F306452

General Info

Members Datasets Scaffolds Average Seq Length
199 128 398 143

Family's Representative Sequence

Representative Sequence 3300053150|Ga0500603_006860|Ga0500603_006860_1038_1517
Length 159
Sequence VGGAQHAEGGGGMTADSLFPVLNLAAMAAWLPLVLVPRRRWATTILPIAMPVLLGVVYVVLVVMSLPGSDGGFSSLAGVRALFVDPRGLLAGWTHYLAFDLFIGGWEARDAQERGIPHLLIVPALVLTFLFGPAGLVLYLAIRRFGARTPTAVPLGRQR

Samples

Sample ID Description Type Environment
1 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
72 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
73 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
74 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
75 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
76 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
77 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
78 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
79 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
80 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
81 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
82 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
83 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
84 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
85 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
86 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
87 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
88 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
89 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
90 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
91 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
100 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
101 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
102 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
103 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
104 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
105 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
106 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
107 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
108 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
109 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
110 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
111 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
112 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
113 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
114 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
115 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
116 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
117 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
118 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
119 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
120 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
121 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
122 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
123 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
124 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
125 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
126 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
127 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
128 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.05
Nodule 0
Rhizoplane 0.5
Rhizosphere 86.93
Stem 0
Stem Tuber 0
Unclassified 27.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500603_006860 3300053150 Bacteria 2484
2 Ga0065715_10004699 3300005293 Bacteria 4657
3 Ga0065707_10442663 3300005295 Unclassified 803
4 Ga0070690_100305841 3300005330 Bacteria 1141
5 Ga0070690_101293837 3300005330 Bacteria 584
6 Ga0070670_100739654 3300005331 Bacteria 886
7 Ga0070677_10133620 3300005333 Bacteria 1136
8 Ga0070677_10175529 3300005333 Bacteria 1016
9 Ga0070689_100246851 3300005340 Unclassified 1472
10 Ga0070668_100683986 3300005347 Bacteria 904
11 Ga0070669_100056997 3300005353 Bacteria 2866
12 Ga0070669_100073098 3300005353 Bacteria 2540
13 Ga0070675_100022016 3300005354 Bacteria 5093
14 Ga0070675_100058595 3300005354 Unclassified 3177
15 Ga0070675_100151448 3300005354 Unclassified 1989
16 Ga0070675_100354458 3300005354 Unclassified 1302
17 Ga0070675_100784120 3300005354 Bacteria 871
18 Ga0070674_100952615 3300005356 Bacteria 751
19 Ga0070673_100441265 3300005364 Bacteria 1170
20 Ga0070673_101094658 3300005364 Unclassified 744
21 Ga0070673_101146462 3300005364 Bacteria 727
22 Ga0070673_101271450 3300005364 Bacteria 691
23 Ga0070700_100036692 3300005441 Bacteria 2975
24 Ga0070700_100426695 3300005441 Bacteria 1003
25 Ga0070694_100724157 3300005444 Bacteria 811
26 Ga0070678_100042367 3300005456 Bacteria 3235
27 Ga0070678_100133401 3300005456 Bacteria 1977
28 Ga0070678_100494731 3300005456 Bacteria 1078
29 Ga0068867_101400827 3300005459 Unclassified 648
30 Ga0070698_100217020 3300005471 Bacteria 1847
31 Ga0070697_100977027 3300005536 Bacteria 752
32 Ga0070672_100011723 3300005543 Bacteria 6123
33 Ga0070672_100028472 3300005543 Bacteria 4180
34 Ga0070672_100477808 3300005543 Unclassified 1076
35 Ga0070686_100445673 3300005544 Bacteria 994
36 Ga0068852_101663334 3300005616 Bacteria 661
37 Ga0068859_100593233 3300005617 Bacteria 1201
38 Ga0068859_100886948 3300005617 Unclassified 977
39 Ga0068859_101140658 3300005617 Bacteria 858
40 Ga0068861_100141282 3300005719 Bacteria 1965
41 Ga0068861_100379051 3300005719 Bacteria 1249
42 Ga0068861_100379304 3300005719 Bacteria 1249
43 Ga0068870_10190367 3300005840 Unclassified 1237
44 Ga0068870_10471712 3300005840 Unclassified 831
45 Ga0068858_100032463 3300005842 Unclassified 4848
46 Ga0068862_100440718 3300005844 Bacteria 1226
47 Ga0081455_10235007 3300005937 Bacteria 1350
48 Ga0075368_10223812 3300006042 Bacteria 800
49 Ga0075364_10063774 3300006051 Bacteria 2419
50 Ga0075367_10003046 3300006178 Bacteria 7854
51 Ga0075366_10128669 3300006195 Bacteria 1528
52 Ga0068871_100400070 3300006358 Unclassified 1223
53 Ga0068871_101382146 3300006358 Bacteria 663
54 Ga0075428_100118448 3300006844 Bacteria 2884
55 Ga0075428_100213112 3300006844 Bacteria 2087
56 Ga0075428_100384007 3300006844 Bacteria 1506
57 Ga0075428_100674239 3300006844 Unclassified 1102
58 Ga0075430_100000153 3300006846 Bacteria 44870
59 Ga0075430_100007664 3300006846 Bacteria 9117
60 Ga0075430_100039253 3300006846 Bacteria 4009
61 Ga0075430_100280759 3300006846 Bacteria 1378
62 Ga0075431_100114404 3300006847 Bacteria 2785
63 Ga0075431_100126695 3300006847 Bacteria 2635
64 Ga0075431_100370779 3300006847 Bacteria 1437
65 Ga0075431_100399962 3300006847 Bacteria 1375
66 Ga0075431_100451390 3300006847 Bacteria 1281
67 Ga0075431_102215490 3300006847 Unclassified 504
68 Ga0075433_10235570 3300006852 Bacteria 1625
69 Ga0075429_100138901 3300006880 Bacteria 2127
70 Ga0068865_100266626 3300006881 Unclassified 1358
71 Ga0097620_100593225 3300006931 Bacteria 1201
72 Ga0097620_100886937 3300006931 Unclassified 977
73 Ga0097620_101140654 3300006931 Bacteria 858
74 Ga0075435_100233771 3300007076 Unclassified 1562
75 Ga0075435_101045426 3300007076 Bacteria 713
76 Ga0111539_11516201 3300009094 Bacteria 777
77 Ga0105245_10304119 3300009098 Unclassified 1566
78 Ga0114129_10636982 3300009147 Bacteria 1377
79 Ga0114129_10984241 3300009147 Unclassified 1063
80 Ga0105242_12474993 3300009176 Bacteria 567
81 Ga0105248_10328364 3300009177 Unclassified 1723
82 Ga0105248_10625545 3300009177 Unclassified 1215
83 Ga0105248_12001010 3300009177 Bacteria 658
84 Ga0105249_10611293 3300009553 Bacteria 1145
85 Ga0105249_10901437 3300009553 Bacteria 951
86 Ga0105249_12304816 3300009553 Bacteria 611
87 Ga0157378_10727131 3300013297 Bacteria 1014
88 Ga0157375_12529320 3300013308 Bacteria 613
89 Ga0163163_11303435 3300014325 Bacteria 788
90 Ga0157380_10301676 3300014326 Unclassified 1476
91 Ga0157380_10703559 3300014326 Bacteria 1016
92 Ga0207697_10028532 3300025315 Bacteria 2282
93 Ga0207681_10089469 3300025923 Bacteria 2195
94 Ga0207681_10128840 3300025923 Bacteria 1868
95 Ga0207650_10084142 3300025925 Unclassified 2418
96 Ga0207659_10128926 3300025926 Bacteria 1949
97 Ga0207659_10147351 3300025926 Bacteria 1834
98 Ga0207644_10497225 3300025931 Unclassified 1006
99 Ga0207706_10156484 3300025933 Unclassified 2004
100 Ga0207704_10378198 3300025938 Bacteria 1111
101 Ga0207691_10055167 3300025940 Bacteria 3623
102 Ga0207691_10082172 3300025940 Bacteria 2894
103 Ga0207691_10249239 3300025940 Unclassified 1533
104 Ga0207691_11472419 3300025940 Bacteria 557
105 Ga0207661_10392737 3300025944 Unclassified 1257
106 Ga0207651_10470817 3300025960 Bacteria 1081
107 Ga0207651_10643970 3300025960 Unclassified 930
108 Ga0207651_11272086 3300025960 Unclassified 661
109 Ga0207668_10397090 3300025972 Bacteria 1165
110 Ga0207668_11189162 3300025972 Bacteria 685
111 Ga0207640_11264208 3300025981 Bacteria 658
112 Ga0207708_10009840 3300026075 Bacteria 7096
113 Ga0207708_10251278 3300026075 Bacteria 1425
114 Ga0207708_10515579 3300026075 Bacteria 1004
115 Ga0207648_10749095 3300026089 Bacteria 907
116 Ga0207676_11360166 3300026095 Unclassified 706
117 Ga0207675_100195271 3300026118 Bacteria 1942
118 Ga0207675_100406049 3300026118 Bacteria 1343
119 Ga0207675_100434988 3300026118 Bacteria 1298
120 Ga0207683_10080897 3300026121 Bacteria 2883
121 Ga0207683_10190671 3300026121 Unclassified 1861
122 Ga0209974_10348450 3300027876 Bacteria 574
123 Ga0268265_10296346 3300028380 Bacteria 1454
124 Ga0268264_10217291 3300028381 Bacteria 1758
125 Ga0307508_10082027 3300031616 Bacteria 2806
126 Ga0307413_11461546 3300031824 Unclassified 603
127 Ga0307406_12056040 3300031901 Unclassified 511
128 Ga0307407_10817292 3300031903 Unclassified 710
129 Ga0307409_100129976 3300031995 Bacteria 2150
130 Ga0307409_101255036 3300031995 Unclassified 765
131 Ga0307409_101533448 3300031995 Unclassified 694
132 Ga0307414_10347355 3300032004 Bacteria 1272
133 Ga0307411_10175474 3300032005 Unclassified 1621
134 Ga0307415_100500757 3300032126 Unclassified 1062
135 Ga0307507_10555500 3300033179 Bacteria 604
136 Ga0373939_0197223 3300035114 Bacteria 759
137 Ga0400483_106341 3300039062 Unclassified 1454
138 Ga0400483_150052 3300039062 Bacteria 4222
139 Ga0451853_2315760 3300041512 Bacteria 520
140 Ga0439451_042307 3300042009 Unclassified 914
141 Ga0450896_026154 3300042133 Unclassified 870
142 Ga0450896_031386 3300042133 Bacteria 806
143 Ga0439460_0049538 3300042461 Bacteria 1256
144 Ga0495638_0333842 3300046460 Unclassified 806
145 Ga0495643_0006152 3300046522 Bacteria 7972
146 Ga0495621_0236066 3300046539 Unclassified 744
147 Ga0495672_0068104 3300047320 Bacteria 2025
148 Ga0496109_1253665 3300048912 Unclassified 678
149 Ga0501031_0581549 3300049568 Bacteria 721
150 Ga0501033_0465363 3300049570 Bacteria 877
151 Ga0501039_0008981 3300049575 Bacteria 7614
152 Ga0501039_0580871 3300049575 Bacteria 879
153 Ga0501040_0069028 3300049576 Bacteria 2438
154 Ga0501041_0021519 3300049577 Bacteria 3863
155 Ga0501042_0034867 3300049578 Bacteria 3570
156 Ga0501046_0287638 3300049580 Bacteria 1203
157 Ga0501048_0751308 3300049582 Bacteria 701
158 Ga0501068_1088883 3300049584 Unclassified 528
159 Ga0501072_0077944 3300049588 Unclassified 2624
160 Ga0501072_0471093 3300049588 Bacteria 994
161 Ga0501074_1278135 3300049590 Unclassified 514
162 Ga0501075_0021203 3300049591 Bacteria 4735
163 Ga0501075_0464513 3300049591 Bacteria 965
164 Ga0501076_0144884 3300049592 Bacteria 1931
165 Ga0501076_0474374 3300049592 Bacteria 1031
166 Ga0501079_0017160 3300049741 Bacteria 5529
167 Ga0501081_0217269 3300049743 Unclassified 1389
168 Ga0501081_0386228 3300049743 Unclassified 1035
169 Ga0501045_0012330 3300049824 Bacteria 6019
170 nmdc:mga00v17_272092_c1 3300050491 Bacteria 1099
171 nmdc:mga0k408_154577_c1 3300050493 Bacteria 1366
172 nmdc:mga06z11_206116_c1 3300050494 Unclassified 1144
173 nmdc:mga05p37_765485_c1 3300050507 Bacteria 1062
174 nmdc:mga09592_319637_c1 3300050508 Bacteria 1345
175 nmdc:mga09592_710104_c1 3300050508 Unclassified 855
176 nmdc:mga0qj67_16739_c1 3300050509 Bacteria 5567
177 nmdc:mga0qj67_216795_c1 3300050509 Bacteria 1554
178 nmdc:mga0qj67_30474_c1 3300050509 Bacteria 4200
179 nmdc:mga0qj67_8720_c1 3300050509 Bacteria 7531
180 nmdc:mga06r32_1492736_c1 3300050510 Bacteria 616
181 nmdc:mga06r32_389922_c1 3300050510 Bacteria 1375
182 nmdc:mga06r32_61687_c1 3300050510 Bacteria 3610
183 nmdc:mga06r32_67464_c1 3300050510 Bacteria 3454
184 nmdc:mga08y16_191827_c1 3300050511 Bacteria 2119
185 nmdc:mga0rr50_1145156_c1 3300050513 Bacteria 661
186 nmdc:mga0a205_431393_c1 3300050515 Unclassified 1179
187 Ga0500635_0001725 3300053080 Bacteria 5309
188 Ga0500578_0137437 3300053086 Bacteria 1529
189 Ga0500566_0008202 3300053094 Bacteria 6180
190 Ga0500566_0043684 3300053094 Bacteria 2582
191 Ga0500641_0003671 3300053096 Bacteria 5419
192 Ga0500614_067633 3300053123 Bacteria 974
193 Ga0500623_242974 3300053127 Bacteria 611
194 Ga0500658_0427744 3300053134 Bacteria 604
195 Ga0500568_0001081 3300053139 Bacteria 18369
196 Ga0500585_045419 3300053144 Bacteria 1560
197 Ga0500637_0216138 3300053178 Bacteria 1086
198 Ga0500601_008664 3300053737 Bacteria 1132
199 Ga0530510_0247707 3300061734 Unclassified 1327
200 Ga0500603_006860
201 Ga0065715_10004699
202 Ga0065707_10442663
203 Ga0070690_100305841
204 Ga0070690_101293837
205 Ga0070670_100739654
206 Ga0070677_10133620
207 Ga0070677_10175529
208 Ga0070689_100246851
209 Ga0070668_100683986
210 Ga0070669_100056997
211 Ga0070669_100073098
212 Ga0070675_100022016
213 Ga0070675_100058595
214 Ga0070675_100151448
215 Ga0070675_100354458
216 Ga0070675_100784120
217 Ga0070674_100952615
218 Ga0070673_100441265
219 Ga0070673_101094658
220 Ga0070673_101146462
221 Ga0070673_101271450
222 Ga0070700_100036692
223 Ga0070700_100426695
224 Ga0070694_100724157
225 Ga0070678_100042367
226 Ga0070678_100133401
227 Ga0070678_100494731
228 Ga0068867_101400827
229 Ga0070698_100217020
230 Ga0070697_100977027
231 Ga0070672_100011723
232 Ga0070672_100028472
233 Ga0070672_100477808
234 Ga0070686_100445673
235 Ga0068852_101663334
236 Ga0068859_100593233
237 Ga0068859_100886948
238 Ga0068859_101140658
239 Ga0068861_100141282
240 Ga0068861_100379051
241 Ga0068861_100379304
242 Ga0068870_10190367
243 Ga0068870_10471712
244 Ga0068858_100032463
245 Ga0068862_100440718
246 Ga0081455_10235007
247 Ga0075368_10223812
248 Ga0075364_10063774
249 Ga0075367_10003046
250 Ga0075366_10128669
251 Ga0068871_100400070
252 Ga0068871_101382146
253 Ga0075428_100118448
254 Ga0075428_100213112
255 Ga0075428_100384007
256 Ga0075428_100674239
257 Ga0075430_100000153
258 Ga0075430_100007664
259 Ga0075430_100039253
260 Ga0075430_100280759
261 Ga0075431_100114404
262 Ga0075431_100126695
263 Ga0075431_100370779
264 Ga0075431_100399962
265 Ga0075431_100451390
266 Ga0075431_102215490
267 Ga0075433_10235570
268 Ga0075429_100138901
269 Ga0068865_100266626
270 Ga0097620_100593225
271 Ga0097620_100886937
272 Ga0097620_101140654
273 Ga0075435_100233771
274 Ga0075435_101045426
275 Ga0111539_11516201
276 Ga0105245_10304119
277 Ga0114129_10636982
278 Ga0114129_10984241
279 Ga0105242_12474993
280 Ga0105248_10328364
281 Ga0105248_10625545
282 Ga0105248_12001010
283 Ga0105249_10611293
284 Ga0105249_10901437
285 Ga0105249_12304816
286 Ga0157378_10727131
287 Ga0157375_12529320
288 Ga0163163_11303435
289 Ga0157380_10301676
290 Ga0157380_10703559
291 Ga0207697_10028532
292 Ga0207681_10089469
293 Ga0207681_10128840
294 Ga0207650_10084142
295 Ga0207659_10128926
296 Ga0207659_10147351
297 Ga0207644_10497225
298 Ga0207706_10156484
299 Ga0207704_10378198
300 Ga0207691_10055167
301 Ga0207691_10082172
302 Ga0207691_10249239
303 Ga0207691_11472419
304 Ga0207661_10392737
305 Ga0207651_10470817
306 Ga0207651_10643970
307 Ga0207651_11272086
308 Ga0207668_10397090
309 Ga0207668_11189162
310 Ga0207640_11264208
311 Ga0207708_10009840
312 Ga0207708_10251278
313 Ga0207708_10515579
314 Ga0207648_10749095
315 Ga0207676_11360166
316 Ga0207675_100195271
317 Ga0207675_100406049
318 Ga0207675_100434988
319 Ga0207683_10080897
320 Ga0207683_10190671
321 Ga0209974_10348450
322 Ga0268265_10296346
323 Ga0268264_10217291
324 Ga0307508_10082027
325 Ga0307413_11461546
326 Ga0307406_12056040
327 Ga0307407_10817292
328 Ga0307409_100129976
329 Ga0307409_101255036
330 Ga0307409_101533448
331 Ga0307414_10347355
332 Ga0307411_10175474
333 Ga0307415_100500757
334 Ga0307507_10555500
335 Ga0373939_0197223
336 Ga0400483_106341
337 Ga0400483_150052
338 Ga0451853_2315760
339 Ga0439451_042307
340 Ga0450896_026154
341 Ga0450896_031386
342 Ga0439460_0049538
343 Ga0495638_0333842
344 Ga0495643_0006152
345 Ga0495621_0236066
346 Ga0495672_0068104
347 Ga0496109_1253665
348 Ga0501031_0581549
349 Ga0501033_0465363
350 Ga0501039_0008981
351 Ga0501039_0580871
352 Ga0501040_0069028
353 Ga0501041_0021519
354 Ga0501042_0034867
355 Ga0501046_0287638
356 Ga0501048_0751308
357 Ga0501068_1088883
358 Ga0501072_0077944
359 Ga0501072_0471093
360 Ga0501074_1278135
361 Ga0501075_0021203
362 Ga0501075_0464513
363 Ga0501076_0144884
364 Ga0501076_0474374
365 Ga0501079_0017160
366 Ga0501081_0217269
367 Ga0501081_0386228
368 Ga0501045_0012330
369 nmdc:mga00v17_272092_c1
370 nmdc:mga0k408_154577_c1
371 nmdc:mga06z11_206116_c1
372 nmdc:mga05p37_765485_c1
373 nmdc:mga09592_319637_c1
374 nmdc:mga09592_710104_c1
375 nmdc:mga0qj67_16739_c1
376 nmdc:mga0qj67_216795_c1
377 nmdc:mga0qj67_30474_c1
378 nmdc:mga0qj67_8720_c1
379 nmdc:mga06r32_1492736_c1
380 nmdc:mga06r32_389922_c1
381 nmdc:mga06r32_61687_c1
382 nmdc:mga06r32_67464_c1
383 nmdc:mga08y16_191827_c1
384 nmdc:mga0rr50_1145156_c1
385 nmdc:mga0a205_431393_c1
386 Ga0500635_0001725
387 Ga0500578_0137437
388 Ga0500566_0008202
389 Ga0500566_0043684
390 Ga0500641_0003671
391 Ga0500614_067633
392 Ga0500623_242974
393 Ga0500658_0427744
394 Ga0500568_0001081
395 Ga0500585_045419
396 Ga0500637_0216138
397 Ga0500601_008664
398 Ga0530510_0247707

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14108

ABA4-like

ABA DEFICIENT 4-like

17

139

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7coy-assembly1.cif.gz_aL structure of the far-red light utilizing photosystem i of acaryochloris marina 0.4961 26 102
8fe1-assembly1.cif.gz_E alpha1/betab heteromeric glycine receptor in 1 mm glycine 20 um ivermectin state 0.4801 4 135
2iub-assembly2.cif.gz_H crystal structure of a divalent metal ion transporter cora at 2.9 a resolution. 0.4358 3 142
2iub-assembly2.cif.gz_H crystal structure of a divalent metal ion transporter cora at 2.9 a resolution. 0.4289 3 142
2iub-assembly1.cif.gz_C crystal structure of a divalent metal ion transporter cora at 2.9 a resolution. 0.4172 3 142
ID Description Score Start End Superfamily
af_A0A1D8PMP5_155_258_1.20.58.200 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Translin; domain 2 0.6782 5 105 1.20.58.200
af_A0A1D8PMP5_155_258_1.20.58.200 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Translin; domain 2 0.6557 5 105 1.20.58.200
af_A0A0R0GA89_473_615_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.5134 40 133 1.20.140.150
af_Q23349_12_329_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5118 29 136 1.20.1070.10
af_Q6GMK6_1_106_1.20.5.110 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.4938 1 131 1.20.5.110
ID Description Score Start End GO Terms
AF-A0A7Y4SM66-F1-model_v4 DUF4281 domain-containing protein 0.9836 1 134 GO:0016020
AF-A0A1Q3NTP0-F1-model_v4 deleted 0.9787 2 133
AF-A0A1G6AIU9-F1-model_v4 DUF4281 domain-containing protein 0.9777 1 134 GO:0016020
AF-A0A1M2Z6V3-F1-model_v4 deleted 0.9749 1 129
AF-A0A543NQZ5-F1-model_v4 deleted 0.9744 1 133

Map