F306090

General Info

Members Datasets Scaffolds Average Seq Length
199 144 398 232

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_0667663|Ga0436361_0667663_38_736
Length 232
Sequence MTGPPLQRLEGVRACVFDAYGTLFDFGSAAARAADVPEEKRAALTALWRDKQLQYTWLRTLQNRYADFWQVTGDALDFALDTLGLDRSLRESLMDLYLGLEPFPEVPEVLRALRARGFRTAILSNGSPAMLDALVIRAGLADAFDAVLSVEAVGVFKTHPKVYRYALDTLGLPAKAISFQSSNAWDAFAASDFGMRVVWCNRYGQRRERLPGAPDFEIRTLAELPGLLAVIA

Samples

Sample ID Description Type Environment
1 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
24 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
25 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
35 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
45 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
46 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
47 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
48 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
49 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
50 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
68 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
69 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
70 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
71 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
72 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
73 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
74 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
75 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
76 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
77 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
78 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
79 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
80 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
81 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
82 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
83 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
84 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
87 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
88 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
89 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
90 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
91 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
92 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
93 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
94 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
95 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
96 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
97 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
98 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
99 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
100 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
101 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
102 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
103 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
104 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
105 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
106 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
107 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
114 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
115 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
116 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
117 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
118 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
119 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
120 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
121 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
122 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
123 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
124 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
127 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
128 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
129 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
130 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
131 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
132 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
133 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
134 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
135 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
136 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
137 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
138 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
139 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
140 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
141 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
142 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
143 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
144 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0
Isolates 0.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.04
Nodule 0
Rhizoplane 3.52
Rhizosphere 85.93
Stem 0
Stem Tuber 0
Unclassified 7.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436361_0667663 3300039447 Bacteria 1150
2 JGI25151J46595_10000285 3300003187 Bacteria 57259
3 rootH2_10162785 3300003320 Bacteria 1357
4 Ga0070675_100196312 3300005354 Bacteria 1750
5 Ga0070659_100644623 3300005366 Bacteria 913
6 Ga0070714_100017288 3300005435 Bacteria 5841
7 Ga0070713_100001338 3300005436 Bacteria 15759
8 Ga0070713_100079728 3300005436 Bacteria 2790
9 Ga0070713_100092531 3300005436 Bacteria 2603
10 Ga0070710_10000951 3300005437 Bacteria 13753
11 Ga0070706_100003328 3300005467 Bacteria 15866
12 Ga0070707_100003646 3300005468 Bacteria 14519
13 Ga0070707_100287017 3300005468 Bacteria 1599
14 Ga0070698_100017627 3300005471 Bacteria 7524
15 Ga0070698_100073357 3300005471 Bacteria 3429
16 Ga0070698_100123305 3300005471 Bacteria 2549
17 Ga0070698_100161259 3300005471 Bacteria 2186
18 Ga0070698_100624661 3300005471 Unclassified 1018
19 Ga0070699_100000893 3300005518 Bacteria 27849
20 Ga0070699_100576280 3300005518 Bacteria 1025
21 Ga0070679_100326840 3300005530 Bacteria 1482
22 Ga0070697_100461979 3300005536 Bacteria 1107
23 Ga0068853_100382389 3300005539 Unclassified 1315
24 Ga0068853_100505993 3300005539 Bacteria 1141
25 Ga0070672_100095378 3300005543 Bacteria 2406
26 Ga0070696_100095634 3300005546 Bacteria 2122
27 Ga0070665_100615237 3300005548 Bacteria 1099
28 Ga0068864_100654344 3300005618 Unclassified 1023
29 Ga0081455_10001208 3300005937 Bacteria 32347
30 Ga0081455_10019936 3300005937 Bacteria 6330
31 Ga0081455_10025697 3300005937 Bacteria 5431
32 Ga0081540_1001854 3300005983 Bacteria 17700
33 Ga0081540_1033233 3300005983 Bacteria 2804
34 Ga0070717_10022737 3300006028 Bacteria 4958
35 Ga0070717_10078791 3300006028 Bacteria 2762
36 Ga0070717_10111649 3300006028 Bacteria 2333
37 Ga0070715_10000122 3300006163 Bacteria 18468
38 Ga0070716_100000583 3300006173 Bacteria 15326
39 Ga0075369_10146034 3300006186 Unclassified 1080
40 Ga0075369_10221288 3300006186 Bacteria 876
41 Ga0075428_100285452 3300006844 Bacteria 1776
42 Ga0075428_100637920 3300006844 Bacteria 1136
43 Ga0075428_100690519 3300006844 Bacteria 1087
44 Ga0075430_100288093 3300006846 Bacteria 1359
45 Ga0075431_100074623 3300006847 Bacteria 3499
46 Ga0075433_10506709 3300006852 Bacteria 1062
47 Ga0075434_100143294 3300006871 Bacteria 2410
48 Ga0075429_100166701 3300006880 Bacteria 1930
49 Ga0075429_100427884 3300006880 Bacteria 1159
50 Ga0075436_100001205 3300006914 Bacteria 17600
51 Ga0075436_100341683 3300006914 Bacteria 1078
52 Ga0075436_100398622 3300006914 Bacteria 997
53 Ga0075435_100084630 3300007076 Bacteria 2610
54 Ga0075435_100727594 3300007076 Bacteria 863
55 Ga0099794_10185565 3300007265 Bacteria 1062
56 Ga0099794_10196867 3300007265 Unclassified 1031
57 Ga0099795_10056266 3300007788 Bacteria 1446
58 Ga0099795_10147225 3300007788 Unclassified 962
59 Ga0105240_10178732 3300009093 Bacteria 2506
60 Ga0111539_10008559 3300009094 Bacteria 12991
61 Ga0111539_10398100 3300009094 Bacteria 1604
62 Ga0114129_10012927 3300009147 Bacteria 11880
63 Ga0114129_10052130 3300009147 Bacteria 5742
64 Ga0114129_10888238 3300009147 Bacteria 1130
65 Ga0114129_10949290 3300009147 Bacteria 1086
66 Ga0105248_10743976 3300009177 Bacteria 1106
67 Ga0105237_10616081 3300009545 Bacteria 1092
68 Ga0099796_10059375 3300010159 Bacteria 1351
69 Ga0105239_10680597 3300010375 Bacteria 1176
70 Ga0157375_10118980 3300013308 Bacteria 2749
71 Ga0213872_10223554 3300021361 Bacteria 801
72 Ga0213871_10030996 3300021441 Unclassified 1394
73 Ga0213871_10061506 3300021441 Bacteria 1047
74 Ga0209130_1000263 3300025284 Bacteria 65894
75 Ga0209025_1000114 3300025294 Bacteria 218921
76 Ga0209758_1003180 3300025297 Bacteria 15366
77 Ga0207426_1000436 3300025302 Bacteria 67619
78 Ga0207692_10001071 3300025898 Bacteria 10008
79 Ga0207685_10000986 3300025905 Bacteria 5498
80 Ga0207699_10011060 3300025906 Bacteria 4547
81 Ga0207699_10115401 3300025906 Bacteria 1728
82 Ga0207684_10001015 3300025910 Bacteria 31484
83 Ga0207684_10023435 3300025910 Bacteria 5270
84 Ga0207684_10042574 3300025910 Unclassified 3850
85 Ga0207707_10109401 3300025912 Bacteria 2416
86 Ga0207695_10160608 3300025913 Bacteria 2179
87 Ga0207693_10052895 3300025915 Bacteria 3186
88 Ga0207663_10006409 3300025916 Bacteria 6020
89 Ga0207681_10531972 3300025923 Bacteria 966
90 Ga0207700_10002325 3300025928 Bacteria 10900
91 Ga0207700_10376679 3300025928 Unclassified 1240
92 Ga0207664_10012091 3300025929 Bacteria 6165
93 Ga0207665_10000939 3300025939 Bacteria 19702
94 Ga0207691_10105403 3300025940 Bacteria 2512
95 Ga0207712_10746225 3300025961 Bacteria 857
96 Ga0207658_10055737 3300025986 Bacteria 2931
97 Ga0207639_10195271 3300026041 Bacteria 1732
98 Ga0268265_10087437 3300028380 Bacteria 2480
99 Ga0265330_10044113 3300031235 Bacteria 1970
100 Ga0265328_10057837 3300031239 Unclassified 1424
101 Ga0265339_10021319 3300031249 Bacteria 3771
102 Ga0265339_10161361 3300031249 Bacteria 1128
103 Ga0265316_10207287 3300031344 Bacteria 1451
104 Ga0265313_10136103 3300031595 Bacteria 1060
105 Ga0265314_10092098 3300031711 Bacteria 1971
106 Ga0265342_10179320 3300031712 Unclassified 1161
107 Ga0316576_10062527 3300031727 Bacteria 2731
108 Ga0307416_100455679 3300032002 Bacteria 1333
109 Ga0307411_10422540 3300032005 Bacteria 1108
110 Ga0373934_0023089 3300035086 Bacteria 2403
111 Ga0373939_0111814 3300035114 Bacteria 952
112 Ga0373953_0019389 3300035117 Bacteria 2529
113 Ga0373957_0009554 3300035120 Bacteria 3176
114 Ga0373955_0075326 3300035172 Bacteria 1896
115 Ga0373927_0019377 3300035695 Bacteria 4461
116 Ga0373933_0077226 3300035724 Bacteria 2035
117 Ga0373937_0077064 3300036401 Bacteria 3081
118 Ga0395900_0550843 3300037418 Bacteria 1098
119 Ga0395898_0033383 3300037466 Bacteria 5137
120 Ga0436364_1215387 3300037853 Bacteria 105146
121 Ga0436364_1510472 3300037853 Bacteria 1345
122 Ga0436365_0044439 3300039437 Bacteria 3559
123 Ga0436360_0224199 3300039438 Bacteria 1337
124 Ga0436360_0783219 3300039438 Bacteria 1557
125 Ga0436360_1155539 3300039438 Unclassified 1892
126 Ga0436361_0438389 3300039447 Bacteria 1441
127 Ga0436361_0981493 3300039447 Bacteria 2653
128 Ga0436361_1128413 3300039447 Bacteria 761
129 Ga0436362_0311694 3300039453 Bacteria 1085
130 Ga0436362_0549991 3300039453 Bacteria 949
131 Ga0436362_1289504 3300039453 Bacteria 3350
132 Ga0439431_0025510 3300041997 Bacteria 1444
133 Ga0451577_0014263 3300042876 Bacteria 7408
134 Ga0451577_0467835 3300042876 Bacteria 1145
135 Ga0451576_0007596 3300045051 Bacteria 12917
136 Ga0495610_0023872 3300046512 Bacteria 3313
137 Ga0495667_0114358 3300046559 Bacteria 1744
138 Ga0495613_0069536 3300046689 Unclassified 2566
139 Ga0495674_0078303 3300047319 Unclassified 2840
140 Ga0495676_0288211 3300047321 Bacteria 1110
141 Ga0496100_0450770 3300048903 Bacteria 986
142 Ga0496106_0239070 3300048909 Bacteria 1451
143 Ga0496107_0078870 3300048910 Bacteria 2400
144 Ga0496107_0280320 3300048910 Bacteria 1241
145 Ga0496108_0645003 3300048911 Bacteria 921
146 Ga0496110_0188330 3300048913 Bacteria 1874
147 Ga0496115_0082158 3300048918 Bacteria 2625
148 Ga0496124_0193135 3300048927 Bacteria 1556
149 Ga0496126_0372452 3300048929 Bacteria 1164
150 Ga0501034_0103737 3300049571 Bacteria 2837
151 Ga0501038_0395639 3300049574 Bacteria 1070
152 Ga0501041_0081004 3300049577 Bacteria 1999
153 Ga0501043_0291469 3300049579 Bacteria 1249
154 Ga0501046_0127536 3300049580 Bacteria 1932
155 Ga0501047_0040108 3300049581 Bacteria 4528
156 Ga0501069_0249900 3300049585 Bacteria 1034
157 Ga0501070_0077486 3300049586 Bacteria 2751
158 Ga0501071_0050169 3300049587 Bacteria 3006
159 Ga0501072_0006251 3300049588 Bacteria 9078
160 Ga0501075_0022097 3300049591 Bacteria 4645
161 Ga0501075_0127029 3300049591 Bacteria 1942
162 Ga0501075_0208601 3300049591 Bacteria 1490
163 Ga0501076_0026641 3300049592 Bacteria 4480
164 Ga0501077_0001905 3300049593 Bacteria 12631
165 Ga0501079_0011088 3300049741 Bacteria 6875
166 Ga0501079_0037484 3300049741 Bacteria 3737
167 Ga0501080_0093641 3300049742 Bacteria 2790
168 Ga0501081_0001008 3300049743 Bacteria 16795
169 Ga0501081_0174544 3300049743 Bacteria 1553
170 Ga0501083_0023987 3300049744 Bacteria 4229
171 Ga0501035_0096393 3300049822 Bacteria 2599
172 Ga0501044_0076997 3300049823 Bacteria 3383
173 Ga0501045_0424768 3300049824 Bacteria 989
174 nmdc:mga0yw44_167024_c1 3300050492 Bacteria 1443
175 nmdc:mga0yw44_173235_c1 3300050492 Bacteria 1418
176 nmdc:mga05p37_392339_c1 3300050507 Bacteria 1623
177 nmdc:mga05p37_509718_c1 3300050507 Bacteria 1379
178 nmdc:mga05p37_712898_c1 3300050507 Bacteria 1112
179 nmdc:mga05p37_8141_c1 3300050507 Bacteria 12391
180 nmdc:mga09592_128464_c1 3300050508 Bacteria 2180
181 nmdc:mga09592_162378_c1 3300050508 Bacteria 1930
182 nmdc:mga0qj67_121863_c1 3300050509 Bacteria 2110
183 nmdc:mga06r32_180274_c1 3300050510 Bacteria 2098
184 nmdc:mga06r32_215871_c1 3300050510 Bacteria 1906
185 nmdc:mga0n895_112054_c1 3300050512 Bacteria 2745
186 nmdc:mga0n895_96768_c1 3300050512 Bacteria 2957
187 nmdc:mga0rr50_173152_c1 3300050513 Bacteria 1760
188 nmdc:mga08x19_18_c1 3300050514 Bacteria 321445
189 nmdc:mga0sz30_194844_c1 3300050516 Bacteria 899
190 Ga0495595_0017935 3300053084 Bacteria 3051
191 Ga0495619_0017501 3300053085 Bacteria 4538
192 Ga0500556_0000032 3300053104 Bacteria 150774
193 Ga0500568_0120115 3300053139 Bacteria 979
194 Ga0500616_0001287 3300053153 Bacteria 24938
195 Ga0500645_066453 3300053730 Unclassified 1038
196 Ga0501084_0119906 3300054114 Bacteria 2211
197 Ga0501082_0011411 3300060353 Bacteria 7645
198 Ga0501082_0115639 3300060353 Bacteria 2323
199 2844538366 2844533157 Bacteria 7517899
200 Ga0436361_0667663
201 JGI25151J46595_10000285
202 rootH2_10162785
203 Ga0070675_100196312
204 Ga0070659_100644623
205 Ga0070714_100017288
206 Ga0070713_100001338
207 Ga0070713_100079728
208 Ga0070713_100092531
209 Ga0070710_10000951
210 Ga0070706_100003328
211 Ga0070707_100003646
212 Ga0070707_100287017
213 Ga0070698_100017627
214 Ga0070698_100073357
215 Ga0070698_100123305
216 Ga0070698_100161259
217 Ga0070698_100624661
218 Ga0070699_100000893
219 Ga0070699_100576280
220 Ga0070679_100326840
221 Ga0070697_100461979
222 Ga0068853_100382389
223 Ga0068853_100505993
224 Ga0070672_100095378
225 Ga0070696_100095634
226 Ga0070665_100615237
227 Ga0068864_100654344
228 Ga0081455_10001208
229 Ga0081455_10019936
230 Ga0081455_10025697
231 Ga0081540_1001854
232 Ga0081540_1033233
233 Ga0070717_10022737
234 Ga0070717_10078791
235 Ga0070717_10111649
236 Ga0070715_10000122
237 Ga0070716_100000583
238 Ga0075369_10146034
239 Ga0075369_10221288
240 Ga0075428_100285452
241 Ga0075428_100637920
242 Ga0075428_100690519
243 Ga0075430_100288093
244 Ga0075431_100074623
245 Ga0075433_10506709
246 Ga0075434_100143294
247 Ga0075429_100166701
248 Ga0075429_100427884
249 Ga0075436_100001205
250 Ga0075436_100341683
251 Ga0075436_100398622
252 Ga0075435_100084630
253 Ga0075435_100727594
254 Ga0099794_10185565
255 Ga0099794_10196867
256 Ga0099795_10056266
257 Ga0099795_10147225
258 Ga0105240_10178732
259 Ga0111539_10008559
260 Ga0111539_10398100
261 Ga0114129_10012927
262 Ga0114129_10052130
263 Ga0114129_10888238
264 Ga0114129_10949290
265 Ga0105248_10743976
266 Ga0105237_10616081
267 Ga0099796_10059375
268 Ga0105239_10680597
269 Ga0157375_10118980
270 Ga0213872_10223554
271 Ga0213871_10030996
272 Ga0213871_10061506
273 Ga0209130_1000263
274 Ga0209025_1000114
275 Ga0209758_1003180
276 Ga0207426_1000436
277 Ga0207692_10001071
278 Ga0207685_10000986
279 Ga0207699_10011060
280 Ga0207699_10115401
281 Ga0207684_10001015
282 Ga0207684_10023435
283 Ga0207684_10042574
284 Ga0207707_10109401
285 Ga0207695_10160608
286 Ga0207693_10052895
287 Ga0207663_10006409
288 Ga0207681_10531972
289 Ga0207700_10002325
290 Ga0207700_10376679
291 Ga0207664_10012091
292 Ga0207665_10000939
293 Ga0207691_10105403
294 Ga0207712_10746225
295 Ga0207658_10055737
296 Ga0207639_10195271
297 Ga0268265_10087437
298 Ga0265330_10044113
299 Ga0265328_10057837
300 Ga0265339_10021319
301 Ga0265339_10161361
302 Ga0265316_10207287
303 Ga0265313_10136103
304 Ga0265314_10092098
305 Ga0265342_10179320
306 Ga0316576_10062527
307 Ga0307416_100455679
308 Ga0307411_10422540
309 Ga0373934_0023089
310 Ga0373939_0111814
311 Ga0373953_0019389
312 Ga0373957_0009554
313 Ga0373955_0075326
314 Ga0373927_0019377
315 Ga0373933_0077226
316 Ga0373937_0077064
317 Ga0395900_0550843
318 Ga0395898_0033383
319 Ga0436364_1215387
320 Ga0436364_1510472
321 Ga0436365_0044439
322 Ga0436360_0224199
323 Ga0436360_0783219
324 Ga0436360_1155539
325 Ga0436361_0438389
326 Ga0436361_0981493
327 Ga0436361_1128413
328 Ga0436362_0311694
329 Ga0436362_0549991
330 Ga0436362_1289504
331 Ga0439431_0025510
332 Ga0451577_0014263
333 Ga0451577_0467835
334 Ga0451576_0007596
335 Ga0495610_0023872
336 Ga0495667_0114358
337 Ga0495613_0069536
338 Ga0495674_0078303
339 Ga0495676_0288211
340 Ga0496100_0450770
341 Ga0496106_0239070
342 Ga0496107_0078870
343 Ga0496107_0280320
344 Ga0496108_0645003
345 Ga0496110_0188330
346 Ga0496115_0082158
347 Ga0496124_0193135
348 Ga0496126_0372452
349 Ga0501034_0103737
350 Ga0501038_0395639
351 Ga0501041_0081004
352 Ga0501043_0291469
353 Ga0501046_0127536
354 Ga0501047_0040108
355 Ga0501069_0249900
356 Ga0501070_0077486
357 Ga0501071_0050169
358 Ga0501072_0006251
359 Ga0501075_0022097
360 Ga0501075_0127029
361 Ga0501075_0208601
362 Ga0501076_0026641
363 Ga0501077_0001905
364 Ga0501079_0011088
365 Ga0501079_0037484
366 Ga0501080_0093641
367 Ga0501081_0001008
368 Ga0501081_0174544
369 Ga0501083_0023987
370 Ga0501035_0096393
371 Ga0501044_0076997
372 Ga0501045_0424768
373 nmdc:mga0yw44_167024_c1
374 nmdc:mga0yw44_173235_c1
375 nmdc:mga05p37_392339_c1
376 nmdc:mga05p37_509718_c1
377 nmdc:mga05p37_712898_c1
378 nmdc:mga05p37_8141_c1
379 nmdc:mga09592_128464_c1
380 nmdc:mga09592_162378_c1
381 nmdc:mga0qj67_121863_c1
382 nmdc:mga06r32_180274_c1
383 nmdc:mga06r32_215871_c1
384 nmdc:mga0n895_112054_c1
385 nmdc:mga0n895_96768_c1
386 nmdc:mga0rr50_173152_c1
387 nmdc:mga08x19_18_c1
388 nmdc:mga0sz30_194844_c1
389 Ga0495595_0017935
390 Ga0495619_0017501
391 Ga0500556_0000032
392 Ga0500568_0120115
393 Ga0500616_0001287
394 Ga0500645_066453
395 Ga0501084_0119906
396 Ga0501082_0011411
397 Ga0501082_0115639
398 2844538366

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

74

200

0.93

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

12

194

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2no4-assembly1.cif.gz_B crystal structure analysis of a dehalogenase 0.965 5 224
1zrm-assembly1.cif.gz_A crystal structure of the reaction intermediate of l-2-haloacid dehalogenase with 2-chloro-n-butyrate 0.9545 7 221
3umb-assembly1.cif.gz_A-2 crystal structure of the l-2-haloacid dehalogenase rsc1362 0.9543 5 224
3um9-assembly1.cif.gz_B crystal structure of the defluorinating l-2-haloacid dehalogenase bpro0530 0.9478 4 220
2no5-assembly1.cif.gz_B crystal structure analysis of a dehalogenase with intermediate complex 0.9443 1 224
ID Description Score Start End Superfamily
2no5B02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.959 22 93 1.10.150.240
2w43B02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.9533 42 79 1.10.150.240
1zrmA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9523 7 221 3.40.50.1000
3umbA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9408 5 221 3.40.50.1000
2no5A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9389 4 224 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A3D6DUS8-F1-model_v4 (S)-2-haloacid dehalogenase (EC 3.8.1.2) (2-haloalkanoic acid dehalogenase) (Halocarboxylic acid halidohydrolase) (L-2-haloacid dehalogenase) 0.9917 4 197 GO:0018784
AF-A0A534DG42-F1-model_v4 deleted 0.9865 118 223
AF-A0A807K9B7-F1-model_v4 deleted 0.9831 7 222
AF-A0A2K9JJH5-F1-model_v4 deleted 0.9813 5 222
AF-A0A7Y2U008-F1-model_v4 (S)-2-haloacid dehalogenase (EC 3.8.1.2) (2-haloalkanoic acid dehalogenase) (Halocarboxylic acid halidohydrolase) (L-2-haloacid dehalogenase) 0.9804 5 223 GO:0018784

Map