F307013

General Info

Members Datasets Scaffolds Average Seq Length
200 153 398 254

Family's Representative Sequence

Representative Sequence 3300006880|Ga0075429_100268902|Ga0075429_1002689022
Length 283
Sequence MEATTTGAATRAVDLWKVYGTGEAQVIALRGVNAALERGRFTAIMGPSGSGKSTLMHCLAGLDSVTRGHVWVGDTEVTGLNDSGLTRLRREKVGFIFQQFNLLPTLSAGENILLPLNIAGRKPDKQWYDTVIDTVGLRDRLSHRPAQLSGGQQQRVACARALVSRPEVVFADEPTGNLDSRSGAEVLGFLRDSVRDFGQTIVMVTHDPNAASYADRVIFLGDGQIVDEMQDPTAEAVLDRLKRIDVLAGGLPGTAEAASPDGAXGVTSVGDTSDDSAALPGER

Samples

Sample ID Description Type Environment
1 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
24 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
72 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
73 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
74 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
75 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
76 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
77 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
78 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
79 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
80 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
81 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
84 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
85 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
86 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
87 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
88 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
89 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
90 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
91 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
92 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
93 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
96 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
99 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
100 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
101 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
102 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
103 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
104 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
105 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
106 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
107 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
108 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
109 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
110 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
111 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
112 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
113 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
114 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
115 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
116 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
117 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
118 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
119 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
120 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
121 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
122 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
129 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
130 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
131 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
132 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
133 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
134 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
135 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
136 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
137 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
138 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
140 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
141 2643221561 Nocardioides sp. Root151 Isolate Unclassified
142 2643221576 Nocardioides sp. Root614 Isolate Unclassified
143 2643221590 Nocardioides sp. Root682 Isolate Unclassified
144 2643221620 Nocardioides sp. Root240 Isolate Unclassified
145 2643221641 Nocardioides sp. Root122 Isolate Unclassified
146 2643221696 Nocardioides sp. Root140 Isolate Unclassified
147 2738541305 Nocardioides sp. CF167 Isolate Unclassified
148 2739367898 Nocardioides sp. CF479 Isolate Unclassified
149 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
150 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
151 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
152 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
153 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93
Metatranscriptomes 0
Isolates 7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2
Nodule 0
Rhizoplane 6
Rhizosphere 85.5
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075429_100268902 3300006880 Bacteria 1493
2 JGI25406J46586_10005128 3300003203 Bacteria 6076
3 Ga0070658_10000656 3300005327 Bacteria 29868
4 Ga0070683_100129079 3300005329 Bacteria 2391
5 Ga0068869_100386693 3300005334 Bacteria 1148
6 Ga0070680_100092902 3300005336 Bacteria 2499
7 Ga0070682_100299177 3300005337 Bacteria 1180
8 Ga0070709_10137873 3300005434 Bacteria 1673
9 Ga0070713_100198853 3300005436 Bacteria 1809
10 Ga0070700_100550817 3300005441 Bacteria 896
11 Ga0070708_100143231 3300005445 Bacteria 2218
12 Ga0070706_100176703 3300005467 Bacteria 1993
13 Ga0070698_100122245 3300005471 Bacteria 2562
14 Ga0070699_100000019 3300005518 Bacteria 185937
15 Ga0070699_100185232 3300005518 Bacteria 1848
16 Ga0070684_100068305 3300005535 Bacteria 3123
17 Ga0070684_100157968 3300005535 Bacteria 2056
18 Ga0070695_100091940 3300005545 Bacteria 2027
19 Ga0070665_100408963 3300005548 Bacteria 1365
20 Ga0068857_100150372 3300005577 Bacteria 2109
21 Ga0068859_100041171 3300005617 Bacteria 4641
22 Ga0068864_100083796 3300005618 Bacteria 2800
23 Ga0068862_100118490 3300005844 Bacteria 2331
24 Ga0081455_10053642 3300005937 Bacteria 3443
25 Ga0081455_10059843 3300005937 Bacteria 3214
26 Ga0081538_10000202 3300005981 Bacteria 66057
27 Ga0081540_1001008 3300005983 Bacteria 25263
28 Ga0081539_10000173 3300005985 Bacteria 151356
29 Ga0081539_10006220 3300005985 Bacteria 11575
30 Ga0070717_10320621 3300006028 Bacteria 1381
31 Ga0075365_10004210 3300006038 Bacteria 7579
32 Ga0075364_10030903 3300006051 Bacteria 3440
33 Ga0075428_100001383 3300006844 Bacteria 25822
34 Ga0075428_100026597 3300006844 Bacteria 6405
35 Ga0075428_100262680 3300006844 Bacteria 1859
36 Ga0075428_100661625 3300006844 Bacteria 1114
37 Ga0075430_100000563 3300006846 Bacteria 28139
38 Ga0075430_100050601 3300006846 Bacteria 3502
39 Ga0075431_100009160 3300006847 Bacteria 9927
40 Ga0075431_100034587 3300006847 Bacteria 5205
41 Ga0075431_100043763 3300006847 Bacteria 4619
42 Ga0075431_100119355 3300006847 Bacteria 2721
43 Ga0075433_10001093 3300006852 Bacteria 19556
44 Ga0075434_100013866 3300006871 Bacteria 7688
45 Ga0075429_100000905 3300006880 Bacteria 23462
46 Ga0075429_100006371 3300006880 Bacteria 10213
47 Ga0068865_100377959 3300006881 Bacteria 1155
48 Ga0075436_100218060 3300006914 Bacteria 1353
49 Ga0097620_100041173 3300006931 Bacteria 4641
50 Ga0075435_100005243 3300007076 Bacteria 9024
51 Ga0105250_10154800 3300009092 Bacteria 955
52 Ga0111539_10452812 3300009094 Bacteria 1494
53 Ga0114129_10001225 3300009147 Bacteria 34111
54 Ga0114129_10048221 3300009147 Bacteria 5986
55 Ga0114129_10050377 3300009147 Bacteria 5849
56 Ga0105248_10012238 3300009177 Bacteria 9460
57 Ga0157372_10686702 3300013307 Bacteria 1191
58 Ga0163163_10221122 3300014325 Bacteria 1942
59 Ga0157379_10166309 3300014968 Bacteria 1991
60 Ga0207699_10107070 3300025906 Bacteria 1785
61 Ga0207705_10001496 3300025909 Bacteria 18567
62 Ga0207707_10334911 3300025912 Bacteria 1305
63 Ga0207693_10296613 3300025915 Bacteria 1266
64 Ga0207660_10305877 3300025917 Bacteria 1267
65 Ga0207649_10398693 3300025920 Bacteria 1029
66 Ga0207650_10218619 3300025925 Bacteria 1533
67 Ga0207659_10001808 3300025926 Bacteria 12652
68 Ga0207706_10216599 3300025933 Bacteria 1677
69 Ga0207709_10105582 3300025935 Bacteria 1872
70 Ga0207665_10395533 3300025939 Bacteria 1051
71 Ga0207711_10064301 3300025941 Bacteria 3169
72 Ga0207689_10038871 3300025942 Bacteria 3939
73 Ga0207689_10228916 3300025942 Bacteria 1536
74 Ga0207661_10005771 3300025944 Bacteria 8728
75 Ga0207679_10019757 3300025945 Bacteria 4534
76 Ga0207668_10083976 3300025972 Bacteria 2319
77 Ga0207677_10015400 3300026023 Bacteria 4497
78 Ga0207703_10163754 3300026035 Bacteria 1950
79 Ga0207678_10002231 3300026067 Bacteria 17510
80 Ga0207708_10227631 3300026075 Bacteria 1496
81 Ga0207702_10111181 3300026078 Bacteria 2436
82 Ga0207676_10176745 3300026095 Bacteria 1865
83 Ga0207674_10211729 3300026116 Bacteria 1887
84 Ga0207698_10099852 3300026142 Bacteria 2402
85 Ga0207428_10026072 3300027907 Bacteria 4883
86 Ga0268266_10419412 3300028379 Bacteria 1268
87 Ga0307515_10127146 3300028794 Bacteria 2837
88 Ga0307513_10095731 3300031456 Bacteria 3009
89 Ga0307408_100240066 3300031548 Bacteria 1489
90 Ga0316579_10000001 3300031691 Bacteria 77478
91 Ga0316579_10024829 3300031691 Bacteria 2701
92 Ga0316576_10001111 3300031727 Bacteria 14057
93 Ga0316576_10017984 3300031727 Bacteria 4817
94 Ga0316578_10014368 3300031728 Bacteria 4227
95 Ga0307405_10271739 3300031731 Bacteria 1271
96 Ga0307413_10192620 3300031824 Bacteria 1465
97 Ga0307410_10107159 3300031852 Bacteria 2015
98 Ga0307406_10120379 3300031901 Bacteria 1824
99 Ga0307406_10213593 3300031901 Bacteria 1429
100 Ga0307412_10009096 3300031911 Bacteria 5693
101 Ga0307409_100017091 3300031995 Bacteria 4823
102 Ga0307416_100165262 3300032002 Bacteria 2052
103 Ga0307416_100364712 3300032002 Bacteria 1468
104 Ga0307415_100032338 3300032126 Bacteria 3382
105 Ga0307415_100146339 3300032126 Bacteria 1812
106 Ga0307507_10211153 3300033179 Bacteria 1323
107 Ga0316574_0013486 3300035398 Bacteria 4701
108 Ga0373927_0271660 3300035695 Bacteria 1115
109 Ga0316582_0060141 3300036647 Bacteria 2435
110 Ga0316584_0003602 3300036712 Bacteria 10125
111 Ga0395899_0176439 3300037312 Bacteria 1502
112 Ga0395900_0007186 3300037418 Bacteria 11543
113 Ga0395900_0037902 3300037418 Bacteria 4970
114 Ga0395898_0071134 3300037466 Bacteria 3362
115 Ga0395898_0133229 3300037466 Bacteria 2380
116 Ga0395905_0036816 3300037471 Bacteria 4596
117 Ga0395901_0046158 3300038443 Bacteria 4524
118 Ga0395901_0406924 3300038443 Bacteria 1397
119 Ga0439459_0057562 3300042438 Bacteria 870
120 Ga0466957_0072921 3300044842 Bacteria 2127
121 Ga0466967_0004829 3300045976 Bacteria 9192
122 Ga0495641_0187104 3300046461 Bacteria 927
123 Ga0495651_0069646 3300046462 Bacteria 2678
124 Ga0495653_0198388 3300046463 Bacteria 1364
125 Ga0495580_0000741 3300046472 Bacteria 27965
126 Ga0495580_0170777 3300046472 Bacteria 1504
127 Ga0495608_0076268 3300046511 Bacteria 2184
128 Ga0495608_0203093 3300046511 Bacteria 1248
129 Ga0495652_0088472 3300046529 Bacteria 2538
130 Ga0495587_0059823 3300046536 Bacteria 2235
131 Ga0495645_0084448 3300046543 Bacteria 2274
132 Ga0495667_0012370 3300046559 Bacteria 5783
133 Ga0495635_0300700 3300046663 Bacteria 1076
134 Ga0495613_0089033 3300046689 Bacteria 2236
135 Ga0495604_0050370 3300047317 Bacteria 3234
136 Ga0495674_0527496 3300047319 Bacteria 942
137 Ga0495680_0040286 3300047322 Bacteria 3723
138 Ga0495684_0001338 3300047471 Bacteria 19834
139 Ga0495602_0024373 3300048088 Bacteria 5872
140 Ga0495602_0205580 3300048088 Bacteria 1499
141 Ga0496102_0087128 3300048905 Bacteria 2885
142 Ga0496104_0091905 3300048907 Bacteria 2901
143 Ga0496104_0289237 3300048907 Bacteria 1551
144 Ga0496108_0048510 3300048911 Bacteria 3550
145 Ga0496109_0010302 3300048912 Bacteria 7983
146 Ga0496109_0203205 3300048912 Bacteria 1863
147 Ga0496110_0002927 3300048913 Bacteria 12933
148 Ga0496110_0132404 3300048913 Bacteria 2252
149 Ga0496111_0100435 3300048914 Bacteria 2125
150 Ga0496112_0141760 3300048915 Bacteria 2372
151 Ga0496112_0864062 3300048915 Bacteria 828
152 Ga0496113_0012973 3300048916 Bacteria 5622
153 Ga0501033_0000152 3300049570 Bacteria 66824
154 Ga0501034_0008866 3300049571 Bacteria 10578
155 Ga0501034_0166353 3300049571 Bacteria 2174
156 Ga0501036_0534939 3300049572 Bacteria 974
157 Ga0501039_0112884 3300049575 Bacteria 2125
158 Ga0501046_0177431 3300049580 Bacteria 1595
159 Ga0501047_0038377 3300049581 Bacteria 4635
160 Ga0501069_0012039 3300049585 Bacteria 4593
161 nmdc:mga00v17_233474_c1 3300050491 Bacteria 1192
162 nmdc:mga0yw44_3522_c1 3300050492 Bacteria 6973
163 nmdc:mga05p37_16323_c1 3300050507 Bacteria 8941
164 nmdc:mga05p37_1791_c1 3300050507 Bacteria 25083
165 nmdc:mga05p37_345654_c1 3300050507 Bacteria 1753
166 nmdc:mga09592_27050_c1 3300050508 Bacteria 4757
167 nmdc:mga09592_3_c1 3300050508 Bacteria 144376
168 nmdc:mga09592_445664_c1 3300050508 Bacteria 1117
169 nmdc:mga09592_71334_c1 3300050508 Bacteria 2949
170 nmdc:mga0qj67_115849_c1 3300050509 Bacteria 2165
171 nmdc:mga0qj67_264522_c1 3300050509 Bacteria 1395
172 nmdc:mga0qj67_286_c1 3300050509 Bacteria 35189
173 nmdc:mga0qj67_393_c1 3300050509 Bacteria 30195
174 nmdc:mga0qj67_8927_c1 3300050509 Bacteria 7436
175 nmdc:mga06r32_107370_c1 3300050510 Bacteria 2743
176 nmdc:mga06r32_12934_c1 3300050510 Bacteria 7545
177 nmdc:mga06r32_22327_c1 3300050510 Bacteria 5850
178 nmdc:mga06r32_317859_c1 3300050510 Bacteria 1542
179 nmdc:mga06r32_460_c1 3300050510 Bacteria 34832
180 nmdc:mga08y16_30305_c1 3300050511 Bacteria 5695
181 nmdc:mga0n895_19998_c1 3300050512 Bacteria 6234
182 nmdc:mga0rr50_17845_c1 3300050513 Bacteria 4752
183 nmdc:mga08x19_88334_c1 3300050514 Bacteria 2043
184 nmdc:mga0a205_16793_c1 3300050515 Bacteria 6855
185 nmdc:mga0a205_522128_c1 3300050515 Bacteria 1044
186 2585296750 2582581312 Bacteria 7308206
187 2643824872 2643221561 Bacteria 4984412
188 2643893619 2643221576 Bacteria 5214352
189 2643962669 2643221590 Bacteria 5214697
190 2644115733 2643221620 Bacteria 5134593
191 2644232081 2643221641 Bacteria 4490190
192 2644532577 2643221696 Bacteria 5431823
193 2738868285 2738541305 Bacteria 4910150
194 2740168552 2739367898 Bacteria 4367674
195 2858892471 2858888857 Bacteria 7060307
196 2869053102 2869048445 Bacteria 6875584
197 2870628223 2870628048 Bacteria 3696012
198 2887486469 2887478801 Bacteria 8972725
199 8001782545 8001781756 Bacteria 9586736
200 Ga0075429_100268902
201 JGI25406J46586_10005128
202 Ga0070658_10000656
203 Ga0070683_100129079
204 Ga0068869_100386693
205 Ga0070680_100092902
206 Ga0070682_100299177
207 Ga0070709_10137873
208 Ga0070713_100198853
209 Ga0070700_100550817
210 Ga0070708_100143231
211 Ga0070706_100176703
212 Ga0070698_100122245
213 Ga0070699_100000019
214 Ga0070699_100185232
215 Ga0070684_100068305
216 Ga0070684_100157968
217 Ga0070695_100091940
218 Ga0070665_100408963
219 Ga0068857_100150372
220 Ga0068859_100041171
221 Ga0068864_100083796
222 Ga0068862_100118490
223 Ga0081455_10053642
224 Ga0081455_10059843
225 Ga0081538_10000202
226 Ga0081540_1001008
227 Ga0081539_10000173
228 Ga0081539_10006220
229 Ga0070717_10320621
230 Ga0075365_10004210
231 Ga0075364_10030903
232 Ga0075428_100001383
233 Ga0075428_100026597
234 Ga0075428_100262680
235 Ga0075428_100661625
236 Ga0075430_100000563
237 Ga0075430_100050601
238 Ga0075431_100009160
239 Ga0075431_100034587
240 Ga0075431_100043763
241 Ga0075431_100119355
242 Ga0075433_10001093
243 Ga0075434_100013866
244 Ga0075429_100000905
245 Ga0075429_100006371
246 Ga0068865_100377959
247 Ga0075436_100218060
248 Ga0097620_100041173
249 Ga0075435_100005243
250 Ga0105250_10154800
251 Ga0111539_10452812
252 Ga0114129_10001225
253 Ga0114129_10048221
254 Ga0114129_10050377
255 Ga0105248_10012238
256 Ga0157372_10686702
257 Ga0163163_10221122
258 Ga0157379_10166309
259 Ga0207699_10107070
260 Ga0207705_10001496
261 Ga0207707_10334911
262 Ga0207693_10296613
263 Ga0207660_10305877
264 Ga0207649_10398693
265 Ga0207650_10218619
266 Ga0207659_10001808
267 Ga0207706_10216599
268 Ga0207709_10105582
269 Ga0207665_10395533
270 Ga0207711_10064301
271 Ga0207689_10038871
272 Ga0207689_10228916
273 Ga0207661_10005771
274 Ga0207679_10019757
275 Ga0207668_10083976
276 Ga0207677_10015400
277 Ga0207703_10163754
278 Ga0207678_10002231
279 Ga0207708_10227631
280 Ga0207702_10111181
281 Ga0207676_10176745
282 Ga0207674_10211729
283 Ga0207698_10099852
284 Ga0207428_10026072
285 Ga0268266_10419412
286 Ga0307515_10127146
287 Ga0307513_10095731
288 Ga0307408_100240066
289 Ga0316579_10000001
290 Ga0316579_10024829
291 Ga0316576_10001111
292 Ga0316576_10017984
293 Ga0316578_10014368
294 Ga0307405_10271739
295 Ga0307413_10192620
296 Ga0307410_10107159
297 Ga0307406_10120379
298 Ga0307406_10213593
299 Ga0307412_10009096
300 Ga0307409_100017091
301 Ga0307416_100165262
302 Ga0307416_100364712
303 Ga0307415_100032338
304 Ga0307415_100146339
305 Ga0307507_10211153
306 Ga0316574_0013486
307 Ga0373927_0271660
308 Ga0316582_0060141
309 Ga0316584_0003602
310 Ga0395899_0176439
311 Ga0395900_0007186
312 Ga0395900_0037902
313 Ga0395898_0071134
314 Ga0395898_0133229
315 Ga0395905_0036816
316 Ga0395901_0046158
317 Ga0395901_0406924
318 Ga0439459_0057562
319 Ga0466957_0072921
320 Ga0466967_0004829
321 Ga0495641_0187104
322 Ga0495651_0069646
323 Ga0495653_0198388
324 Ga0495580_0000741
325 Ga0495580_0170777
326 Ga0495608_0076268
327 Ga0495608_0203093
328 Ga0495652_0088472
329 Ga0495587_0059823
330 Ga0495645_0084448
331 Ga0495667_0012370
332 Ga0495635_0300700
333 Ga0495613_0089033
334 Ga0495604_0050370
335 Ga0495674_0527496
336 Ga0495680_0040286
337 Ga0495684_0001338
338 Ga0495602_0024373
339 Ga0495602_0205580
340 Ga0496102_0087128
341 Ga0496104_0091905
342 Ga0496104_0289237
343 Ga0496108_0048510
344 Ga0496109_0010302
345 Ga0496109_0203205
346 Ga0496110_0002927
347 Ga0496110_0132404
348 Ga0496111_0100435
349 Ga0496112_0141760
350 Ga0496112_0864062
351 Ga0496113_0012973
352 Ga0501033_0000152
353 Ga0501034_0008866
354 Ga0501034_0166353
355 Ga0501036_0534939
356 Ga0501039_0112884
357 Ga0501046_0177431
358 Ga0501047_0038377
359 Ga0501069_0012039
360 nmdc:mga00v17_233474_c1
361 nmdc:mga0yw44_3522_c1
362 nmdc:mga05p37_16323_c1
363 nmdc:mga05p37_1791_c1
364 nmdc:mga05p37_345654_c1
365 nmdc:mga09592_27050_c1
366 nmdc:mga09592_3_c1
367 nmdc:mga09592_445664_c1
368 nmdc:mga09592_71334_c1
369 nmdc:mga0qj67_115849_c1
370 nmdc:mga0qj67_264522_c1
371 nmdc:mga0qj67_286_c1
372 nmdc:mga0qj67_393_c1
373 nmdc:mga0qj67_8927_c1
374 nmdc:mga06r32_107370_c1
375 nmdc:mga06r32_12934_c1
376 nmdc:mga06r32_22327_c1
377 nmdc:mga06r32_317859_c1
378 nmdc:mga06r32_460_c1
379 nmdc:mga08y16_30305_c1
380 nmdc:mga0n895_19998_c1
381 nmdc:mga0rr50_17845_c1
382 nmdc:mga08x19_88334_c1
383 nmdc:mga0a205_16793_c1
384 nmdc:mga0a205_522128_c1
385 2585296750
386 2643824872
387 2643893619
388 2643962669
389 2644115733
390 2644232081
391 2644532577
392 2738868285
393 2740168552
394 2858892471
395 2869053102
396 2870628223
397 2887486469
398 8001782545

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

29

176

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xu1-assembly1.cif.gz_B structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9399 8 228
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9396 10 233
7w7b-assembly2.cif.gz_G heme exporter hrtba in complex with protoporphyrin ix containing manganese(iii), high resolution data 0.9388 8 226
7w7a-assembly2.cif.gz_E heme exporter in complex with mn-containing protoporphyrin ix, mn-anomalous data 0.9378 9 224
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.935 8 228
ID Description Score Start End Superfamily
af_Q2G0D8_1_227_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9598 8 230 3.40.50.300
af_Q2G167_1_224_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9531 10 227 3.40.50.300
af_Q2FUZ1_1_243_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9412 8 244 3.40.50.300
af_P9WQK1_1_231_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9397 8 226 3.40.50.300
af_Q2G0D8_1_227_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9392 8 230 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3P1WHQ0-F1-model_v4 ATP-binding cassette domain-containing protein 0.9912 6 245 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-R7MIN1-F1-model_v4 deleted 0.9857 8 227
AF-A0A4P8II76-F1-model_v4 ABC transporter ATP-binding protein 0.9797 7 227 GO:0005524
GO:0016887
AF-R7MIN1-F1-model_v4 deleted 0.9726 8 227
AF-A0A0G3GLA2-F1-model_v4 ABC-type antimicrobial peptide transport system, ATPase component 0.9693 6 227 GO:0005524
GO:0005886
GO:0016887
GO:0022857

Map