F306781

General Info

Members Datasets Scaffolds Average Seq Length
200 174 130 436

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100002426|Ga0070671_10000242616
Length 471
Sequence MREVKEAANQEAVPTAVVAAATNPLRAALRDLSTVEMRGRVTEVLGTLVKAVGVQARIGEICELRNPTPDGVGHIRQDSPLRAEVIGFRGSTAILTPFGDISGLSSDTEVVTLQRTFAVPTGRGLLGRVLDGFGRPIDGRGPVGDIWHVPVNADPPAPLTRRPVNQVCETRVRAIDALFTVGRGQRVGVIAPVGAGKTTLMGMLARGAQADVTVIALVGERGREIGEFINRTLGPEGMKHSVVVVSTADRPAVERAKCAQVATAVAEGFRREGLHVLLLMDSVTRYARALREIGLASGEAPTRRGFPPSVFAALPKLLERAGNDDRGGITAFYTLLVEGDEENDPIAEEVTSLLDGHLHLSRTQAQAHQFPAIDVLTSLSRVMPAITSTAQQEACAQIRSWLAKHREIEMLVQMGEYRTGADAEADAALAHVPKIHKFLRQQPDEFSPIDDTTRALMSLVEGNSDGANGNE

Samples

Sample ID Description Type Environment
1 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
2 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
3 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
4 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
5 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
6 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
7 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
8 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
9 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
10 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
11 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
12 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
13 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
14 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
15 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
16 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
17 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
18 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
19 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
20 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
21 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
22 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
23 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
24 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
25 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
26 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
27 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
28 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
29 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
30 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
31 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
32 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
33 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
34 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
35 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
36 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
37 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
38 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
39 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
40 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
41 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
42 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
43 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
44 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
45 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
46 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
47 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
48 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
49 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
50 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
51 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
52 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
53 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
54 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
55 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
56 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
57 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
58 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
59 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
60 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
61 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
62 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
63 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
64 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
65 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
66 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
67 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
68 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
69 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
70 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
71 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
72 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
73 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
86 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
107 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
124 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
125 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
126 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
127 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
131 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
134 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
135 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
136 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
137 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
138 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
139 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
142 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
145 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
148 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
149 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
156 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
159 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
162 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
163 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
164 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
165 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
166 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
167 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
168 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
170 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
171 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
172 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
173 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
174 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 65
Metatranscriptomes 0
Isolates 35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4
Nodule 29
Rhizoplane 0.5
Rhizosphere 55.5
Stem 0
Stem Tuber 0
Unclassified 11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10081750 3300005295 Bacteria 51142
2 Ga0070658_10000461 3300005327 Bacteria 35222
3 Ga0070683_100000586 3300005329 Bacteria 25995
4 Ga0070683_100089505 3300005329 Bacteria 2889
5 Ga0070680_100227468 3300005336 Bacteria 1575
6 Ga0070671_100002426 3300005355 Bacteria 14408
7 Ga0070671_100004199 3300005355 Bacteria 11392
8 Ga0070667_100012681 3300005367 Bacteria 6970
9 Ga0070684_100001749 3300005535 Bacteria 15819
10 Ga0070665_100013202 3300005548 Bacteria 8321
11 Ga0070665_100021181 3300005548 Bacteria 6535
12 Ga0070665_100085346 3300005548 Bacteria 3163
13 Ga0068857_100015763 3300005577 Bacteria 6613
14 Ga0068859_100003728 3300005617 Bacteria 15539
15 Ga0068864_100005226 3300005618 Bacteria 10641
16 Ga0068863_100024781 3300005841 Bacteria 5722
17 Ga0068858_100001417 3300005842 Bacteria 24639
18 Ga0075365_10055024 3300006038 Bacteria 2640
19 Ga0097621_100175966 3300006237 Bacteria 1847
20 Ga0075431_100203287 3300006847 Bacteria 2026
21 Ga0075429_100119364 3300006880 Bacteria 2304
22 Ga0097620_100003728 3300006931 Bacteria 15539
23 Ga0099795_10000017 3300007788 Bacteria 63153
24 Ga0105250_10010140 3300009092 Bacteria 3933
25 Ga0105240_10000828 3300009093 Bacteria 55952
26 Ga0105240_10001319 3300009093 Bacteria 42818
27 Ga0105240_10003331 3300009093 Bacteria 25012
28 Ga0105240_10010075 3300009093 Bacteria 13305
29 Ga0105240_10048135 3300009093 Bacteria 5390
30 Ga0105245_10005864 3300009098 Bacteria 10787
31 Ga0105247_10001326 3300009101 Bacteria 18058
32 Ga0105241_10029717 3300009174 Bacteria 4079
33 Ga0105242_10115990 3300009176 Bacteria 2290
34 Ga0105248_10012718 3300009177 Bacteria 9286
35 Ga0105237_10005604 3300009545 Bacteria 14150
36 Ga0105237_10154437 3300009545 Bacteria 2292
37 Ga0105238_10000175 3300009551 Bacteria 69973
38 Ga0105238_10003244 3300009551 Bacteria 16244
39 Ga0105238_10008255 3300009551 Bacteria 10417
40 Ga0099796_10000009 3300010159 Bacteria 63267
41 Ga0105239_10003058 3300010375 Bacteria 20792
42 Ga0105239_10131855 3300010375 Bacteria 2780
43 Ga0157370_10138709 3300013104 Bacteria 2266
44 Ga0157369_10115954 3300013105 Unclassified 2844
45 Ga0157374_10008188 3300013296 Bacteria 8934
46 Ga0157378_10041306 3300013297 Bacteria 4091
47 Ga0157378_10056026 3300013297 Bacteria 3512
48 Ga0163162_10000249 3300013306 Bacteria 48772
49 Ga0157375_10000653 3300013308 Bacteria 30658
50 Ga0163163_10312947 3300014325 Bacteria 1623
51 Ga0157379_10014966 3300014968 Bacteria 6804
52 Ga0157379_10253216 3300014968 Bacteria 1599
53 Ga0163161_10000510 3300017792 Bacteria 31678
54 Ga0213873_10001713 3300021358 Bacteria 3679
55 Ga0213876_10071197 3300021384 Bacteria 1836
56 Ga0207710_10005256 3300025900 Bacteria 5594
57 Ga0207705_10002234 3300025909 Bacteria 14944
58 Ga0207695_10000063 3300025913 Bacteria 349527
59 Ga0207695_10030639 3300025913 Bacteria 5919
60 Ga0207695_10235114 3300025913 Bacteria 1735
61 Ga0207695_10255953 3300025913 Bacteria 1649
62 Ga0207652_10137173 3300025921 Bacteria 2185
63 Ga0207694_10000257 3300025924 Bacteria 50545
64 Ga0207694_10000673 3300025924 Bacteria 30672
65 Ga0207711_10006018 3300025941 Bacteria 10252
66 Ga0207661_10002135 3300025944 Bacteria 13610
67 Ga0207658_10009610 3300025986 Bacteria 6562
68 Ga0207703_10029222 3300026035 Bacteria 4348
69 Ga0207698_10044409 3300026142 Bacteria 3339
70 Ga0209179_1000001 3300027512 Bacteria 128813
71 Ga0268266_10087053 3300028379 Unclassified 2732
72 Ga0268266_10108019 3300028379 Bacteria 2461
73 Ga0268264_10018226 3300028381 Bacteria 5742
74 Ga0307515_10014918 3300028794 Bacteria 14361
75 Ga0265338_10028404 3300028800 Bacteria 5579
76 Ga0307511_10005042 3300030521 Bacteria 13467
77 Ga0265316_10061433 3300031344 Bacteria 2918
78 Ga0307509_10000178 3300031507 Bacteria 100228
79 Ga0316579_10002852 3300031691 Bacteria 6609
80 Ga0265314_10009125 3300031711 Bacteria 8419
81 Ga0307412_10045181 3300031911 Bacteria 2878
82 Ga0373923_0063103 3300035111 Bacteria 1577
83 Ga0373936_0019107 3300035113 Bacteria 2653
84 Ga0436364_0616191 3300037853 Unclassified 2600
85 Ga0436365_0108766 3300039437 Bacteria 12260
86 Ga0436362_0614188 3300039453 Bacteria 17382
87 Ga0466972_0053706 3300044658 Bacteria 1940
88 Ga0466966_0058794 3300044684 Bacteria 2429
89 Ga0466961_0030848 3300044693 Bacteria 3445
90 Ga0466964_0005888 3300044706 Bacteria 4565
91 Ga0453684_0212179 3300044712 Bacteria 2249
92 Ga0466971_0017016 3300044719 Bacteria 3214
93 Ga0466957_0014136 3300044842 Bacteria 4643
94 Ga0466959_0007154 3300045049 Bacteria 7812
95 Ga0466959_0163160 3300045049 Bacteria 1566
96 Ga0466958_0084756 3300045836 Bacteria 1954
97 Ga0466967_0030245 3300045976 Bacteria 4542
98 Ga0495627_001642 3300046453 Bacteria 12429
99 Ga0495628_0014141 3300046516 Bacteria 6698
100 Ga0496112_0165627 3300048915 Bacteria 2176
101 Ga0496121_0002526 3300048924 Bacteria 27740
102 Ga0496121_0040558 3300048924 Bacteria 4082
103 Ga0496124_0003370 3300048927 Bacteria 19628
104 Ga0496125_0002321 3300048928 Bacteria 25054
105 Ga0496125_0130000 3300048928 Bacteria 1775
106 Ga0501034_0000148 3300049571 Bacteria 131931
107 Ga0501043_0002538 3300049579 Bacteria 15438
108 Ga0501046_0000842 3300049580 Bacteria 29914
109 Ga0501047_0027565 3300049581 Bacteria 5472
110 Ga0501073_0162250 3300049589 Bacteria 1548
111 Ga0501075_0016868 3300049591 Bacteria 5266
112 Ga0501075_0045253 3300049591 Bacteria 3303
113 Ga0501076_0040799 3300049592 Bacteria 3648
114 Ga0501080_0046298 3300049742 Bacteria 4050
115 Ga0501083_0000018 3300049744 Bacteria 154637
116 Ga0501083_0161254 3300049744 Bacteria 1467
117 Ga0501035_0003963 3300049822 Bacteria 14109
118 Ga0501044_0004722 3300049823 Bacteria 15227
119 Ga0501044_0018122 3300049823 Bacteria 7551
120 nmdc:mga0yw44_80290_c1 3300050492 Bacteria 2043
121 nmdc:mga09592_117661_c1 3300050508 Bacteria 2281
122 nmdc:mga0sz30_20947_c1 3300050516 Bacteria 2641
123 Ga0500583_0022070 3300053092 Bacteria 2661
124 Ga0500641_0004411 3300053096 Bacteria 4975
125 Ga0500556_0000310 3300053104 Bacteria 37052
126 Ga0500604_0015273 3300053151 Bacteria 2102
127 Ga0500616_0000029 3300053153 Bacteria 428959
128 Ga0501082_0001158 3300060353 Bacteria 23221
129 Ga0501082_0113401 3300060353 Bacteria 2347
130 Ga0530510_0273737 3300061734 Bacteria 1260

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300061734 Ga0530510_0273737 Ga0530510_0273737_14_1081 340
2 3300035111 Ga0373923_0063103 Ga0373923_0063103_483_1562 344
3 3300013308 Ga0157375_10000653 Ga0157375_1000065331 353
4 3300049589 Ga0501073_0162250 Ga0501073_0162250_30_1166 355
5 3300009093 Ga0105240_10048135 Ga0105240_100481354 376
6 iso_pu_bacteria 2882912400 2882912552 377
7 3300037853 Ga0436364_0616191 Ga0436364_0616191_207_1451 378
8 3300017792 Ga0163161_10000510 Ga0163161_1000051024 380
9 3300048928 Ga0496125_0130000 Ga0496125_0130000_189_1442 380
10 3300025909 Ga0207705_10002234 Ga0207705_1000223410 381
11 3300025924 Ga0207694_10000257 Ga0207694_1000025713 381
12 3300035113 Ga0373936_0019107 Ga0373936_0019107_964_2208 381
13 3300046453 Ga0495627_001642 Ga0495627_001642_8742_9974 385
14 3300048927 Ga0496124_0003370 Ga0496124_0003370_6852_8084 385
15 3300013306 Ga0163162_10000249 Ga0163162_1000024917 386
16 3300044684 Ga0466966_0058794 Ga0466966_0058794_307_1623 387
17 3300045049 Ga0466959_0007154 Ga0466959_0007154_6040_7356 387
18 3300009551 Ga0105238_10000175 Ga0105238_100001754 388
19 3300050516 nmdc:mga0sz30_20947_c1 nmdc:mga0sz30_20947_c1_1363_2583 389
20 3300014968 Ga0157379_10253216 Ga0157379_102532162 391
21 3300021358 Ga0213873_10001713 Ga0213873_100017132 391
22 3300021384 Ga0213876_10071197 Ga0213876_100711972 391
23 3300039437 Ga0436365_0108766 Ga0436365_0108766_5395_6636 391
24 3300039453 Ga0436362_0614188 Ga0436362_0614188_6383_7624 391
25 iso_pu_bacteria 2885305155 2885309277 392
26 iso_pu_bacteria 2885326080 2885327861 392
27 iso_pu_bacteria 2885334103 2885334208 392
28 3300005327 Ga0070658_10000461 Ga0070658_1000046124 394
29 3300005329 Ga0070683_100089505 Ga0070683_1000895053 394
30 3300005548 Ga0070665_100021181 Ga0070665_1000211815 394
31 3300048924 Ga0496121_0040558 Ga0496121_0040558_2650_3945 394
32 iso_pu_bacteria 2876392853 2876393621 394
33 3300009093 Ga0105240_10003331 Ga0105240_1000333114 395
34 3300009093 Ga0105240_10010075 Ga0105240_1001007512 395
35 3300010375 Ga0105239_10131855 Ga0105239_101318553 395
36 3300025913 Ga0207695_10030639 Ga0207695_100306393 395
37 3300031344 Ga0265316_10061433 Ga0265316_100614331 395
38 3300045049 Ga0466959_0163160 Ga0466959_0163160_183_1499 396
39 iso_pu_bacteria 2721755686 2723578056 397
40 iso_pu_bacteria 2881161766 2881163382 397
41 3300005355 Ga0070671_100004199 Ga0070671_1000041993 399
42 3300005548 Ga0070665_100013202 Ga0070665_1000132029 399
43 3300006237 Ga0097621_100175966 Ga0097621_1001759662 399
44 3300009093 Ga0105240_10000828 Ga0105240_100008288 399
45 3300009098 Ga0105245_10005864 Ga0105245_100058643 399
46 3300009174 Ga0105241_10029717 Ga0105241_100297173 399
47 3300009177 Ga0105248_10012718 Ga0105248_100127184 399
48 3300009545 Ga0105237_10154437 Ga0105237_101544372 399
49 3300009551 Ga0105238_10003244 Ga0105238_1000324413 399
50 3300010375 Ga0105239_10003058 Ga0105239_1000305812 399
51 3300013296 Ga0157374_10008188 Ga0157374_100081889 399
52 3300013297 Ga0157378_10041306 Ga0157378_100413064 399
53 3300025913 Ga0207695_10000063 Ga0207695_1000006366 399
54 3300025924 Ga0207694_10000673 Ga0207694_1000067316 399
55 3300025941 Ga0207711_10006018 Ga0207711_100060184 399
56 3300026142 Ga0207698_10044409 Ga0207698_100444092 399
57 3300028379 Ga0268266_10087053 Ga0268266_100870531 399
58 3300044658 Ga0466972_0053706 Ga0466972_0053706_181_1497 400
59 3300044693 Ga0466961_0030848 Ga0466961_0030848_1499_2815 400
60 3300044706 Ga0466964_0005888 Ga0466964_0005888_1702_3018 400
61 3300044719 Ga0466971_0017016 Ga0466971_0017016_1367_2683 400
62 3300044842 Ga0466957_0014136 Ga0466957_0014136_1634_2950 400
63 3300045836 Ga0466958_0084756 Ga0466958_0084756_278_1594 400
64 3300050508 nmdc:mga09592_117661_c1 nmdc:mga09592_117661_c1_398_1663 406
65 3300053096 Ga0500641_0004411 Ga0500641_0004411_409_1728 409
66 3300044712 Ga0453684_0212179 Ga0453684_0212179_835_2157 410
67 3300049742 Ga0501080_0046298 Ga0501080_0046298_2667_3977 410
68 3300060353 Ga0501082_0113401 Ga0501082_0113401_422_1732 410
69 3300030521 Ga0307511_10005042 Ga0307511_1000504212 411
70 3300031691 Ga0316579_10002852 Ga0316579_100028522 414
71 3300031507 Ga0307509_10000178 Ga0307509_1000017837 417
72 3300049591 Ga0501075_0016868 Ga0501075_0016868_385_1692 417
73 3300049591 Ga0501075_0045253 Ga0501075_0045253_1367_2674 417
74 3300049592 Ga0501076_0040799 Ga0501076_0040799_1716_3023 417
75 3300053092 Ga0500583_0022070 Ga0500583_0022070_683_2056 417
76 3300046516 Ga0495628_0014141 Ga0495628_0014141_1511_2827 418
77 3300049571 Ga0501034_0000148 Ga0501034_0000148_119781_121151 420
78 iso_pu_bacteria 2871488783 2871489544 420
79 iso_pu_bacteria 2878753008 2878754052 420
80 iso_pu_bacteria 2881147464 2881154354 420
81 iso_pu_bacteria 2881861095 2881867731 420
82 iso_pu_bacteria 2885318864 2885319796 420
83 iso_pu_bacteria 2903492973 2903494646 420
84 iso_pu_bacteria 2924784321 2924788871 420
85 iso_pu_bacteria 2961170736 2961171685 420
86 iso_pu_bacteria 2967996073 2967996610 420
87 iso_pu_bacteria 2968003550 2968010178 420
88 iso_pu_bacteria 2970503327 2970504281 420
89 iso_pu_bacteria 2977821940 2977823268 420
90 iso_pu_bacteria 2979808191 2979808918 420
91 iso_pu_bacteria 8004374579 8004375629 420
92 iso_pu_bacteria 8057529695 8057535921 420
93 3300005329 Ga0070683_100000586 Ga0070683_10000058614 421
94 3300005336 Ga0070680_100227468 Ga0070680_1002274681 421
95 3300005535 Ga0070684_100001749 Ga0070684_1000017494 421
96 3300005577 Ga0068857_100015763 Ga0068857_1000157638 421
97 3300005618 Ga0068864_100005226 Ga0068864_1000052263 421
98 3300009545 Ga0105237_10005604 Ga0105237_100056045 421
99 3300013104 Ga0157370_10138709 Ga0157370_101387093 421
100 3300013105 Ga0157369_10115954 Ga0157369_101159544 421
101 3300013297 Ga0157378_10056026 Ga0157378_100560263 421
102 3300025921 Ga0207652_10137173 Ga0207652_101371733 421
103 3300025944 Ga0207661_10002135 Ga0207661_100021353 421
104 3300045976 Ga0466967_0030245 Ga0466967_0030245_2559_3896 421
105 iso_pu_bacteria 2513237351 2514591587 421
106 3300006038 Ga0075365_10055024 Ga0075365_100550242 423
107 3300006880 Ga0075429_100119364 Ga0075429_1001193642 423
108 3300009176 Ga0105242_10115990 Ga0105242_101159902 423
109 3300031911 Ga0307412_10045181 Ga0307412_100451813 423
110 3300050492 nmdc:mga0yw44_80290_c1 nmdc:mga0yw44_80290_c1_198_1556 423
111 3300053151 Ga0500604_0015273 Ga0500604_0015273_327_1685 423
112 3300053153 Ga0500616_0000029 Ga0500616_0000029_104572_105924 423
113 iso_pu_bacteria 2508501127 2509142948 423
114 iso_pu_bacteria 2513237305 2514420619 423
115 iso_pu_bacteria 2856342000 2856346275 423
116 iso_pu_bacteria 2856349417 2856352367 423
117 iso_pu_bacteria 2856356410 2856361177 423
118 iso_pu_bacteria 2871495908 2871501934 423
119 iso_pu_bacteria 2874123672 2874127171 423
120 iso_pu_bacteria 2876369609 2876372442 423
121 iso_pu_bacteria 2878760144 2878765829 423
122 iso_pu_bacteria 2878767105 2878772503 423
123 iso_pu_bacteria 2881155292 2881158149 423
124 iso_pu_bacteria 2881853255 2881857894 423
125 iso_pu_bacteria 2882632389 2882637431 423
126 iso_pu_bacteria 2885312484 2885315416 423
127 iso_pu_bacteria 2885342637 2885346280 423
128 iso_pu_bacteria 2885350715 2885352378 423
129 iso_pu_bacteria 2888343758 2888348803 423
130 iso_pu_bacteria 2889914905 2889918801 423
131 iso_pu_bacteria 2903540706 2903546775 423
132 iso_pu_bacteria 2904659560 2904660129 423
133 iso_pu_bacteria 2924754689 2924761767 423
134 iso_pu_bacteria 2924762789 2924764767 423
135 iso_pu_bacteria 2937836603 2937838666 423
136 iso_pu_bacteria 2937848649 2937853814 423
137 iso_pu_bacteria 2937994558 2938000634 423
138 iso_pu_bacteria 2958165035 2958171005 423
139 iso_pu_bacteria 2961114664 2961115454 423
140 iso_pu_bacteria 2961127735 2961130175 423
141 iso_pu_bacteria 2961163497 2961169449 423
142 iso_pu_bacteria 2965018300 2965023701 423
143 iso_pu_bacteria 2968110612 2968111185 423
144 iso_pu_bacteria 2968171901 2968177839 423
145 iso_pu_bacteria 2970524798 2970529381 423
146 iso_pu_bacteria 2970540015 2970543721 423
147 iso_pu_bacteria 2970554993 2970560685 423
148 iso_pu_bacteria 2977828996 2977829070 423
149 iso_pu_bacteria 2977864932 2977866860 423
150 iso_pu_bacteria 2977922695 2977929027 423
151 iso_pu_bacteria 2977986579 2977988757 423
152 iso_pu_bacteria 2987659509 2987665573 423
153 iso_pu_bacteria 2987666974 2987669538 423
154 iso_pu_bacteria 3000135777 3000140921 423
155 iso_pu_bacteria 3004188549 3004194637 423
156 iso_pu_bacteria 3004211236 3004212565 423
157 iso_pu_bacteria 3004218560 3004221629 423
158 iso_pu_bacteria 8004395343 8004403625 423
159 iso_pu_bacteria 8055617313 8055623046 423
160 3300009551 Ga0105238_10008255 Ga0105238_100082554 424
161 3300025913 Ga0207695_10235114 Ga0207695_102351142 424
162 3300028794 Ga0307515_10014918 Ga0307515_100149189 424
163 3300031711 Ga0265314_10009125 Ga0265314_100091254 424
164 3300060353 Ga0501082_0001158 Ga0501082_0001158_5321_6682 424
165 3300007788 Ga0099795_10000017 Ga0099795_1000001716 425
166 3300009093 Ga0105240_10001319 Ga0105240_1000131912 425
167 3300010159 Ga0099796_10000009 Ga0099796_1000000916 425
168 3300025913 Ga0207695_10255953 Ga0207695_102559532 425
169 3300027512 Ga0209179_1000001 Ga0209179_100000156 425
170 3300028800 Ga0265338_10028404 Ga0265338_100284044 425
171 3300049579 Ga0501043_0002538 Ga0501043_0002538_3084_4460 425
172 3300049580 Ga0501046_0000842 Ga0501046_0000842_14284_15660 425
173 3300049581 Ga0501047_0027565 Ga0501047_0027565_92_1468 425
174 3300049744 Ga0501083_0000018 Ga0501083_0000018_115136_116512 425
175 3300049744 Ga0501083_0161254 Ga0501083_0161254_69_1439 425
176 3300049822 Ga0501035_0003963 Ga0501035_0003963_11202_12578 425
177 3300049823 Ga0501044_0004722 Ga0501044_0004722_7510_8889 425
178 3300049823 Ga0501044_0018122 Ga0501044_0018122_5420_6796 425
179 3300005355 Ga0070671_100002426 Ga0070671_10000242616 426
180 3300005367 Ga0070667_100012681 Ga0070667_1000126815 426
181 3300005548 Ga0070665_100085346 Ga0070665_1000853463 426
182 3300005617 Ga0068859_100003728 Ga0068859_1000037285 426
183 3300005841 Ga0068863_100024781 Ga0068863_1000247814 426
184 3300005842 Ga0068858_100001417 Ga0068858_10000141722 426
185 3300006847 Ga0075431_100203287 Ga0075431_1002032873 426
186 3300006931 Ga0097620_100003728 Ga0097620_1000037285 426
187 3300009092 Ga0105250_10010140 Ga0105250_100101403 426
188 3300009101 Ga0105247_10001326 Ga0105247_1000132617 426
189 3300014325 Ga0163163_10312947 Ga0163163_103129472 426
190 3300014968 Ga0157379_10014966 Ga0157379_100149664 426
191 3300025900 Ga0207710_10005256 Ga0207710_100052563 426
192 3300025986 Ga0207658_10009610 Ga0207658_100096105 426
193 3300026035 Ga0207703_10029222 Ga0207703_100292223 426
194 3300028379 Ga0268266_10108019 Ga0268266_101080193 426
195 3300028381 Ga0268264_10018226 Ga0268264_100182263 426
196 3300048915 Ga0496112_0165627 Ga0496112_0165627_613_2028 426
197 3300048924 Ga0496121_0002526 Ga0496121_0002526_2876_4291 426
198 3300048928 Ga0496125_0002321 Ga0496125_0002321_21641_23056 426
199 3300005295 Ga0065707_10081750 Ga0065707_100817508 427
200 3300053104 Ga0500556_0000310 Ga0500556_0000310_24578_25906 427

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00006

ATP-synt_ab

ATP synthase alpha/beta family, nucleotide-binding domain

171

380

0.99

PF18269

T3SS_ATPase_C

T3SS EscN ATPase C-terminal domain

387

458

0.97

PF02874

ATP-synt_ab_N

ATP synthase alpha/beta family, beta-barrel domain

41

114

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5b0o-assembly4.cif.gz_D structure of the flih-flii complex 0.9457 1 417
5syr-assembly1.cif.gz_A crystal structure of atpase delta1-79 spa47 r350a 0.9403 92 418
2dpy-assembly1.cif.gz_A crystal structure of the flagellar type iii atpase flii 0.9401 17 417
6n70-assembly1.cif.gz_A crystal structure of atpase delta1-79 spa47 r191a 0.9398 92 418
2dpy-assembly2.cif.gz_B crystal structure of the flagellar type iii atpase flii 0.9392 17 417
ID Description Score Start End Superfamily
2dpyB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9627 92 339 3.40.50.300
af_A0A0R0JZ78_6_157_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.962 220 340 3.40.50.300
4nphA02 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; 0.957 346 418 1.20.1270.330
2dpyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9401 17 417 3.40.50.12240
af_A0A2P2CLF9_96_382_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.934 91 345 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A0F8XUV5-F1-model_v4 ATPase F1/V1/A1 complex alpha/beta subunit nucleotide-binding domain-containing protein 0.9841 302 418 GO:0005524
GO:0045261
GO:0046933
AF-A0A655MZN9-F1-model_v4 deleted 0.984 301 418
AF-A0A382SIS4-F1-model_v4 AAA+ ATPase domain-containing protein 0.9821 125 415 GO:0005524
GO:0005737
GO:0016887
GO:0030254
GO:0030257
GO:0045261
GO:0046933
GO:0046961
AF-A0A523MQT2-F1-model_v4 FliI/YscN family ATPase 0.9817 179 418 GO:0005524
GO:0005737
GO:0016887
GO:0030254
GO:0030257
GO:0045261
GO:0046933
AF-A0A847JBL1-F1-model_v4 Flagellum-specific ATP synthase FliI 0.9814 195 418 GO:0005524
GO:0045261
GO:0046933

Feature Viewer

pLDDT pTM Quality
91.96 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map