F306076

General Info

Members Datasets Scaffolds Average Seq Length
199 122 398 247

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0414860|Ga0436364_0414860_4231_5058
Length 275
Sequence MDGTSMDGTRQSRVTVTFAGSGDAFGSGGRYQACIHLRAPDRPPVLLDCGATSLSALKACGLDPGEIAAVFVSHLHGDHFGGLPFLILDGQFTRRTQPLTVAGPPGTADRLRQAMEASFPGAVDVQRRFDVDVVELPPGATTTVTGIQVRTWEVSHPSGAPPLALRLDTGGTTIGYTGDTAWTGDLPDVADGADLLIAEAYYFDKAVPYHLRHADLAAHRSDLTSRRIVLTHMSADMLAKARNGQAAFETAHDGLVIHVSGLAIRQARCRAPAAT

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
22 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
38 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
39 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
55 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
56 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
57 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
58 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
59 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
60 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
61 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
62 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
63 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
64 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
65 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
66 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
67 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
68 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
69 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
70 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
71 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
72 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
73 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
74 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
75 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
76 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
77 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
78 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
79 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
80 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
81 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
82 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
83 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
84 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
85 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
86 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
87 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
88 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
89 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
90 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
91 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
99 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
100 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
101 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
102 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
103 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
104 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
105 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
106 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
107 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
108 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
109 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
110 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
111 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
112 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
113 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
114 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
115 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
116 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
117 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
118 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
119 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
120 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
121 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
122 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.99
Metatranscriptomes 1.01
Isolates 1.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.5
Rhizosphere 95.48
Stem 0
Stem Tuber 0
Unclassified 9.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0414860 3300037853 Bacteria 8311
2 Ga0070658_10026430 3300005327 Bacteria 4657
3 Ga0070661_100290629 3300005344 Unclassified 1270
4 Ga0070709_10000189 3300005434 Bacteria 39091
5 Ga0070709_10282307 3300005434 Bacteria 1207
6 Ga0070714_100000994 3300005435 Bacteria 20247
7 Ga0070714_100034922 3300005435 Bacteria 4211
8 Ga0070714_100278462 3300005435 Bacteria 1553
9 Ga0070714_100629497 3300005435 Unclassified 1032
10 Ga0070713_100005128 3300005436 Bacteria 8916
11 Ga0070713_100090110 3300005436 Bacteria 2636
12 Ga0070710_10000820 3300005437 Bacteria 14967
13 Ga0070711_100117044 3300005439 Bacteria 1965
14 Ga0070711_100208474 3300005439 Bacteria 1512
15 Ga0070708_100019973 3300005445 Bacteria 5640
16 Ga0070708_100506020 3300005445 Bacteria 1139
17 Ga0070681_10045992 3300005458 Bacteria 4365
18 Ga0070706_100074460 3300005467 Bacteria 3143
19 Ga0070706_100325426 3300005467 Bacteria 1433
20 Ga0070706_100640802 3300005467 Bacteria 987
21 Ga0070707_100005808 3300005468 Bacteria 11511
22 Ga0070707_100045819 3300005468 Bacteria 4185
23 Ga0070707_100145888 3300005468 Unclassified 2303
24 Ga0070707_100296432 3300005468 Bacteria 1571
25 Ga0070707_100539967 3300005468 Bacteria 1128
26 Ga0070698_100135608 3300005471 Bacteria 2415
27 Ga0070698_100175769 3300005471 Bacteria 2081
28 Ga0070698_100341633 3300005471 Bacteria 1428
29 Ga0070699_100042719 3300005518 Bacteria 3923
30 Ga0070699_100113772 3300005518 Unclassified 2377
31 Ga0070699_100124195 3300005518 Bacteria 2271
32 Ga0070679_100031545 3300005530 Bacteria 5236
33 Ga0070684_100246967 3300005535 Bacteria 1631
34 Ga0070697_100084055 3300005536 Bacteria 2625
35 Ga0070697_100274169 3300005536 Bacteria 1446
36 Ga0070697_100425998 3300005536 Bacteria 1153
37 Ga0068855_100533633 3300005563 Bacteria 1272
38 Ga0068862_100015079 3300005844 Bacteria 6421
39 Ga0070717_10000382 3300006028 Bacteria 28373
40 Ga0070717_10007443 3300006028 Bacteria 8135
41 Ga0070715_10015822 3300006163 Bacteria 2821
42 Ga0070716_100001721 3300006173 Bacteria 9871
43 Ga0070716_100129763 3300006173 Bacteria 1592
44 Ga0070712_100010064 3300006175 Bacteria 5960
45 Ga0075428_100147626 3300006844 Bacteria 2556
46 Ga0075428_100207802 3300006844 Unclassified 2116
47 Ga0075430_100005476 3300006846 Bacteria 10725
48 Ga0075430_100011695 3300006846 Bacteria 7469
49 Ga0075430_100016237 3300006846 Bacteria 6341
50 Ga0075430_100155342 3300006846 Unclassified 1905
51 Ga0075430_100224558 3300006846 Bacteria 1558
52 Ga0075431_100031789 3300006847 Bacteria 5437
53 Ga0075431_100220633 3300006847 Bacteria 1934
54 Ga0075433_10079354 3300006852 Unclassified 2892
55 Ga0075434_100013225 3300006871 Bacteria 7843
56 Ga0075434_100176736 3300006871 Bacteria 2155
57 Ga0075434_100203135 3300006871 Unclassified 2002
58 Ga0075429_100011747 3300006880 Bacteria 7595
59 Ga0075436_100370907 3300006914 Bacteria 1034
60 Ga0111539_10000446 3300009094 Bacteria 51962
61 Ga0111539_10352375 3300009094 Bacteria 1713
62 Ga0111539_10593538 3300009094 Bacteria 1290
63 Ga0114129_10035200 3300009147 Bacteria 7075
64 Ga0114129_10053860 3300009147 Bacteria 5643
65 Ga0114129_10228162 3300009147 Bacteria 2509
66 Ga0114129_10233386 3300009147 Unclassified 2477
67 Ga0114129_10271327 3300009147 Bacteria 2269
68 Ga0157371_10390735 3300013102 Unclassified 1017
69 Ga0157369_10026235 3300013105 Bacteria 6465
70 Ga0157369_10039775 3300013105 Bacteria 5138
71 Ga0157372_10578920 3300013307 Unclassified 1308
72 Ga0206353_11160209 3300020082 Bacteria 2486
73 Ga0213875_10008378 3300021388 Bacteria 5301
74 Ga0224572_1000335 3300024225 Bacteria 5113
75 Ga0207692_10001334 3300025898 Bacteria 9201
76 Ga0207692_10082834 3300025898 Bacteria 1720
77 Ga0207685_10027596 3300025905 Bacteria 1989
78 Ga0207699_10000251 3300025906 Bacteria 30139
79 Ga0207684_10008956 3300025910 Bacteria 8876
80 Ga0207684_10177990 3300025910 Unclassified 1834
81 Ga0207684_10261149 3300025910 Bacteria 1494
82 Ga0207693_10007835 3300025915 Bacteria 8769
83 Ga0207693_10170414 3300025915 Bacteria 1714
84 Ga0207660_10063070 3300025917 Bacteria 2671
85 Ga0207657_10108220 3300025919 Bacteria 2298
86 Ga0207652_10056652 3300025921 Bacteria 3374
87 Ga0207646_10005851 3300025922 Bacteria 12856
88 Ga0207646_10014719 3300025922 Bacteria 7411
89 Ga0207646_10019414 3300025922 Bacteria 6319
90 Ga0207646_10035938 3300025922 Bacteria 4473
91 Ga0207646_10204447 3300025922 Bacteria 1784
92 Ga0207700_10000336 3300025928 Bacteria 27633
93 Ga0207700_10135631 3300025928 Unclassified 2016
94 Ga0207664_10000443 3300025929 Bacteria 29578
95 Ga0207664_10018201 3300025929 Bacteria 5165
96 Ga0207664_10439071 3300025929 Bacteria 1164
97 Ga0207665_10100437 3300025939 Bacteria 2019
98 Ga0207665_10397987 3300025939 Unclassified 1048
99 Ga0207661_10056132 3300025944 Bacteria 3161
100 Ga0207678_10591567 3300026067 Bacteria 972
101 Ga0207674_10234547 3300026116 Bacteria 1782
102 Ga0207428_10003284 3300027907 Bacteria 15730
103 Ga0265338_10008540 3300028800 Bacteria 12404
104 Ga0265338_10142599 3300028800 Bacteria 1874
105 Ga0307408_100017595 3300031548 Bacteria 4785
106 Ga0307405_10474983 3300031731 Unclassified 997
107 Ga0307413_10657725 3300031824 Bacteria 865
108 Ga0307406_10414285 3300031901 Bacteria 1072
109 Ga0307407_10274589 3300031903 Bacteria 1165
110 Ga0307409_100269795 3300031995 Bacteria 1566
111 Ga0307416_100049071 3300032002 Bacteria 3354
112 Ga0373926_0082374 3300035083 Bacteria 1191
113 Ga0373934_0146323 3300035086 Bacteria 967
114 Ga0373957_0125358 3300035120 Bacteria 1042
115 Ga0373955_0068446 3300035172 Bacteria 1978
116 Ga0372808_003871 3300036459 Bacteria 1872
117 Ga0373925_0000013 3300037068 Bacteria 188673
118 Ga0373925_0065286 3300037068 Bacteria 2741
119 Ga0395898_0028723 3300037466 Bacteria 5574
120 Ga0436364_0658155 3300037853 Bacteria 8091
121 Ga0395901_0697883 3300038443 Unclassified 1013
122 Ga0436365_1436257 3300039437 Bacteria 1025
123 Ga0451577_0002182 3300042876 Bacteria 23872
124 Ga0453684_0008392 3300044712 Bacteria 18535
125 Ga0451576_0002647 3300045051 Bacteria 26164
126 Ga0451576_0213219 3300045051 Unclassified 2017
127 Ga0451576_0456622 3300045051 Bacteria 1341
128 Ga0495651_0090280 3300046462 Bacteria 2298
129 Ga0495653_0159033 3300046463 Unclassified 1570
130 Ga0495618_0402209 3300046514 Bacteria 837
131 Ga0495652_0294963 3300046529 Bacteria 1181
132 Ga0495640_0036744 3300046533 Bacteria 3459
133 Ga0495587_0256655 3300046536 Bacteria 982
134 Ga0495634_0267727 3300046642 Bacteria 1041
135 Ga0495635_0268260 3300046663 Bacteria 1148
136 Ga0495635_0370561 3300046663 Bacteria 954
137 Ga0495657_0032584 3300046675 Bacteria 3635
138 Ga0495646_0259905 3300046680 Bacteria 928
139 Ga0495624_0172247 3300046690 Bacteria 1320
140 Ga0495600_0232335 3300046809 Bacteria 1177
141 Ga0495674_0047750 3300047319 Bacteria 3793
142 Ga0495674_0247288 3300047319 Bacteria 1468
143 Ga0495684_0306403 3300047471 Bacteria 1139
144 Ga0496112_0521702 3300048915 Bacteria 1123
145 Ga0496126_0077355 3300048929 Bacteria 2950
146 Ga0501033_0511349 3300049570 Bacteria 830
147 Ga0501036_0359936 3300049572 Unclassified 1215
148 Ga0501038_0222274 3300049574 Bacteria 1506
149 Ga0501039_0261063 3300049575 Bacteria 1361
150 Ga0501040_0097210 3300049576 Bacteria 2051
151 Ga0501042_0003694 3300049578 Bacteria 9663
152 Ga0501048_0086896 3300049582 Bacteria 2206
153 Ga0501067_0028743 3300049583 Bacteria 3081
154 Ga0501068_0113832 3300049584 Bacteria 1684
155 Ga0501068_0357447 3300049584 Bacteria 939
156 Ga0501069_0051486 3300049585 Bacteria 2291
157 Ga0501071_0351333 3300049587 Bacteria 1122
158 Ga0501072_0191516 3300049588 Bacteria 1631
159 Ga0501072_0202807 3300049588 Bacteria 1581
160 Ga0501074_0047119 3300049590 Bacteria 3116
161 Ga0501075_0052402 3300049591 Bacteria 3068
162 Ga0501076_0007136 3300049592 Bacteria 8122
163 Ga0501077_0027623 3300049593 Bacteria 3602
164 Ga0501077_0076125 3300049593 Bacteria 2125
165 Ga0501079_0076516 3300049741 Bacteria 2589
166 Ga0501079_0312207 3300049741 Bacteria 1230
167 Ga0501081_0000826 3300049743 Bacteria 18324
168 Ga0501081_0048000 3300049743 Bacteria 2937
169 Ga0501081_0148718 3300049743 Bacteria 1682
170 Ga0501083_0044750 3300049744 Bacteria 2996
171 Ga0501083_0068484 3300049744 Bacteria 2362
172 Ga0501045_0057486 3300049824 Bacteria 2846
173 Ga0501045_0096776 3300049824 Bacteria 2184
174 nmdc:mga05p37_33138_c1 3300050507 Bacteria 6326
175 nmdc:mga05p37_672171_c1 3300050507 Bacteria 1156
176 nmdc:mga05p37_741718_c1 3300050507 Bacteria 1084
177 nmdc:mga09592_57913_c1 3300050508 Bacteria 3276
178 nmdc:mga09592_96830_c1 3300050508 Bacteria 2525
179 nmdc:mga0qj67_129304_c1 3300050509 Bacteria 2045
180 nmdc:mga0qj67_13606_c1 3300050509 Bacteria 6138
181 nmdc:mga0qj67_3930_c1 3300050509 Bacteria 10750
182 nmdc:mga0qj67_511543_c1 3300050509 Bacteria 965
183 nmdc:mga06r32_126569_c1 3300050510 Bacteria 2524
184 nmdc:mga06r32_15530_c1 3300050510 Bacteria 6915
185 nmdc:mga06r32_49900_c1 3300050510 Bacteria 4004
186 nmdc:mga08y16_2861_c1 3300050511 Bacteria 17751
187 nmdc:mga0n895_124670_c1 3300050512 Bacteria 2599
188 nmdc:mga0n895_2506_c1 3300050512 Bacteria 14370
189 nmdc:mga0a205_1677_c1 3300050515 Bacteria 19104
190 nmdc:mga0a205_2428_c1 3300050515 Bacteria 16430
191 Ga0501084_0004567 3300054114 Bacteria 11318
192 Ga0501084_0026773 3300054114 Bacteria 4816
193 Ga0501084_0166915 3300054114 Bacteria 1858
194 Ga0501082_0596457 3300060353 Bacteria 967
195 Ga0530510_0174155 3300061734 Bacteria 1594
196 Ga0530510_0389086 3300061734 Bacteria 1050
197 Ga0530510_0646541 3300061734 Bacteria 805
198 2899363379 2899359706 Bacteria 10940472
199 8003320286 8003314358 Bacteria 10575343
200 Ga0436364_0414860
201 Ga0070658_10026430
202 Ga0070661_100290629
203 Ga0070709_10000189
204 Ga0070709_10282307
205 Ga0070714_100000994
206 Ga0070714_100034922
207 Ga0070714_100278462
208 Ga0070714_100629497
209 Ga0070713_100005128
210 Ga0070713_100090110
211 Ga0070710_10000820
212 Ga0070711_100117044
213 Ga0070711_100208474
214 Ga0070708_100019973
215 Ga0070708_100506020
216 Ga0070681_10045992
217 Ga0070706_100074460
218 Ga0070706_100325426
219 Ga0070706_100640802
220 Ga0070707_100005808
221 Ga0070707_100045819
222 Ga0070707_100145888
223 Ga0070707_100296432
224 Ga0070707_100539967
225 Ga0070698_100135608
226 Ga0070698_100175769
227 Ga0070698_100341633
228 Ga0070699_100042719
229 Ga0070699_100113772
230 Ga0070699_100124195
231 Ga0070679_100031545
232 Ga0070684_100246967
233 Ga0070697_100084055
234 Ga0070697_100274169
235 Ga0070697_100425998
236 Ga0068855_100533633
237 Ga0068862_100015079
238 Ga0070717_10000382
239 Ga0070717_10007443
240 Ga0070715_10015822
241 Ga0070716_100001721
242 Ga0070716_100129763
243 Ga0070712_100010064
244 Ga0075428_100147626
245 Ga0075428_100207802
246 Ga0075430_100005476
247 Ga0075430_100011695
248 Ga0075430_100016237
249 Ga0075430_100155342
250 Ga0075430_100224558
251 Ga0075431_100031789
252 Ga0075431_100220633
253 Ga0075433_10079354
254 Ga0075434_100013225
255 Ga0075434_100176736
256 Ga0075434_100203135
257 Ga0075429_100011747
258 Ga0075436_100370907
259 Ga0111539_10000446
260 Ga0111539_10352375
261 Ga0111539_10593538
262 Ga0114129_10035200
263 Ga0114129_10053860
264 Ga0114129_10228162
265 Ga0114129_10233386
266 Ga0114129_10271327
267 Ga0157371_10390735
268 Ga0157369_10026235
269 Ga0157369_10039775
270 Ga0157372_10578920
271 Ga0206353_11160209
272 Ga0213875_10008378
273 Ga0224572_1000335
274 Ga0207692_10001334
275 Ga0207692_10082834
276 Ga0207685_10027596
277 Ga0207699_10000251
278 Ga0207684_10008956
279 Ga0207684_10177990
280 Ga0207684_10261149
281 Ga0207693_10007835
282 Ga0207693_10170414
283 Ga0207660_10063070
284 Ga0207657_10108220
285 Ga0207652_10056652
286 Ga0207646_10005851
287 Ga0207646_10014719
288 Ga0207646_10019414
289 Ga0207646_10035938
290 Ga0207646_10204447
291 Ga0207700_10000336
292 Ga0207700_10135631
293 Ga0207664_10000443
294 Ga0207664_10018201
295 Ga0207664_10439071
296 Ga0207665_10100437
297 Ga0207665_10397987
298 Ga0207661_10056132
299 Ga0207678_10591567
300 Ga0207674_10234547
301 Ga0207428_10003284
302 Ga0265338_10008540
303 Ga0265338_10142599
304 Ga0307408_100017595
305 Ga0307405_10474983
306 Ga0307413_10657725
307 Ga0307406_10414285
308 Ga0307407_10274589
309 Ga0307409_100269795
310 Ga0307416_100049071
311 Ga0373926_0082374
312 Ga0373934_0146323
313 Ga0373957_0125358
314 Ga0373955_0068446
315 Ga0372808_003871
316 Ga0373925_0000013
317 Ga0373925_0065286
318 Ga0395898_0028723
319 Ga0436364_0658155
320 Ga0395901_0697883
321 Ga0436365_1436257
322 Ga0451577_0002182
323 Ga0453684_0008392
324 Ga0451576_0002647
325 Ga0451576_0213219
326 Ga0451576_0456622
327 Ga0495651_0090280
328 Ga0495653_0159033
329 Ga0495618_0402209
330 Ga0495652_0294963
331 Ga0495640_0036744
332 Ga0495587_0256655
333 Ga0495634_0267727
334 Ga0495635_0268260
335 Ga0495635_0370561
336 Ga0495657_0032584
337 Ga0495646_0259905
338 Ga0495624_0172247
339 Ga0495600_0232335
340 Ga0495674_0047750
341 Ga0495674_0247288
342 Ga0495684_0306403
343 Ga0496112_0521702
344 Ga0496126_0077355
345 Ga0501033_0511349
346 Ga0501036_0359936
347 Ga0501038_0222274
348 Ga0501039_0261063
349 Ga0501040_0097210
350 Ga0501042_0003694
351 Ga0501048_0086896
352 Ga0501067_0028743
353 Ga0501068_0113832
354 Ga0501068_0357447
355 Ga0501069_0051486
356 Ga0501071_0351333
357 Ga0501072_0191516
358 Ga0501072_0202807
359 Ga0501074_0047119
360 Ga0501075_0052402
361 Ga0501076_0007136
362 Ga0501077_0027623
363 Ga0501077_0076125
364 Ga0501079_0076516
365 Ga0501079_0312207
366 Ga0501081_0000826
367 Ga0501081_0048000
368 Ga0501081_0148718
369 Ga0501083_0044750
370 Ga0501083_0068484
371 Ga0501045_0057486
372 Ga0501045_0096776
373 nmdc:mga05p37_33138_c1
374 nmdc:mga05p37_672171_c1
375 nmdc:mga05p37_741718_c1
376 nmdc:mga09592_57913_c1
377 nmdc:mga09592_96830_c1
378 nmdc:mga0qj67_129304_c1
379 nmdc:mga0qj67_13606_c1
380 nmdc:mga0qj67_3930_c1
381 nmdc:mga0qj67_511543_c1
382 nmdc:mga06r32_126569_c1
383 nmdc:mga06r32_15530_c1
384 nmdc:mga06r32_49900_c1
385 nmdc:mga08y16_2861_c1
386 nmdc:mga0n895_124670_c1
387 nmdc:mga0n895_2506_c1
388 nmdc:mga0a205_1677_c1
389 nmdc:mga0a205_2428_c1
390 Ga0501084_0004567
391 Ga0501084_0026773
392 Ga0501084_0166915
393 Ga0501082_0596457
394 Ga0530510_0174155
395 Ga0530510_0389086
396 Ga0530510_0646541
397 2899363379
398 8003320286

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12706

Lactamase_B_2

Beta-lactamase superfamily domain

44

233

0.89

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

27

232

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gcw-assembly1.cif.gz_A crystal structure of rnase z in complex with precursor trna(thr) 0.8492 5 249
1y44-assembly1.cif.gz_A crystal structure of rnase z 0.8467 5 249
2cbn-assembly1.cif.gz_A-2 crystal structure of zipd from escherichia coli 0.8457 4 249
2fk6-assembly1.cif.gz_A-2 crystal structure of rnase z/trna(thr) complex 0.8384 5 249
4gcw-assembly1.cif.gz_A crystal structure of rnase z in complex with precursor trna(thr) 0.8332 5 249
ID Description Score Start End Superfamily
af_P0A8V0_1_305_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8491 5 249 3.60.15.10
af_Q2FY67_1_306_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.846 5 249 3.60.15.10
af_P0A8V0_1_305_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8332 5 249 3.60.15.10
af_Q2FY67_1_306_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8301 5 249 3.60.15.10
af_P9WGC1_17_267_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8285 4 247 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A7Y6IS57-F1-model_v4 MBL fold metallo-hydrolase 0.9747 5 249 GO:0042781
AF-A0A0S8BYA2-F1-model_v4 MBL fold metallo-hydrolase 0.9733 5 249 GO:0042781
AF-A0A535GJ70-F1-model_v4 MBL fold metallo-hydrolase 0.9729 48 249 GO:0042781
AF-A0A521LSE2-F1-model_v4 MBL fold metallo-hydrolase 0.9723 5 249 GO:0042781
AF-A0A2M8ZXT4-F1-model_v4 deleted 0.9723 4 249

Map