F306840

General Info

Members Datasets Scaffolds Average Seq Length
200 147 400 279

Family's Representative Sequence

Representative Sequence 3300005456|Ga0070678_100102862|Ga0070678_1001028622
Length 326
Sequence MPAKASAASWSIDAILTVRAELVGALSFFRRDEERQSFDKLRTNGGSGLEILSTNKAFEGTQGVYRHASAATGTDMTFSVFVPAYEQGEKLPVVWYLSGLTCTHANVTEKGEYRAACAKHRLIFVAPDTSPRGETVPDDPDGAYDFGLGAGFYVDATQDPWAVNYRMWSYVTEELPALIGSAFPADMTRQSILGHSMGGHGALTIGLTFPDRFSAVSAFAPIVAPSQVSWGRKALGGYLGPDKTAWRKHDAVALIEDGARLPELLVDQGADDQFLQQELRPELLRAVCADAGIALTLNLRPGYDHSYYFVSTFMADHLAWHAARLA

Samples

Sample ID Description Type Environment
1 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
98 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
99 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
102 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
103 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
104 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
105 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
106 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
107 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
108 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
109 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
110 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
111 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
112 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
113 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
114 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
115 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
116 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
117 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
118 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
119 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
120 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
121 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
122 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
123 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
124 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
125 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
126 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
127 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
128 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
129 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
130 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
131 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
132 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
133 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
134 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
135 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
136 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
137 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
138 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
139 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
140 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
141 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
142 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
143 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
144 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
145 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
146 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
147 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98
Metatranscriptomes 0.5
Isolates 1.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.5
Nodule 0
Rhizoplane 2.5
Rhizosphere 87
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070678_100102862 3300005456 Bacteria 2218
2 SwRhRL2b_contig_1223872 2162886007 Bacteria 910
3 JGI24744J21845_10008903 3300002077 Bacteria 2063
4 Ga0070658_10012036 3300005327 Bacteria 6948
5 Ga0070658_10082839 3300005327 Bacteria 2636
6 Ga0070676_10004547 3300005328 Bacteria 7310
7 Ga0070670_100072404 3300005331 Bacteria 2959
8 Ga0068869_100000288 3300005334 Bacteria 26913
9 Ga0070680_100138137 3300005336 Bacteria 2043
10 Ga0068868_100000589 3300005338 Bacteria 24447
11 Ga0068868_100106465 3300005338 Bacteria 2275
12 Ga0070660_100115051 3300005339 Bacteria 2143
13 Ga0070660_100295777 3300005339 Bacteria 1326
14 Ga0070661_100078175 3300005344 Bacteria 2440
15 Ga0070692_10028408 3300005345 Bacteria 2779
16 Ga0070668_100000049 3300005347 Bacteria 74953
17 Ga0070675_100007786 3300005354 Bacteria 8298
18 Ga0070675_100012081 3300005354 Bacteria 6768
19 Ga0070671_100000269 3300005355 Bacteria 35055
20 Ga0070671_100286289 3300005355 Bacteria 1402
21 Ga0070673_100000012 3300005364 Bacteria 141279
22 Ga0070673_100007540 3300005364 Bacteria 7190
23 Ga0070659_100035619 3300005366 Bacteria 3876
24 Ga0070659_100065939 3300005366 Bacteria 2868
25 Ga0070659_100088869 3300005366 Bacteria 2475
26 Ga0070659_100111511 3300005366 Bacteria 2208
27 Ga0070659_100186401 3300005366 Bacteria 1704
28 Ga0070714_100138378 3300005435 Bacteria 2183
29 Ga0070678_100005985 3300005456 Bacteria 7088
30 Ga0070662_100318010 3300005457 Bacteria 1269
31 Ga0068867_100000253 3300005459 Bacteria 35386
32 Ga0070679_100108533 3300005530 Bacteria 2761
33 Ga0070679_100253544 3300005530 Bacteria 1715
34 Ga0070672_100055884 3300005543 Bacteria 3094
35 Ga0070665_100179279 3300005548 Bacteria 2119
36 Ga0068855_100238201 3300005563 Bacteria 2034
37 Ga0068855_100371589 3300005563 Bacteria 1572
38 Ga0068855_100449628 3300005563 Bacteria 1406
39 Ga0070664_100080535 3300005564 Bacteria 2805
40 Ga0068857_100576369 3300005577 Bacteria 1062
41 Ga0068854_100059727 3300005578 Bacteria 2756
42 Ga0068856_100261358 3300005614 Bacteria 1746
43 Ga0068852_100344928 3300005616 Bacteria 1452
44 Ga0068859_100000823 3300005617 Bacteria 31532
45 Ga0068861_100000007 3300005719 Bacteria 86469
46 Ga0068861_100210941 3300005719 Bacteria 1636
47 Ga0068863_100007486 3300005841 Bacteria 10680
48 Ga0068858_100340818 3300005842 Bacteria 1435
49 Ga0068860_100324070 3300005843 Bacteria 1512
50 Ga0068862_100000411 3300005844 Bacteria 46404
51 Ga0068865_100000002 3300006881 Bacteria 285745
52 Ga0097620_100000823 3300006931 Bacteria 31532
53 Ga0105240_10159124 3300009093 Bacteria 2684
54 Ga0105240_10463893 3300009093 Bacteria 1415
55 Ga0105245_10002408 3300009098 Bacteria 16918
56 Ga0105247_10328167 3300009101 Bacteria 1070
57 Ga0114129_10181896 3300009147 Bacteria 2860
58 Ga0105243_10000799 3300009148 Bacteria 30094
59 Ga0105242_10000206 3300009176 Bacteria 45972
60 Ga0105248_10000324 3300009177 Bacteria 56570
61 Ga0105248_10003285 3300009177 Bacteria 17946
62 Ga0105248_10063346 3300009177 Bacteria 4151
63 Ga0105248_11036057 3300009177 Bacteria 927
64 Ga0105238_10142751 3300009551 Bacteria 2371
65 Ga0105246_10008581 3300011119 Bacteria 6283
66 Ga0157373_10044826 3300013100 Bacteria 3158
67 Ga0157371_10328212 3300013102 Bacteria 1111
68 Ga0157369_10017243 3300013105 Bacteria 8117
69 Ga0157369_10230999 3300013105 Bacteria 1934
70 Ga0157369_10318066 3300013105 Bacteria 1618
71 Ga0157374_10002902 3300013296 Bacteria 14368
72 Ga0157378_10017063 3300013297 Bacteria 6365
73 Ga0163162_10007077 3300013306 Bacteria 10885
74 Ga0157375_10006269 3300013308 Bacteria 10359
75 Ga0157380_10069540 3300014326 Bacteria 2841
76 Ga0206353_11470001 3300020082 Bacteria 2558
77 Ga0207688_10049103 3300025901 Bacteria 2358
78 Ga0207647_10047958 3300025904 Bacteria 2654
79 Ga0207647_10086660 3300025904 Bacteria 1871
80 Ga0207645_10001923 3300025907 Bacteria 16755
81 Ga0207705_10043607 3300025909 Bacteria 3223
82 Ga0207695_10060058 3300025913 Bacteria 3938
83 Ga0207660_10425336 3300025917 Bacteria 1072
84 Ga0207657_10034495 3300025919 Bacteria 4549
85 Ga0207657_10160818 3300025919 Bacteria 1824
86 Ga0207652_10051970 3300025921 Bacteria 3515
87 Ga0207652_10292656 3300025921 Bacteria 1469
88 Ga0207650_10007267 3300025925 Bacteria 7542
89 Ga0207659_10059679 3300025926 Bacteria 2743
90 Ga0207687_10000630 3300025927 Bacteria 23796
91 Ga0207664_10085129 3300025929 Bacteria 2579
92 Ga0207664_10188799 3300025929 Bacteria 1773
93 Ga0207644_10231874 3300025931 Bacteria 1467
94 Ga0207690_10011714 3300025932 Bacteria 5243
95 Ga0207690_10022933 3300025932 Bacteria 3889
96 Ga0207690_10253139 3300025932 Bacteria 1361
97 Ga0207690_10347358 3300025932 Bacteria 1172
98 Ga0207706_10072929 3300025933 Bacteria 3019
99 Ga0207706_10151055 3300025933 Bacteria 2043
100 Ga0207686_10000803 3300025934 Bacteria 19272
101 Ga0207709_10000559 3300025935 Bacteria 31723
102 Ga0207704_10000003 3300025938 Bacteria 285808
103 Ga0207704_10244055 3300025938 Bacteria 1344
104 Ga0207691_10065191 3300025940 Bacteria 3298
105 Ga0207691_10192752 3300025940 Bacteria 1777
106 Ga0207711_10001657 3300025941 Bacteria 20542
107 Ga0207711_10016983 3300025941 Bacteria 6045
108 Ga0207711_10042435 3300025941 Bacteria 3876
109 Ga0207689_10000902 3300025942 Bacteria 28523
110 Ga0207667_10004514 3300025949 Bacteria 17055
111 Ga0207651_10000003 3300025960 Bacteria 308050
112 Ga0207651_10004749 3300025960 Bacteria 6906
113 Ga0207668_10037785 3300025972 Bacteria 3234
114 Ga0207668_10120887 3300025972 Bacteria 1983
115 Ga0207668_10178437 3300025972 Bacteria 1673
116 Ga0207640_10044921 3300025981 Bacteria 2834
117 Ga0207640_10101055 3300025981 Bacteria 2022
118 Ga0207658_10040285 3300025986 Bacteria 3376
119 Ga0207677_10000416 3300026023 Bacteria 28983
120 Ga0207639_10176159 3300026041 Bacteria 1816
121 Ga0207702_10087387 3300026078 Bacteria 2722
122 Ga0207702_10128072 3300026078 Bacteria 2282
123 Ga0207641_10579680 3300026088 Bacteria 1096
124 Ga0207648_10000167 3300026089 Bacteria 67709
125 Ga0207674_10323703 3300026116 Bacteria 1491
126 Ga0207675_100001249 3300026118 Bacteria 25345
127 Ga0209371_1029454 3300027312 Bacteria 1213
128 Ga0209974_10020892 3300027876 Bacteria 2170
129 Ga0268266_10161331 3300028379 Bacteria 2028
130 Ga0268264_10676348 3300028381 Bacteria 1023
131 Ga0268256_1036679 3300030500 Bacteria 1129
132 Ga0307413_10030080 3300031824 Bacteria 3046
133 Ga0307406_10385141 3300031901 Bacteria 1107
134 Ga0307416_100180974 3300032002 Bacteria 1976
135 Ga0395900_0051695 3300037418 Bacteria 4232
136 Ga0395900_0135566 3300037418 Bacteria 2522
137 Ga0395898_0277538 3300037466 Bacteria 1598
138 Ga0395905_0015817 3300037471 Bacteria 7166
139 Ga0395905_0267094 3300037471 Bacteria 1596
140 Ga0395905_0385049 3300037471 Bacteria 1296
141 Ga0395901_0040869 3300038443 Bacteria 4804
142 Ga0439448_0000373 3300042005 Bacteria 10141
143 Ga0451577_0012571 3300042876 Bacteria 7947
144 Ga0466963_0211364 3300044694 Bacteria 1358
145 Ga0466971_0071168 3300044719 Bacteria 1580
146 Ga0495627_000109 3300046453 Bacteria 101751
147 Ga0495638_0001114 3300046460 Bacteria 26119
148 Ga0495607_0012929 3300046501 Bacteria 5489
149 Ga0495607_0057427 3300046501 Bacteria 2230
150 Ga0495606_0001565 3300046507 Bacteria 30000
151 Ga0495606_0117693 3300046507 Bacteria 1594
152 Ga0495610_0005638 3300046512 Bacteria 8831
153 Ga0495616_0001098 3300046513 Bacteria 19261
154 Ga0495616_0139617 3300046513 Bacteria 1104
155 Ga0495631_0066561 3300046518 Bacteria 1559
156 Ga0495632_0000083 3300046519 Bacteria 97159
157 Ga0495632_0008992 3300046519 Bacteria 6061
158 Ga0495643_0002639 3300046522 Bacteria 13914
159 Ga0495643_0053758 3300046522 Bacteria 2158
160 Ga0495654_0024271 3300046530 Bacteria 3135
161 Ga0495668_0003046 3300046616 Bacteria 13027
162 Ga0495625_0000568 3300046660 Bacteria 54059
163 Ga0495625_0011816 3300046660 Bacteria 7093
164 Ga0495669_0055979 3300046684 Bacteria 1777
165 Ga0495669_0132513 3300046684 Bacteria 1173
166 Ga0495673_0150072 3300047469 Bacteria 902
167 Ga0495686_0000191 3300047472 Bacteria 114738
168 Ga0495686_0004962 3300047472 Bacteria 10702
169 Ga0495615_0000021 3300048090 Bacteria 52484
170 Ga0495626_0000826 3300048091 Bacteria 27802
171 Ga0496102_0000036 3300048905 Bacteria 201896
172 Ga0496103_0000074 3300048906 Bacteria 116385
173 Ga0496108_0000312 3300048911 Bacteria 41253
174 Ga0496112_0013393 3300048915 Bacteria 7570
175 Ga0496115_0000288 3300048918 Bacteria 43537
176 Ga0496116_0000405 3300048919 Bacteria 62060
177 Ga0496117_0000093 3300048920 Bacteria 201862
178 Ga0496117_0146414 3300048920 Bacteria 1405
179 Ga0496118_0000070 3300048921 Bacteria 201866
180 Ga0496118_0088108 3300048921 Bacteria 2149
181 Ga0496119_0007469 3300048922 Bacteria 9833
182 Ga0496121_0000569 3300048924 Bacteria 69581
183 Ga0496121_0017693 3300048924 Bacteria 7255
184 Ga0496124_0000225 3300048927 Bacteria 110516
185 Ga0496125_0074664 3300048928 Bacteria 2628
186 Ga0496126_0038678 3300048929 Bacteria 4435
187 Ga0496126_0316383 3300048929 Bacteria 1284
188 Ga0501221_004558 3300049704 Bacteria 2298
189 nmdc:mga0k408_87832_c1 3300050493 Bacteria 1826
190 Ga0500643_000241 3300053087 Bacteria 50801
191 Ga0500562_058856 3300053108 Bacteria 1032
192 Ga0500595_043109 3300053119 Bacteria 1439
193 Ga0500559_0005654 3300053136 Bacteria 5722
194 Ga0500604_0000356 3300053151 Bacteria 12632
195 Ga0500616_0027915 3300053153 Bacteria 3114
196 Ga0500627_0001620 3300053158 Bacteria 6361
197 Ga0500645_006722 3300053730 Bacteria 4077
198 2512644718 2512564014 Bacteria 4639632
199 2885432559 2885429604 Bacteria 3642894
200 8054304724 8054302542 Bacteria 5698134
201 Ga0070678_100102862
202 SwRhRL2b_contig_1223872
203 JGI24744J21845_10008903
204 Ga0070658_10012036
205 Ga0070658_10082839
206 Ga0070676_10004547
207 Ga0070670_100072404
208 Ga0068869_100000288
209 Ga0070680_100138137
210 Ga0068868_100000589
211 Ga0068868_100106465
212 Ga0070660_100115051
213 Ga0070660_100295777
214 Ga0070661_100078175
215 Ga0070692_10028408
216 Ga0070668_100000049
217 Ga0070675_100007786
218 Ga0070675_100012081
219 Ga0070671_100000269
220 Ga0070671_100286289
221 Ga0070673_100000012
222 Ga0070673_100007540
223 Ga0070659_100035619
224 Ga0070659_100065939
225 Ga0070659_100088869
226 Ga0070659_100111511
227 Ga0070659_100186401
228 Ga0070714_100138378
229 Ga0070678_100005985
230 Ga0070662_100318010
231 Ga0068867_100000253
232 Ga0070679_100108533
233 Ga0070679_100253544
234 Ga0070672_100055884
235 Ga0070665_100179279
236 Ga0068855_100238201
237 Ga0068855_100371589
238 Ga0068855_100449628
239 Ga0070664_100080535
240 Ga0068857_100576369
241 Ga0068854_100059727
242 Ga0068856_100261358
243 Ga0068852_100344928
244 Ga0068859_100000823
245 Ga0068861_100000007
246 Ga0068861_100210941
247 Ga0068863_100007486
248 Ga0068858_100340818
249 Ga0068860_100324070
250 Ga0068862_100000411
251 Ga0068865_100000002
252 Ga0097620_100000823
253 Ga0105240_10159124
254 Ga0105240_10463893
255 Ga0105245_10002408
256 Ga0105247_10328167
257 Ga0114129_10181896
258 Ga0105243_10000799
259 Ga0105242_10000206
260 Ga0105248_10000324
261 Ga0105248_10003285
262 Ga0105248_10063346
263 Ga0105248_11036057
264 Ga0105238_10142751
265 Ga0105246_10008581
266 Ga0157373_10044826
267 Ga0157371_10328212
268 Ga0157369_10017243
269 Ga0157369_10230999
270 Ga0157369_10318066
271 Ga0157374_10002902
272 Ga0157378_10017063
273 Ga0163162_10007077
274 Ga0157375_10006269
275 Ga0157380_10069540
276 Ga0206353_11470001
277 Ga0207688_10049103
278 Ga0207647_10047958
279 Ga0207647_10086660
280 Ga0207645_10001923
281 Ga0207705_10043607
282 Ga0207695_10060058
283 Ga0207660_10425336
284 Ga0207657_10034495
285 Ga0207657_10160818
286 Ga0207652_10051970
287 Ga0207652_10292656
288 Ga0207650_10007267
289 Ga0207659_10059679
290 Ga0207687_10000630
291 Ga0207664_10085129
292 Ga0207664_10188799
293 Ga0207644_10231874
294 Ga0207690_10011714
295 Ga0207690_10022933
296 Ga0207690_10253139
297 Ga0207690_10347358
298 Ga0207706_10072929
299 Ga0207706_10151055
300 Ga0207686_10000803
301 Ga0207709_10000559
302 Ga0207704_10000003
303 Ga0207704_10244055
304 Ga0207691_10065191
305 Ga0207691_10192752
306 Ga0207711_10001657
307 Ga0207711_10016983
308 Ga0207711_10042435
309 Ga0207689_10000902
310 Ga0207667_10004514
311 Ga0207651_10000003
312 Ga0207651_10004749
313 Ga0207668_10037785
314 Ga0207668_10120887
315 Ga0207668_10178437
316 Ga0207640_10044921
317 Ga0207640_10101055
318 Ga0207658_10040285
319 Ga0207677_10000416
320 Ga0207639_10176159
321 Ga0207702_10087387
322 Ga0207702_10128072
323 Ga0207641_10579680
324 Ga0207648_10000167
325 Ga0207674_10323703
326 Ga0207675_100001249
327 Ga0209371_1029454
328 Ga0209974_10020892
329 Ga0268266_10161331
330 Ga0268264_10676348
331 Ga0268256_1036679
332 Ga0307413_10030080
333 Ga0307406_10385141
334 Ga0307416_100180974
335 Ga0395900_0051695
336 Ga0395900_0135566
337 Ga0395898_0277538
338 Ga0395905_0015817
339 Ga0395905_0267094
340 Ga0395905_0385049
341 Ga0395901_0040869
342 Ga0439448_0000373
343 Ga0451577_0012571
344 Ga0466963_0211364
345 Ga0466971_0071168
346 Ga0495627_000109
347 Ga0495638_0001114
348 Ga0495607_0012929
349 Ga0495607_0057427
350 Ga0495606_0001565
351 Ga0495606_0117693
352 Ga0495610_0005638
353 Ga0495616_0001098
354 Ga0495616_0139617
355 Ga0495631_0066561
356 Ga0495632_0000083
357 Ga0495632_0008992
358 Ga0495643_0002639
359 Ga0495643_0053758
360 Ga0495654_0024271
361 Ga0495668_0003046
362 Ga0495625_0000568
363 Ga0495625_0011816
364 Ga0495669_0055979
365 Ga0495669_0132513
366 Ga0495673_0150072
367 Ga0495686_0000191
368 Ga0495686_0004962
369 Ga0495615_0000021
370 Ga0495626_0000826
371 Ga0496102_0000036
372 Ga0496103_0000074
373 Ga0496108_0000312
374 Ga0496112_0013393
375 Ga0496115_0000288
376 Ga0496116_0000405
377 Ga0496117_0000093
378 Ga0496117_0146414
379 Ga0496118_0000070
380 Ga0496118_0088108
381 Ga0496119_0007469
382 Ga0496121_0000569
383 Ga0496121_0017693
384 Ga0496124_0000225
385 Ga0496125_0074664
386 Ga0496126_0038678
387 Ga0496126_0316383
388 Ga0501221_004558
389 nmdc:mga0k408_87832_c1
390 Ga0500643_000241
391 Ga0500562_058856
392 Ga0500595_043109
393 Ga0500559_0005654
394 Ga0500604_0000356
395 Ga0500616_0027915
396 Ga0500627_0001620
397 Ga0500645_006722
398 2512644718
399 2885432559
400 8054304724

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00756

Esterase

Putative esterase

69

321

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e4d-assembly2.cif.gz_D structural and kinetic study of an s-formylglutathione hydrolase from agrobacterium tumefaciens 0.9625 8 283
4b6g-assembly2.cif.gz_B the crystal structure of the neisserial esterase d. 0.9574 8 281
3e4d-assembly2.cif.gz_D structural and kinetic study of an s-formylglutathione hydrolase from agrobacterium tumefaciens 0.9523 8 283
3s8y-assembly1.cif.gz_A bromide soaked structure of an esterase from the oil-degrading bacterium oleispira antarctica 0.9497 6 283
6jzl-assembly1.cif.gz_A s-formylglutathione hydrolase homolog from a psychrophilic bacterium of shewanella frigidimarina 0.9474 8 283
ID Description Score Start End Superfamily
3fcxB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9394 8 283 3.40.50.1820
af_Q54RL8_4_285_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9375 8 283 3.40.50.1820
3fcxB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9295 8 283 3.40.50.1820
af_A0A0G2JYG2_4_177_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9179 9 183 3.40.50.1820
af_Q54RL8_4_285_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9151 8 283 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A520HT63-F1-model_v4 S-formylglutathione hydrolase (EC 3.1.2.12) 0.9926 134 283 GO:0005829
GO:0018738
GO:0046294
GO:0052689
AF-A0A060CE92-F1-model_v4 S-formylglutathione hydrolase (EC 3.1.2.12) 0.9877 175 285 GO:0005829
GO:0018738
GO:0046294
GO:0052689
AF-A0A3D0ZU78-F1-model_v4 S-formylglutathione hydrolase (EC 3.1.2.12) 0.9858 108 283 GO:0005829
GO:0018738
GO:0046294
GO:0052689
AF-A0A0S8FE76-F1-model_v4 S-formylglutathione hydrolase (EC 3.1.2.12) 0.9841 109 283 GO:0005829
GO:0018738
GO:0046294
GO:0052689
AF-A0A520R925-F1-model_v4 S-formylglutathione hydrolase (EC 3.1.2.12) 0.982 153 286 GO:0005829
GO:0018738
GO:0046294
GO:0052689

Map