quality
73.02 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map