F306108

General Info

Members Datasets Scaffolds Average Seq Length
199 122 398 195

Family's Representative Sequence

Representative Sequence 3300041463|Ga0451804_0485833|Ga0451804_0485833_13_687
Length 224
Sequence MSNPLANRGVIVAVWRTRRVRRTLTSQPSSMEKYCTYLIFGAPGAGKGTQGKSLGSIPRFFHCACGDVFRAIDTRTPLGQKFIEFSSRGELVPDEVTVELWKTRIEHCVEDHTFKPDIDSLVLDGIPRNVHQAEMLEGTLDVKAIFYLHCTNFKAMVERLQRRALKENRLDDANLGVIRDRLKVYDKETKPVLSFYGKKLVHSIDSTKTPVQVLGDVLAHIKKI

Samples

Sample ID Description Type Environment
1 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
30 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
57 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
58 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
59 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
60 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
61 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
62 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
63 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
64 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
65 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
66 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
67 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
68 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
69 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
70 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
71 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
72 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
73 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
74 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
75 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
76 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
77 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
78 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
80 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
81 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
82 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
83 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
84 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
85 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
86 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
87 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
88 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
89 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
90 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
91 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
92 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
93 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
94 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
95 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
96 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
97 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
98 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
99 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
100 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
101 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
102 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
103 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
104 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
105 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
106 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
107 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
108 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
109 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
110 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
111 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
112 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
113 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
117 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
118 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
119 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
120 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
121 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
122 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.01
Rhizosphere 97.99
Stem 0
Stem Tuber 0
Unclassified 31.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451804_0485833 3300041463 Unclassified 775
2 Ga0070683_100426926 3300005329 Unclassified 1265
3 Ga0070690_100059892 3300005330 Bacteria 2449
4 Ga0070690_100572416 3300005330 Unclassified 854
5 Ga0068868_100568128 3300005338 Bacteria 1001
6 Ga0070689_100015418 3300005340 Bacteria 5572
7 Ga0070689_100035841 3300005340 Bacteria 3792
8 Ga0070691_10058841 3300005341 Bacteria 1846
9 Ga0070669_101048337 3300005353 Bacteria 701
10 Ga0070688_100130553 3300005365 Bacteria 1694
11 Ga0070711_100104413 3300005439 Bacteria 2067
12 Ga0070711_100243478 3300005439 Bacteria 1407
13 Ga0070711_100751372 3300005439 Bacteria 824
14 Ga0070705_100133773 3300005440 Bacteria 1621
15 Ga0070705_100512229 3300005440 Unclassified 913
16 Ga0070705_100557289 3300005440 Bacteria 880
17 Ga0070694_100012739 3300005444 Bacteria 5237
18 Ga0070708_100964339 3300005445 Unclassified 800
19 Ga0070681_10127690 3300005458 Unclassified 2476
20 Ga0070707_100712644 3300005468 Unclassified 966
21 Ga0070684_100067873 3300005535 Unclassified 3133
22 Ga0070686_100263061 3300005544 Bacteria 1265
23 Ga0070704_100006864 3300005549 Bacteria 6741
24 Ga0068857_100024370 3300005577 Bacteria 5326
25 Ga0068857_100310663 3300005577 Bacteria 1454
26 Ga0068857_100372942 3300005577 Bacteria 1324
27 Ga0068859_100216164 3300005617 Bacteria 2004
28 Ga0068859_100850572 3300005617 Bacteria 998
29 Ga0068864_100347967 3300005618 Bacteria 1398
30 Ga0068864_100608272 3300005618 Bacteria 1061
31 Ga0068864_101544337 3300005618 Bacteria 667
32 Ga0068863_100139430 3300005841 Unclassified 2317
33 Ga0068863_101092382 3300005841 Unclassified 802
34 Ga0097621_100012488 3300006237 Bacteria 6300
35 Ga0068871_100365108 3300006358 Unclassified 1279
36 Ga0068871_100697818 3300006358 Unclassified 929
37 Ga0075428_100001123 3300006844 Bacteria 28575
38 Ga0075428_100161874 3300006844 Bacteria 2429
39 Ga0075428_100429879 3300006844 Bacteria 1415
40 Ga0075431_100009275 3300006847 Bacteria 9875
41 Ga0075431_100292005 3300006847 Unclassified 1649
42 Ga0075434_101072069 3300006871 Bacteria 819
43 Ga0075429_100229957 3300006880 Unclassified 1624
44 Ga0097620_100131810 3300006931 Bacteria 2571
45 Ga0097620_100216156 3300006931 Bacteria 2004
46 Ga0097620_100850506 3300006931 Bacteria 998
47 Ga0099794_10226261 3300007265 Unclassified 962
48 Ga0099795_10106225 3300007788 Unclassified 1107
49 Ga0099795_10379502 3300007788 Unclassified 638
50 Ga0105240_10035351 3300009093 Bacteria 6440
51 Ga0105240_10118434 3300009093 Bacteria 3191
52 Ga0111539_10021791 3300009094 Bacteria 7878
53 Ga0111539_10150958 3300009094 Unclassified 2719
54 Ga0111539_10235334 3300009094 Unclassified 2132
55 Ga0111539_10527743 3300009094 Bacteria 1375
56 Ga0111539_10790039 3300009094 Unclassified 1105
57 Ga0105245_10375416 3300009098 Bacteria 1415
58 Ga0114129_10524157 3300009147 Bacteria 1544
59 Ga0105242_10700536 3300009176 Unclassified 991
60 Ga0105242_10808111 3300009176 Bacteria 929
61 Ga0105248_10139243 3300009177 Unclassified 2737
62 Ga0105248_11730497 3300009177 Unclassified 709
63 Ga0105249_10472985 3300009553 Unclassified 1295
64 Ga0105249_10634908 3300009553 Bacteria 1125
65 Ga0099796_10072099 3300010159 Unclassified 1249
66 Ga0105246_10309572 3300011119 Unclassified 1279
67 Ga0157369_10696415 3300013105 Unclassified 1046
68 Ga0163162_10311464 3300013306 Bacteria 1707
69 Ga0157372_10127539 3300013307 Bacteria 2926
70 Ga0163163_10075521 3300014325 Bacteria 3363
71 Ga0157379_10081995 3300014968 Bacteria 2890
72 Ga0207707_10359657 3300025912 Bacteria 1253
73 Ga0207663_10402917 3300025916 Bacteria 1047
74 Ga0207663_10563649 3300025916 Unclassified 892
75 Ga0207663_10700881 3300025916 Bacteria 802
76 Ga0207687_10214309 3300025927 Bacteria 1512
77 Ga0207670_10009252 3300025936 Bacteria 5611
78 Ga0207670_10200553 3300025936 Bacteria 1516
79 Ga0207670_10561820 3300025936 Unclassified 933
80 Ga0207665_10080013 3300025939 Bacteria 2247
81 Ga0207711_10622209 3300025941 Bacteria 1007
82 Ga0207711_10697408 3300025941 Unclassified 947
83 Ga0207667_10878635 3300025949 Bacteria 889
84 Ga0207677_10525703 3300026023 Bacteria 1027
85 Ga0207641_10985155 3300026088 Unclassified 839
86 Ga0207641_11060524 3300026088 Bacteria 808
87 Ga0207676_10129399 3300026095 Bacteria 2144
88 Ga0207676_10310366 3300026095 Unclassified 1444
89 Ga0207676_11364826 3300026095 Bacteria 704
90 Ga0207674_10014911 3300026116 Bacteria 8567
91 Ga0207674_10067389 3300026116 Unclassified 3604
92 Ga0207428_10110509 3300027907 Bacteria 2116
93 Ga0207428_10656955 3300027907 Unclassified 752
94 Ga0265337_1000127 3300028556 Bacteria 38567
95 Ga0265319_1028873 3300028563 Bacteria 1952
96 Ga0265334_10086721 3300028573 Unclassified 1147
97 Ga0265336_10020469 3300028666 Bacteria 2122
98 Ga0265338_10002718 3300028800 Bacteria 25960
99 Ga0265338_10013365 3300028800 Bacteria 9275
100 Ga0265338_10084739 3300028800 Bacteria 2644
101 Ga0265338_10091191 3300028800 Bacteria 2519
102 Ga0265338_10097615 3300028800 Unclassified 2406
103 Ga0265338_10130175 3300028800 Bacteria 1989
104 Ga0265338_10156526 3300028800 Bacteria 1764
105 Ga0265324_10000835 3300029957 Bacteria 20013
106 Ga0265324_10171518 3300029957 Unclassified 737
107 Ga0265328_10061549 3300031239 Unclassified 1378
108 Ga0265320_10021357 3300031240 Bacteria 3484
109 Ga0265320_10031680 3300031240 Bacteria 2714
110 Ga0265325_10067084 3300031241 Bacteria 1808
111 Ga0265325_10067357 3300031241 Bacteria 1804
112 Ga0265339_10006080 3300031249 Bacteria 7966
113 Ga0265331_10084107 3300031250 Unclassified 1475
114 Ga0265327_10035148 3300031251 Bacteria 2774
115 Ga0265314_10000453 3300031711 Bacteria 54843
116 Ga0265314_10074156 3300031711 Bacteria 2267
117 Ga0265342_10189374 3300031712 Bacteria 1123
118 Ga0373936_0092134 3300035113 Bacteria 1272
119 Ga0373954_0081807 3300035118 Bacteria 1543
120 Ga0373955_0071676 3300035172 Bacteria 1939
121 Ga0373924_0276786 3300035410 Bacteria 744
122 Ga0373935_0008155 3300035692 Bacteria 6279
123 Ga0373927_0008062 3300035695 Bacteria 7111
124 Ga0373947_0545651 3300035725 Bacteria 789
125 Ga0373937_0727761 3300036401 Unclassified 939
126 Ga0373937_0830752 3300036401 Unclassified 872
127 Ga0373937_0844794 3300036401 Unclassified 864
128 Ga0373925_0023246 3300037068 Unclassified 4523
129 Ga0373925_0046000 3300037068 Bacteria 3243
130 Ga0373925_0505220 3300037068 Unclassified 993
131 Ga0436365_1328826 3300039437 Bacteria 2581
132 Ga0451845_0717606 3300041501 Bacteria 700
133 Ga0451577_0710742 3300042876 Bacteria 910
134 Ga0453684_0062432 3300044712 Bacteria 4773
135 Ga0453684_1204212 3300044712 Unclassified 795
136 Ga0451576_0042626 3300045051 Bacteria 4791
137 Ga0451576_0127470 3300045051 Bacteria 2652
138 Ga0451576_0168289 3300045051 Unclassified 2287
139 Ga0451576_0168649 3300045051 Bacteria 2285
140 Ga0451576_0187807 3300045051 Bacteria 2158
141 Ga0451576_0228379 3300045051 Unclassified 1944
142 Ga0451576_0306251 3300045051 Bacteria 1662
143 Ga0451576_0774168 3300045051 Bacteria 1008
144 Ga0451576_0822890 3300045051 Bacteria 975
145 Ga0451576_0882074 3300045051 Bacteria 939
146 Ga0495592_0044446 3300046454 Bacteria 3319
147 Ga0495629_0037980 3300046459 Bacteria 3394
148 Ga0495651_0303574 3300046462 Bacteria 1070
149 Ga0495653_0167528 3300046463 Bacteria 1520
150 Ga0495582_0226841 3300046473 Unclassified 1069
151 Ga0495639_0236944 3300046475 Unclassified 900
152 Ga0495662_0217378 3300046476 Unclassified 942
153 Ga0495594_0387667 3300046499 Bacteria 795
154 Ga0495608_0112827 3300046511 Bacteria 1747
155 Ga0495618_0552675 3300046514 Bacteria 689
156 Ga0495628_0231748 3300046516 Unclassified 1384
157 Ga0495628_0263407 3300046516 Bacteria 1284
158 Ga0495630_0000054 3300046517 Bacteria 91921
159 Ga0495630_0024746 3300046517 Unclassified 4438
160 Ga0495666_0002682 3300046526 Bacteria 8878
161 Ga0495640_0040759 3300046533 Bacteria 3250
162 Ga0495640_0163264 3300046533 Bacteria 1426
163 Ga0495586_0000014 3300046535 Bacteria 131102
164 Ga0495586_0014839 3300046535 Bacteria 4140
165 Ga0495586_0141855 3300046535 Bacteria 1349
166 Ga0495587_0095856 3300046536 Bacteria 1712
167 Ga0495645_0041660 3300046543 Bacteria 3348
168 Ga0495667_0093885 3300046559 Bacteria 1943
169 Ga0495634_0033202 3300046642 Bacteria 3546
170 Ga0495599_0006165 3300046678 Bacteria 7223
171 Ga0495599_0037457 3300046678 Bacteria 3047
172 Ga0495647_0115024 3300046681 Bacteria 1126
173 Ga0495613_0037315 3300046689 Unclassified 3603
174 Ga0495613_0069650 3300046689 Bacteria 2564
175 Ga0495624_0079400 3300046690 Bacteria 2035
176 Ga0495581_0309738 3300047315 Bacteria 923
177 Ga0495674_0001703 3300047319 Bacteria 21633
178 Ga0495674_0033356 3300047319 Bacteria 4665
179 Ga0495676_0036303 3300047321 Unclassified 4117
180 Ga0495676_0136509 3300047321 Bacteria 1763
181 Ga0495684_0342384 3300047471 Bacteria 1064
182 Ga0496112_0594150 3300048915 Bacteria 1039
183 Ga0501033_0099393 3300049570 Bacteria 2125
184 Ga0501034_0427442 3300049571 Unclassified 1245
185 Ga0501047_0087728 3300049581 Bacteria 2989
186 Ga0501044_0145408 3300049823 Bacteria 2357
187 nmdc:mga09592_222056_c1 3300050508 Unclassified 1637
188 nmdc:mga09592_301806_c1 3300050508 Bacteria 1388
189 nmdc:mga06r32_209703_c1 3300050510 Unclassified 1936
190 nmdc:mga06r32_32759_c1 3300050510 Unclassified 4893
191 nmdc:mga06r32_520985_c1 3300050510 Bacteria 1164
192 nmdc:mga08y16_1319205_c1 3300050511 Unclassified 688
193 nmdc:mga08y16_187519_c1 3300050511 Bacteria 2146
194 nmdc:mga08y16_211527_c1 3300050511 Unclassified 2008
195 nmdc:mga08y16_227969_c1 3300050511 Unclassified 1927
196 nmdc:mga08y16_515772_c1 3300050511 Bacteria 1213
197 nmdc:mga0rr50_231383_c1 3300050513 Unclassified 1529
198 Ga0495601_0099107 3300053077 Bacteria 1881
199 Ga0495619_0197226 3300053085 Bacteria 1394
200 Ga0451804_0485833
201 Ga0070683_100426926
202 Ga0070690_100059892
203 Ga0070690_100572416
204 Ga0068868_100568128
205 Ga0070689_100015418
206 Ga0070689_100035841
207 Ga0070691_10058841
208 Ga0070669_101048337
209 Ga0070688_100130553
210 Ga0070711_100104413
211 Ga0070711_100243478
212 Ga0070711_100751372
213 Ga0070705_100133773
214 Ga0070705_100512229
215 Ga0070705_100557289
216 Ga0070694_100012739
217 Ga0070708_100964339
218 Ga0070681_10127690
219 Ga0070707_100712644
220 Ga0070684_100067873
221 Ga0070686_100263061
222 Ga0070704_100006864
223 Ga0068857_100024370
224 Ga0068857_100310663
225 Ga0068857_100372942
226 Ga0068859_100216164
227 Ga0068859_100850572
228 Ga0068864_100347967
229 Ga0068864_100608272
230 Ga0068864_101544337
231 Ga0068863_100139430
232 Ga0068863_101092382
233 Ga0097621_100012488
234 Ga0068871_100365108
235 Ga0068871_100697818
236 Ga0075428_100001123
237 Ga0075428_100161874
238 Ga0075428_100429879
239 Ga0075431_100009275
240 Ga0075431_100292005
241 Ga0075434_101072069
242 Ga0075429_100229957
243 Ga0097620_100131810
244 Ga0097620_100216156
245 Ga0097620_100850506
246 Ga0099794_10226261
247 Ga0099795_10106225
248 Ga0099795_10379502
249 Ga0105240_10035351
250 Ga0105240_10118434
251 Ga0111539_10021791
252 Ga0111539_10150958
253 Ga0111539_10235334
254 Ga0111539_10527743
255 Ga0111539_10790039
256 Ga0105245_10375416
257 Ga0114129_10524157
258 Ga0105242_10700536
259 Ga0105242_10808111
260 Ga0105248_10139243
261 Ga0105248_11730497
262 Ga0105249_10472985
263 Ga0105249_10634908
264 Ga0099796_10072099
265 Ga0105246_10309572
266 Ga0157369_10696415
267 Ga0163162_10311464
268 Ga0157372_10127539
269 Ga0163163_10075521
270 Ga0157379_10081995
271 Ga0207707_10359657
272 Ga0207663_10402917
273 Ga0207663_10563649
274 Ga0207663_10700881
275 Ga0207687_10214309
276 Ga0207670_10009252
277 Ga0207670_10200553
278 Ga0207670_10561820
279 Ga0207665_10080013
280 Ga0207711_10622209
281 Ga0207711_10697408
282 Ga0207667_10878635
283 Ga0207677_10525703
284 Ga0207641_10985155
285 Ga0207641_11060524
286 Ga0207676_10129399
287 Ga0207676_10310366
288 Ga0207676_11364826
289 Ga0207674_10014911
290 Ga0207674_10067389
291 Ga0207428_10110509
292 Ga0207428_10656955
293 Ga0265337_1000127
294 Ga0265319_1028873
295 Ga0265334_10086721
296 Ga0265336_10020469
297 Ga0265338_10002718
298 Ga0265338_10013365
299 Ga0265338_10084739
300 Ga0265338_10091191
301 Ga0265338_10097615
302 Ga0265338_10130175
303 Ga0265338_10156526
304 Ga0265324_10000835
305 Ga0265324_10171518
306 Ga0265328_10061549
307 Ga0265320_10021357
308 Ga0265320_10031680
309 Ga0265325_10067084
310 Ga0265325_10067357
311 Ga0265339_10006080
312 Ga0265331_10084107
313 Ga0265327_10035148
314 Ga0265314_10000453
315 Ga0265314_10074156
316 Ga0265342_10189374
317 Ga0373936_0092134
318 Ga0373954_0081807
319 Ga0373955_0071676
320 Ga0373924_0276786
321 Ga0373935_0008155
322 Ga0373927_0008062
323 Ga0373947_0545651
324 Ga0373937_0727761
325 Ga0373937_0830752
326 Ga0373937_0844794
327 Ga0373925_0023246
328 Ga0373925_0046000
329 Ga0373925_0505220
330 Ga0436365_1328826
331 Ga0451845_0717606
332 Ga0451577_0710742
333 Ga0453684_0062432
334 Ga0453684_1204212
335 Ga0451576_0042626
336 Ga0451576_0127470
337 Ga0451576_0168289
338 Ga0451576_0168649
339 Ga0451576_0187807
340 Ga0451576_0228379
341 Ga0451576_0306251
342 Ga0451576_0774168
343 Ga0451576_0822890
344 Ga0451576_0882074
345 Ga0495592_0044446
346 Ga0495629_0037980
347 Ga0495651_0303574
348 Ga0495653_0167528
349 Ga0495582_0226841
350 Ga0495639_0236944
351 Ga0495662_0217378
352 Ga0495594_0387667
353 Ga0495608_0112827
354 Ga0495618_0552675
355 Ga0495628_0231748
356 Ga0495628_0263407
357 Ga0495630_0000054
358 Ga0495630_0024746
359 Ga0495666_0002682
360 Ga0495640_0040759
361 Ga0495640_0163264
362 Ga0495586_0000014
363 Ga0495586_0014839
364 Ga0495586_0141855
365 Ga0495587_0095856
366 Ga0495645_0041660
367 Ga0495667_0093885
368 Ga0495634_0033202
369 Ga0495599_0006165
370 Ga0495599_0037457
371 Ga0495647_0115024
372 Ga0495613_0037315
373 Ga0495613_0069650
374 Ga0495624_0079400
375 Ga0495581_0309738
376 Ga0495674_0001703
377 Ga0495674_0033356
378 Ga0495676_0036303
379 Ga0495676_0136509
380 Ga0495684_0342384
381 Ga0496112_0594150
382 Ga0501033_0099393
383 Ga0501034_0427442
384 Ga0501047_0087728
385 Ga0501044_0145408
386 nmdc:mga09592_222056_c1
387 nmdc:mga09592_301806_c1
388 nmdc:mga06r32_209703_c1
389 nmdc:mga06r32_32759_c1
390 nmdc:mga06r32_520985_c1
391 nmdc:mga08y16_1319205_c1
392 nmdc:mga08y16_187519_c1
393 nmdc:mga08y16_211527_c1
394 nmdc:mga08y16_227969_c1
395 nmdc:mga08y16_515772_c1
396 nmdc:mga0rr50_231383_c1
397 Ga0495601_0099107
398 Ga0495619_0197226

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00406

ADK

Adenylate kinase

39

201

0.83

PF13207

AAA_17

AAA domain

40

179

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ycd-assembly1.cif.gz_A crystal structure of poecilia reticulata adenylate kinase 0.8997 3 193
5xz2-assembly2.cif.gz_B crystal structure of adenylate kinase 0.8972 3 193
1ukz-assembly1.cif.gz_A substrate specificity and assembly of catalytic center derived from two structures of ligated uridylate kinase 0.8936 3 192
5ycf-assembly2.cif.gz_A crystal structure of xiphophorus maculatus adenylate kinase 0.8927 1 193
5ycf-assembly1.cif.gz_B crystal structure of xiphophorus maculatus adenylate kinase 0.8912 3 193
ID Description Score Start End Superfamily
af_O59771_1_189_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8974 3 190 3.40.50.300
af_Q4D818_2_191_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8921 2 190 3.40.50.300
af_Q8IQG9_25_217_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8803 3 193 3.40.50.300
af_P9WKF5_1_180_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.88 1 190 3.40.50.300
af_O59771_1_189_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8795 3 190 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2V5N849-F1-model_v4 Adenylate kinase 0.9845 1 92 GO:0016301
AF-A0A2V5VW91-F1-model_v4 Adenylate kinase (AK) (EC 2.7.4.3) (ATP-AMP transphosphorylase) (ATP:AMP phosphotransferase) (Adenylate monophosphate kinase) 0.9842 1 193 GO:0004017
GO:0005524
GO:0005737
GO:0044209
AF-A0A382JKQ0-F1-model_v4 Adenylate kinase active site lid domain-containing protein 0.983 1 139 GO:0005524
GO:0005737
GO:0050145
AF-A0A7V9ZXV5-F1-model_v4 Adenylate kinase (AK) (EC 2.7.4.3) (ATP-AMP transphosphorylase) (ATP:AMP phosphotransferase) (Adenylate monophosphate kinase) 0.9826 1 190 GO:0004017
GO:0005524
GO:0005737
GO:0044209
AF-A0A2V5VUC8-F1-model_v4 Adenylate kinase (AK) (EC 2.7.4.3) (ATP-AMP transphosphorylase) (ATP:AMP phosphotransferase) (Adenylate monophosphate kinase) 0.981 1 190 GO:0004017
GO:0005524
GO:0005737
GO:0044209

Map