F307285

General Info

Members Datasets Scaffolds Average Seq Length
200 155 400 71

Family's Representative Sequence

Representative Sequence 3300025949|Ga0207667_10367617|Ga0207667_103676172
Length 87
Sequence MISPTEVTCAKSRLLSRVGKIPGVNHLHAIRALEKAGFRVVREGKHTVMSDGERILTIPRHNPVNAFTMGGIVRDAGLTPEAFRKLL

Samples

Sample ID Description Type Environment
1 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
96 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
97 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
98 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
99 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
102 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
103 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
108 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
111 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
115 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
116 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
117 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
118 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
119 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
120 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
121 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
122 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
123 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
124 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
125 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
126 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
127 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
128 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
129 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
130 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
139 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
140 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
141 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
142 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
143 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
144 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
145 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
146 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
147 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
148 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
149 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
150 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
153 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
154 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
155 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99
Metatranscriptomes 1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1
Rhizosphere 97
Stem 0
Stem Tuber 0
Unclassified 44.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207667_10367617 3300025949 Unclassified 1466
2 rootH1_10145304 3300003316 Unclassified 1114
3 Ga0065704_10341646 3300005289 Unclassified 822
4 Ga0065715_10559295 3300005293 Unclassified 735
5 Ga0065707_10652221 3300005295 Unclassified 662
6 Ga0070676_10926356 3300005328 Unclassified 650
7 Ga0070690_100671650 3300005330 Bacteria 793
8 Ga0068869_101781376 3300005334 Unclassified 550
9 Ga0070680_100060677 3300005336 Bacteria 3095
10 Ga0068868_101562477 3300005338 Unclassified 619
11 Ga0070689_100082666 3300005340 Unclassified 2523
12 Ga0070669_100136611 3300005353 Bacteria 1886
13 Ga0070671_100474746 3300005355 Bacteria 1074
14 Ga0070674_101872316 3300005356 Unclassified 545
15 Ga0070674_102144500 3300005356 Unclassified 510
16 Ga0070659_101679510 3300005366 Bacteria 568
17 Ga0070711_100105993 3300005439 Bacteria 2054
18 Ga0070711_101474550 3300005439 Bacteria 593
19 Ga0070705_100555253 3300005440 Bacteria 881
20 Ga0070705_101442964 3300005440 Unclassified 575
21 Ga0070700_101953525 3300005441 Unclassified 508
22 Ga0070694_100080543 3300005444 Bacteria 2263
23 Ga0070678_101929144 3300005456 Unclassified 558
24 Ga0070662_100680114 3300005457 Unclassified 869
25 Ga0068867_101118151 3300005459 Bacteria 720
26 Ga0068867_101163799 3300005459 Unclassified 707
27 Ga0068867_101577674 3300005459 Bacteria 613
28 Ga0070706_100161492 3300005467 Bacteria 2092
29 Ga0070706_100755998 3300005467 Bacteria 900
30 Ga0070707_101836002 3300005468 Bacteria 573
31 Ga0070698_100429584 3300005471 Bacteria 1256
32 Ga0070698_100878399 3300005471 Unclassified 842
33 Ga0070698_101661920 3300005471 Unclassified 591
34 Ga0070697_100034351 3300005536 Bacteria 4088
35 Ga0070672_100128850 3300005543 Bacteria 2078
36 Ga0070686_100499782 3300005544 Unclassified 943
37 Ga0070695_100027689 3300005545 Bacteria 3513
38 Ga0070696_100525996 3300005546 Bacteria 944
39 Ga0070704_100003094 3300005549 Bacteria 9477
40 Ga0068855_100023205 3300005563 Bacteria 7433
41 Ga0068857_101931339 3300005577 Bacteria 578
42 Ga0070702_100963928 3300005615 Unclassified 672
43 Ga0068859_102073155 3300005617 Bacteria 628
44 Ga0068861_100149637 3300005719 Bacteria 1914
45 Ga0068863_100537332 3300005841 Bacteria 1153
46 Ga0068858_100453967 3300005842 Unclassified 1235
47 Ga0068858_101451060 3300005842 Unclassified 676
48 Ga0068860_100128521 3300005843 Unclassified 2430
49 Ga0068862_102047286 3300005844 Unclassified 583
50 Ga0068862_102239066 3300005844 Unclassified 558
51 Ga0068862_102297563 3300005844 Unclassified 551
52 Ga0081539_10001982 3300005985 Bacteria 31159
53 Ga0075428_100134866 3300006844 Bacteria 2685
54 Ga0075428_100460028 3300006844 Bacteria 1362
55 Ga0075430_100086991 3300006846 Bacteria 2615
56 Ga0075431_100269283 3300006847 Unclassified 1727
57 Ga0075431_100598423 3300006847 Bacteria 1087
58 Ga0075433_10394559 3300006852 Unclassified 1221
59 Ga0075433_11931474 3300006852 Unclassified 506
60 Ga0097620_100169797 3300006931 Unclassified 2262
61 Ga0097620_102073170 3300006931 Bacteria 628
62 Ga0099794_10321196 3300007265 Unclassified 803
63 Ga0105240_11992145 3300009093 Unclassified 603
64 Ga0111539_10542495 3300009094 Unclassified 1355
65 Ga0111539_11269717 3300009094 Unclassified 855
66 Ga0111539_12480060 3300009094 Unclassified 601
67 Ga0105247_10135587 3300009101 Bacteria 1608
68 Ga0114129_13222962 3300009147 Unclassified 530
69 Ga0105243_10762628 3300009148 Bacteria 950
70 Ga0105241_10017764 3300009174 Bacteria 5231
71 Ga0105241_10398693 3300009174 Unclassified 1206
72 Ga0105248_10933892 3300009177 Viruses 980
73 Ga0105237_11250858 3300009545 Unclassified 749
74 Ga0105249_10114977 3300009553 Bacteria 2548
75 Ga0105249_10192378 3300009553 Bacteria 1992
76 Ga0105249_12786880 3300009553 Unclassified 560
77 Ga0105239_10809980 3300010375 Bacteria 1073
78 Ga0157373_10576133 3300013100 Bacteria 818
79 Ga0157369_10113345 3300013105 Bacteria 2880
80 Ga0157369_10383905 3300013105 Unclassified 1458
81 Ga0157369_10672226 3300013105 Unclassified 1067
82 Ga0157374_11170606 3300013296 Bacteria 790
83 Ga0157378_10127590 3300013297 Unclassified 2351
84 Ga0157378_10222848 3300013297 Bacteria 1793
85 Ga0163162_10367376 3300013306 Bacteria 1572
86 Ga0163162_10801251 3300013306 Bacteria 1059
87 Ga0163162_11699846 3300013306 Unclassified 721
88 Ga0157375_11270827 3300013308 Unclassified 865
89 Ga0157375_12553801 3300013308 Unclassified 610
90 Ga0157380_10052516 3300014326 Bacteria 3228
91 Ga0157380_10057002 3300014326 Bacteria 3109
92 Ga0157377_11060063 3300014745 Unclassified 618
93 Ga0197907_10779366 3300020069 Unclassified 720
94 Ga0206356_11061439 3300020070 Unclassified 505
95 Ga0213876_10003752 3300021384 Bacteria 8617
96 Ga0207688_10397449 3300025901 Bacteria 854
97 Ga0207705_10559362 3300025909 Bacteria 889
98 Ga0207684_10086873 3300025910 Bacteria 2664
99 Ga0207654_10188040 3300025911 Bacteria 1352
100 Ga0207663_10237345 3300025916 Bacteria 1335
101 Ga0207662_10119691 3300025918 Unclassified 1650
102 Ga0207662_10934395 3300025918 Unclassified 615
103 Ga0207646_10634154 3300025922 Bacteria 958
104 Ga0207646_11499225 3300025922 Bacteria 584
105 Ga0207681_11042477 3300025923 Bacteria 686
106 Ga0207681_11732450 3300025923 Unclassified 522
107 Ga0207650_11920650 3300025925 Unclassified 500
108 Ga0207659_10689103 3300025926 Unclassified 875
109 Ga0207706_10110694 3300025933 Bacteria 2416
110 Ga0207706_10614100 3300025933 Bacteria 933
111 Ga0207686_11652241 3300025934 Unclassified 529
112 Ga0207709_10207526 3300025935 Bacteria 1404
113 Ga0207669_11222245 3300025937 Unclassified 637
114 Ga0207691_10098372 3300025940 Bacteria 2613
115 Ga0207712_10540745 3300025961 Bacteria 1001
116 Ga0207703_10099198 3300026035 Unclassified 2465
117 Ga0207641_10251404 3300026088 Bacteria 1651
118 Ga0207648_10699899 3300026089 Unclassified 939
119 Ga0207674_12100171 3300026116 Unclassified 529
120 Ga0207675_100069808 3300026118 Bacteria 3283
121 Ga0209969_1043341 3300027360 Unclassified 701
122 Ga0209588_1064341 3300027671 Unclassified 1185
123 Ga0207428_11202679 3300027907 Unclassified 527
124 Ga0268265_10599302 3300028380 Bacteria 1053
125 Ga0268264_10130242 3300028381 Unclassified 2229
126 Ga0268264_11473613 3300028381 Unclassified 691
127 Ga0265331_10395586 3300031250 Unclassified 619
128 Ga0265327_10004642 3300031251 Bacteria 12048
129 Ga0307408_100384191 3300031548 Unclassified 1201
130 Ga0307408_100778565 3300031548 Bacteria 866
131 Ga0307408_101509230 3300031548 Unclassified 636
132 Ga0265342_10032412 3300031712 Bacteria 3223
133 Ga0316578_10306472 3300031728 Bacteria 949
134 Ga0307405_10495174 3300031731 Bacteria 978
135 Ga0307413_10489329 3300031824 Bacteria 985
136 Ga0307410_11666293 3300031852 Bacteria 564
137 Ga0307407_10146756 3300031903 Unclassified 1528
138 Ga0307412_11656531 3300031911 Bacteria 585
139 Ga0307409_100067341 3300031995 Bacteria 2827
140 Ga0307416_100236005 3300032002 Bacteria 1767
141 Ga0307414_10981622 3300032004 Bacteria 777
142 Ga0307411_10404470 3300032005 Unclassified 1129
143 Ga0307415_101391643 3300032126 Bacteria 667
144 Ga0373950_0036652 3300034818 Unclassified 926
145 Ga0373961_0072242 3300035241 Unclassified 1069
146 Ga0395905_0004818 3300037471 Bacteria 13920
147 Ga0436365_0381406 3300039437 Bacteria 21107
148 Ga0436365_1123731 3300039437 Bacteria 1550
149 Ga0436360_0070231 3300039438 Archaea 559
150 Ga0436360_1340499 3300039438 Bacteria 509
151 Ga0436362_0936640 3300039453 Unclassified 1172
152 Ga0451577_0150778 3300042876 Bacteria 2092
153 Ga0451577_0226971 3300042876 Bacteria 1688
154 Ga0451577_1496995 3300042876 Unclassified 597
155 Ga0453684_0000151 3300044712 Bacteria 306256
156 Ga0453684_0315459 3300044712 Bacteria 1772
157 Ga0466968_0351550 3300044735 Bacteria 716
158 Ga0495603_0145645 3300046455 Bacteria 1377
159 Ga0495643_0000056 3300046522 Bacteria 196484
160 Ga0495642_0490645 3300046528 Unclassified 543
161 Ga0495597_0038637 3300046542 Bacteria 2138
162 Ga0495633_0058704 3300046558 Bacteria 1805
163 Ga0495668_0030759 3300046616 Bacteria 3028
164 Ga0495588_0360552 3300046674 Bacteria 764
165 Ga0495670_0212935 3300046691 Bacteria 1025
166 Ga0495670_0339465 3300046691 Bacteria 808
167 Ga0496106_1239308 3300048909 Bacteria 581
168 Ga0496111_1335549 3300048914 Unclassified 504
169 Ga0501292_104932 3300049515 Unclassified 563
170 Ga0501033_0064979 3300049570 Bacteria 2684
171 Ga0501033_0351023 3300049570 Unclassified 1033
172 Ga0501036_0141667 3300049572 Bacteria 2029
173 Ga0501037_0900890 3300049573 Unclassified 580
174 Ga0501040_0126036 3300049576 Bacteria 1799
175 Ga0501042_0905079 3300049578 Unclassified 643
176 Ga0501043_0010121 3300049579 Bacteria 7393
177 Ga0501046_0222459 3300049580 Bacteria 1397
178 Ga0501047_0519321 3300049581 Unclassified 1017
179 Ga0501069_0801466 3300049585 Unclassified 571
180 Ga0501071_0011276 3300049587 Bacteria 6015
181 Ga0501072_0142252 3300049588 Bacteria 1913
182 Ga0501074_0225145 3300049590 Unclassified 1335
183 Ga0501075_0693585 3300049591 Unclassified 776
184 Ga0501076_0074997 3300049592 Bacteria 2711
185 Ga0501076_0085741 3300049592 Bacteria 2531
186 Ga0501077_0100273 3300049593 Bacteria 1835
187 Ga0501221_216605 3300049704 Unclassified 538
188 Ga0501079_0142304 3300049741 Bacteria 1868
189 Ga0501079_1162651 3300049741 Unclassified 608
190 Ga0501079_1646154 3300049741 Unclassified 505
191 Ga0501081_0344780 3300049743 Unclassified 1097
192 Ga0501035_0225468 3300049822 Bacteria 1599
193 nmdc:mga05p37_1757810_c1 3300050507 Unclassified 601
194 nmdc:mga05p37_354880_c1 3300050507 Bacteria 1725
195 nmdc:mga06r32_1033495_c1 3300050510 Unclassified 773
196 nmdc:mga08y16_216532_c1 3300050511 Bacteria 1983
197 nmdc:mga0n895_1822958_c1 3300050512 Unclassified 569
198 Ga0495655_0230720 3300053083 Bacteria 616
199 Ga0501082_0082514 3300060353 Bacteria 2774
200 Ga0530510_0432326 3300061734 Bacteria 994
201 Ga0207667_10367617
202 rootH1_10145304
203 Ga0065704_10341646
204 Ga0065715_10559295
205 Ga0065707_10652221
206 Ga0070676_10926356
207 Ga0070690_100671650
208 Ga0068869_101781376
209 Ga0070680_100060677
210 Ga0068868_101562477
211 Ga0070689_100082666
212 Ga0070669_100136611
213 Ga0070671_100474746
214 Ga0070674_101872316
215 Ga0070674_102144500
216 Ga0070659_101679510
217 Ga0070711_100105993
218 Ga0070711_101474550
219 Ga0070705_100555253
220 Ga0070705_101442964
221 Ga0070700_101953525
222 Ga0070694_100080543
223 Ga0070678_101929144
224 Ga0070662_100680114
225 Ga0068867_101118151
226 Ga0068867_101163799
227 Ga0068867_101577674
228 Ga0070706_100161492
229 Ga0070706_100755998
230 Ga0070707_101836002
231 Ga0070698_100429584
232 Ga0070698_100878399
233 Ga0070698_101661920
234 Ga0070697_100034351
235 Ga0070672_100128850
236 Ga0070686_100499782
237 Ga0070695_100027689
238 Ga0070696_100525996
239 Ga0070704_100003094
240 Ga0068855_100023205
241 Ga0068857_101931339
242 Ga0070702_100963928
243 Ga0068859_102073155
244 Ga0068861_100149637
245 Ga0068863_100537332
246 Ga0068858_100453967
247 Ga0068858_101451060
248 Ga0068860_100128521
249 Ga0068862_102047286
250 Ga0068862_102239066
251 Ga0068862_102297563
252 Ga0081539_10001982
253 Ga0075428_100134866
254 Ga0075428_100460028
255 Ga0075430_100086991
256 Ga0075431_100269283
257 Ga0075431_100598423
258 Ga0075433_10394559
259 Ga0075433_11931474
260 Ga0097620_100169797
261 Ga0097620_102073170
262 Ga0099794_10321196
263 Ga0105240_11992145
264 Ga0111539_10542495
265 Ga0111539_11269717
266 Ga0111539_12480060
267 Ga0105247_10135587
268 Ga0114129_13222962
269 Ga0105243_10762628
270 Ga0105241_10017764
271 Ga0105241_10398693
272 Ga0105248_10933892
273 Ga0105237_11250858
274 Ga0105249_10114977
275 Ga0105249_10192378
276 Ga0105249_12786880
277 Ga0105239_10809980
278 Ga0157373_10576133
279 Ga0157369_10113345
280 Ga0157369_10383905
281 Ga0157369_10672226
282 Ga0157374_11170606
283 Ga0157378_10127590
284 Ga0157378_10222848
285 Ga0163162_10367376
286 Ga0163162_10801251
287 Ga0163162_11699846
288 Ga0157375_11270827
289 Ga0157375_12553801
290 Ga0157380_10052516
291 Ga0157380_10057002
292 Ga0157377_11060063
293 Ga0197907_10779366
294 Ga0206356_11061439
295 Ga0213876_10003752
296 Ga0207688_10397449
297 Ga0207705_10559362
298 Ga0207684_10086873
299 Ga0207654_10188040
300 Ga0207663_10237345
301 Ga0207662_10119691
302 Ga0207662_10934395
303 Ga0207646_10634154
304 Ga0207646_11499225
305 Ga0207681_11042477
306 Ga0207681_11732450
307 Ga0207650_11920650
308 Ga0207659_10689103
309 Ga0207706_10110694
310 Ga0207706_10614100
311 Ga0207686_11652241
312 Ga0207709_10207526
313 Ga0207669_11222245
314 Ga0207691_10098372
315 Ga0207712_10540745
316 Ga0207703_10099198
317 Ga0207641_10251404
318 Ga0207648_10699899
319 Ga0207674_12100171
320 Ga0207675_100069808
321 Ga0209969_1043341
322 Ga0209588_1064341
323 Ga0207428_11202679
324 Ga0268265_10599302
325 Ga0268264_10130242
326 Ga0268264_11473613
327 Ga0265331_10395586
328 Ga0265327_10004642
329 Ga0307408_100384191
330 Ga0307408_100778565
331 Ga0307408_101509230
332 Ga0265342_10032412
333 Ga0316578_10306472
334 Ga0307405_10495174
335 Ga0307413_10489329
336 Ga0307410_11666293
337 Ga0307407_10146756
338 Ga0307412_11656531
339 Ga0307409_100067341
340 Ga0307416_100236005
341 Ga0307414_10981622
342 Ga0307411_10404470
343 Ga0307415_101391643
344 Ga0373950_0036652
345 Ga0373961_0072242
346 Ga0395905_0004818
347 Ga0436365_0381406
348 Ga0436365_1123731
349 Ga0436360_0070231
350 Ga0436360_1340499
351 Ga0436362_0936640
352 Ga0451577_0150778
353 Ga0451577_0226971
354 Ga0451577_1496995
355 Ga0453684_0000151
356 Ga0453684_0315459
357 Ga0466968_0351550
358 Ga0495603_0145645
359 Ga0495643_0000056
360 Ga0495642_0490645
361 Ga0495597_0038637
362 Ga0495633_0058704
363 Ga0495668_0030759
364 Ga0495588_0360552
365 Ga0495670_0212935
366 Ga0495670_0339465
367 Ga0496106_1239308
368 Ga0496111_1335549
369 Ga0501292_104932
370 Ga0501033_0064979
371 Ga0501033_0351023
372 Ga0501036_0141667
373 Ga0501037_0900890
374 Ga0501040_0126036
375 Ga0501042_0905079
376 Ga0501043_0010121
377 Ga0501046_0222459
378 Ga0501047_0519321
379 Ga0501069_0801466
380 Ga0501071_0011276
381 Ga0501072_0142252
382 Ga0501074_0225145
383 Ga0501075_0693585
384 Ga0501076_0074997
385 Ga0501076_0085741
386 Ga0501077_0100273
387 Ga0501221_216605
388 Ga0501079_0142304
389 Ga0501079_1162651
390 Ga0501079_1646154
391 Ga0501081_0344780
392 Ga0501035_0225468
393 nmdc:mga05p37_1757810_c1
394 nmdc:mga05p37_354880_c1
395 nmdc:mga06r32_1033495_c1
396 nmdc:mga08y16_216532_c1
397 nmdc:mga0n895_1822958_c1
398 Ga0495655_0230720
399 Ga0501082_0082514
400 Ga0530510_0432326

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07927

HicA_toxin

HicA toxin of bacterial toxin-antitoxin,

28

78

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5yrz-assembly1.cif.gz_D toxin-antitoxin complex from streptococcus pneumoniae 0.8626 8 61
2g7j-assembly1.cif.gz_A solution nmr structure of the putative cytoplasmic protein ygac from salmonella typhimurium. northeast structural genomics target str72. 0.8327 7 43
6hpb-assembly1.cif.gz_A crystal structure of the e.coli hicab toxin-antitoxin complex 0.8255 11 60
6g26-assembly1.cif.gz_F the crystal structure of the burkholderia pseudomallei hicab complex 0.818 8 61
5yrz-assembly1.cif.gz_D toxin-antitoxin complex from streptococcus pneumoniae 0.7959 8 61
ID Description Score Start End Superfamily
5yrzD00 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.8626 8 61 3.30.920.30
1whzA00 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.8378 7 68 3.30.920.30
2g7jA00 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Protein of unknown function DUF2002 0.8327 7 43 3.90.1150.40
af_P76106_1_57_3.30.920.30 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.8238 7 61 3.30.920.30
6g26F00 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.8179 8 61 3.30.920.30
ID Description Score Start End GO Terms
AF-A0A7C4WUA5-F1-model_v4 Type II toxin-antitoxin system HicA family toxin 1.002 1 70 GO:0003729
GO:0004519
AF-A0A6L7TUK9-F1-model_v4 Type II toxin-antitoxin system HicA family toxin 0.9969 1 70
AF-A0A1G3A8X0-F1-model_v4 Addiction module toxin, HicA family 0.9948 1 70 GO:0003729
GO:0004519
AF-A0A552QC21-F1-model_v4 Addiction module toxin, HicA family 0.9917 1 69 GO:0003729
GO:0004519
AF-A0A354F7J6-F1-model_v4 Type II toxin-antitoxin system HicA family toxin 0.9915 1 70 GO:0003729
GO:0004519

Map