F305733

General Info

Members Datasets Scaffolds Average Seq Length
199 141 398 97

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_12753720|Ga0105245_127537202
Length 114
Sequence VQFSPPRLADTTAGRLDAMATCTHLDTLNAVTPSDDGCHECLAGGGRWVHLRMCQECGHVGCCDSSPSRHATAHFHATAHPIVRSFEPGEEWFYCYADDLAFEIDGAQPAPSHS

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
92 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
93 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
96 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
97 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
98 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
99 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
100 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
101 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
102 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
103 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
104 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
105 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
106 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
107 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
108 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
109 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
110 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
111 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
114 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
115 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
116 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
117 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
118 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
119 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
120 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
123 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
124 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
125 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
126 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
127 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
128 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
131 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
132 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
133 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
134 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
135 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
136 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
137 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
138 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
139 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
140 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
141 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.99
Metatranscriptomes 1.01
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.04
Rhizosphere 90.45
Stem 0
Stem Tuber 0
Unclassified 1.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_12753720 3300009098 Bacteria 545
2 Ga0070683_100976803 3300005329 Bacteria 813
3 Ga0070683_101436526 3300005329 Bacteria 663
4 Ga0070690_101158320 3300005330 Bacteria 615
5 Ga0070680_100851011 3300005336 Bacteria 786
6 Ga0068868_101017077 3300005338 Bacteria 759
7 Ga0068868_101600822 3300005338 Bacteria 612
8 Ga0070687_100573758 3300005343 Bacteria 771
9 Ga0070668_102196974 3300005347 Bacteria 510
10 Ga0070674_100569168 3300005356 Bacteria 953
11 Ga0070688_100513321 3300005365 Bacteria 906
12 Ga0070714_100770725 3300005435 Bacteria 931
13 Ga0070708_101169975 3300005445 Bacteria 720
14 Ga0070663_100217383 3300005455 Bacteria 1499
15 Ga0070663_101048707 3300005455 Bacteria 711
16 Ga0070681_10098663 3300005458 Bacteria 2867
17 Ga0070685_10292547 3300005466 Bacteria 1095
18 Ga0070685_10404816 3300005466 Bacteria 946
19 Ga0070707_101878990 3300005468 Bacteria 566
20 Ga0070698_101989015 3300005471 Bacteria 534
21 Ga0070684_100386139 3300005535 Bacteria 1290
22 Ga0070693_101540463 3300005547 Bacteria 521
23 Ga0070665_100306594 3300005548 Unclassified 1591
24 Ga0070665_100581440 3300005548 Bacteria 1133
25 Ga0070665_101272261 3300005548 Bacteria 746
26 Ga0068855_100678077 3300005563 Bacteria 1105
27 Ga0068854_100638951 3300005578 Bacteria 912
28 Ga0068852_100536615 3300005616 Bacteria 1169
29 Ga0068859_101095220 3300005617 Bacteria 876
30 Ga0068864_100378405 3300005618 Bacteria 1341
31 Ga0068861_100865926 3300005719 Bacteria 853
32 Ga0068861_101527118 3300005719 Bacteria 656
33 Ga0068870_10357971 3300005840 Bacteria 938
34 Ga0068870_10972811 3300005840 Bacteria 604
35 Ga0068863_100111394 3300005841 Bacteria 2607
36 Ga0068863_102220096 3300005841 Bacteria 559
37 Ga0068858_100040819 3300005842 Bacteria 4304
38 Ga0068858_100250606 3300005842 Bacteria 1682
39 Ga0068862_100798667 3300005844 Bacteria 921
40 Ga0075432_10177214 3300006058 Bacteria 832
41 Ga0097621_100943837 3300006237 Bacteria 805
42 Ga0075428_100044063 3300006844 Bacteria 4904
43 Ga0075428_100351766 3300006844 Bacteria 1581
44 Ga0075428_101559745 3300006844 Bacteria 691
45 Ga0075430_100016579 3300006846 Bacteria 6275
46 Ga0075431_100001630 3300006847 Bacteria 20976
47 Ga0075429_100001103 3300006880 Bacteria 21760
48 Ga0068865_100449695 3300006881 Bacteria 1065
49 Ga0097620_101094957 3300006931 Bacteria 876
50 Ga0111539_12918432 3300009094 Bacteria 553
51 Ga0105245_10240102 3300009098 Bacteria 1756
52 Ga0105247_10094582 3300009101 Bacteria 1901
53 Ga0114129_10003646 3300009147 Bacteria 21662
54 Ga0114129_10979539 3300009147 Bacteria 1066
55 Ga0105243_10520606 3300009148 Bacteria 1131
56 Ga0105243_10703480 3300009148 Bacteria 985
57 Ga0105243_12628269 3300009148 Bacteria 543
58 Ga0105241_12291325 3300009174 Bacteria 537
59 Ga0105242_11446141 3300009176 Bacteria 716
60 Ga0105248_12046891 3300009177 Bacteria 651
61 Ga0105237_11229228 3300009545 Bacteria 756
62 Ga0105238_10000033 3300009551 Bacteria 172981
63 Ga0105238_12620110 3300009551 Bacteria 540
64 Ga0105239_10541790 3300010375 Bacteria 1325
65 Ga0105239_11140838 3300010375 Bacteria 898
66 Ga0105239_12414225 3300010375 Bacteria 612
67 Ga0105246_10378626 3300011119 Bacteria 1169
68 Ga0157329_1001023 3300012491 Bacteria 1318
69 Ga0157371_10219935 3300013102 Bacteria 1364
70 Ga0157374_12155092 3300013296 Bacteria 584
71 Ga0157374_12206991 3300013296 Bacteria 578
72 Ga0163162_12166826 3300013306 Bacteria 638
73 Ga0157375_10379223 3300013308 Bacteria 1581
74 Ga0157375_10908969 3300013308 Bacteria 1024
75 Ga0163163_10127098 3300014325 Bacteria 2587
76 Ga0163163_11277743 3300014325 Bacteria 796
77 Ga0157377_10186171 3300014745 Bacteria 1309
78 Ga0157377_11057103 3300014745 Bacteria 619
79 Ga0157379_10133873 3300014968 Bacteria 2232
80 Ga0157379_11068680 3300014968 Bacteria 772
81 Ga0206356_11031193 3300020070 Bacteria 645
82 Ga0206354_11626567 3300020081 Bacteria 697
83 Ga0207688_10043437 3300025901 Bacteria 2503
84 Ga0207688_10665304 3300025901 Bacteria 658
85 Ga0207647_10342461 3300025904 Bacteria 847
86 Ga0207707_10152055 3300025912 Bacteria 2023
87 Ga0207646_10793069 3300025922 Bacteria 844
88 Ga0207694_10000012 3300025924 Bacteria 411218
89 Ga0207659_10421884 3300025926 Bacteria 1119
90 Ga0207687_10101112 3300025927 Bacteria 2122
91 Ga0207687_11108186 3300025927 Bacteria 680
92 Ga0207664_11317756 3300025929 Bacteria 642
93 Ga0207664_11407535 3300025929 Bacteria 618
94 Ga0207706_10521758 3300025933 Bacteria 1024
95 Ga0207706_11022928 3300025933 Bacteria 693
96 Ga0207686_10748686 3300025934 Bacteria 780
97 Ga0207709_10242231 3300025935 Bacteria 1312
98 Ga0207704_10405283 3300025938 Bacteria 1077
99 Ga0207704_10689209 3300025938 Bacteria 845
100 Ga0207665_10848869 3300025939 Bacteria 723
101 Ga0207691_10376601 3300025940 Bacteria 1212
102 Ga0207689_10549367 3300025942 Bacteria 970
103 Ga0207661_10783257 3300025944 Bacteria 878
104 Ga0207661_10918527 3300025944 Bacteria 806
105 Ga0207661_11944800 3300025944 Bacteria 534
106 Ga0207668_10603793 3300025972 Bacteria 956
107 Ga0207640_11229470 3300025981 Bacteria 667
108 Ga0207677_10114831 3300026023 Bacteria 2013
109 Ga0207677_10391610 3300026023 Unclassified 1176
110 Ga0207677_10477551 3300026023 Bacteria 1073
111 Ga0207677_11923170 3300026023 Bacteria 550
112 Ga0207703_10047063 3300026035 Bacteria 3477
113 Ga0207639_12291303 3300026041 Bacteria 501
114 Ga0207678_10259739 3300026067 Bacteria 1488
115 Ga0207641_11897466 3300026088 Bacteria 597
116 Ga0207676_10425922 3300026095 Bacteria 1246
117 Ga0207674_10368157 3300026116 Bacteria 1389
118 Ga0207674_11477286 3300026116 Bacteria 649
119 Ga0207675_100133338 3300026118 Bacteria 2356
120 Ga0207675_100609456 3300026118 Bacteria 1095
121 Ga0207683_10082835 3300026121 Bacteria 2850
122 Ga0207698_10899703 3300026142 Bacteria 892
123 Ga0207428_10280196 3300027907 Bacteria 1238
124 Ga0268266_10449920 3300028379 Bacteria 1224
125 Ga0268265_10402468 3300028380 Bacteria 1266
126 Ga0307408_100494919 3300031548 Bacteria 1069
127 Ga0307413_10554666 3300031824 Bacteria 933
128 Ga0326468_10001296 3300031889 Bacteria 2209
129 Ga0307412_10194783 3300031911 Bacteria 1535
130 Ga0307416_100036690 3300032002 Bacteria 3763
131 Ga0307414_10172834 3300032004 Bacteria 1729
132 Ga0307414_10526563 3300032004 Bacteria 1050
133 Ga0307411_10307022 3300032005 Bacteria 1275
134 Ga0307411_10554606 3300032005 Bacteria 981
135 Ga0307411_11725520 3300032005 Bacteria 580
136 Ga0316574_0492949 3300035398 Bacteria 765
137 Ga0436360_0065505 3300039438 Bacteria 577
138 Ga0436363_0463624 3300039450 Bacteria 966
139 Ga0439465_0019850 3300041413 Bacteria 2102
140 Ga0451791_0868814 3300041451 Bacteria 762
141 Ga0451793_0346949 3300041452 Bacteria 584
142 Ga0451835_1259832 3300041492 Bacteria 775
143 Ga0451853_1632642 3300041512 Bacteria 792
144 Ga0439433_0144918 3300041999 Bacteria 609
145 Ga0439452_013537 3300042010 Bacteria 2287
146 Ga0439452_026640 3300042010 Bacteria 1457
147 Ga0439462_0111951 3300042015 Bacteria 756
148 Ga0439462_0139397 3300042015 Bacteria 679
149 Ga0439463_078327 3300042016 Bacteria 849
150 Ga0439446_0153972 3300042156 Bacteria 757
151 Ga0450916_045074 3300042530 Bacteria 681
152 Ga0466966_0181754 3300044684 Bacteria 1276
153 Ga0466957_0039872 3300044842 Bacteria 2835
154 Ga0466960_0041472 3300044901 Bacteria 2181
155 Ga0466959_0030736 3300045049 Bacteria 3976
156 Ga0466959_0169060 3300045049 Bacteria 1534
157 Ga0466959_0271823 3300045049 Bacteria 1165
158 Ga0466958_0158720 3300045836 Bacteria 1428
159 Ga0466958_0420392 3300045836 Bacteria 864
160 Ga0466967_0055906 3300045976 Bacteria 3478
161 Ga0466967_0937612 3300045976 Bacteria 861
162 Ga0466967_1277936 3300045976 Bacteria 731
163 Ga0495584_0189930 3300046491 Bacteria 1044
164 Ga0495686_0000003 3300047472 Bacteria 899502
165 Ga0495615_0007937 3300048090 Bacteria 2033
166 Ga0496101_0735181 3300048904 Bacteria 779
167 Ga0496102_0351490 3300048905 Unclassified 1388
168 Ga0496103_0045457 3300048906 Bacteria 2710
169 Ga0496104_0026230 3300048907 Bacteria 5378
170 Ga0496108_0305910 3300048911 Bacteria 1385
171 Ga0496108_0407637 3300048911 Bacteria 1187
172 Ga0496108_0552011 3300048911 Bacteria 1005
173 Ga0496108_1699635 3300048911 Bacteria 519
174 Ga0496109_0114688 3300048912 Bacteria 2506
175 Ga0496109_0598550 3300048912 Bacteria 1039
176 Ga0496110_0007554 3300048913 Bacteria 8683
177 Ga0496110_0763623 3300048913 Bacteria 870
178 Ga0496114_0021105 3300048917 Bacteria 5295
179 Ga0496115_0259624 3300048918 Bacteria 1429
180 Ga0501034_0468858 3300049571 Bacteria 1175
181 Ga0501069_0343987 3300049585 Bacteria 878
182 Ga0501074_0101432 3300049590 Bacteria 2060
183 Ga0501077_0129517 3300049593 Bacteria 1600
184 Ga0501079_0121639 3300049741 Bacteria 2030
185 Ga0501080_0086046 3300049742 Bacteria 2920
186 Ga0501045_0039437 3300049824 Bacteria 3437
187 nmdc:mga05p37_4047_c1 3300050507 Bacteria 17135
188 nmdc:mga05p37_740040_c1 3300050507 Bacteria 1086
189 nmdc:mga09592_11705_c1 3300050508 Bacteria 7134
190 nmdc:mga09592_12589_c1 3300050508 Bacteria 6894
191 nmdc:mga09592_434890_c1 3300050508 Bacteria 1133
192 nmdc:mga0qj67_22158_c1 3300050509 Bacteria 4878
193 nmdc:mga0qj67_2409_c1 3300050509 Bacteria 13320
194 nmdc:mga0qj67_415635_c1 3300050509 Bacteria 1085
195 nmdc:mga06r32_1257_c1 3300050510 Bacteria 22782
196 nmdc:mga08y16_150333_c1 3300050511 Bacteria 2421
197 nmdc:mga08y16_1530864_c1 3300050511 Bacteria 627
198 nmdc:mga08y16_353822_c1 3300050511 Bacteria 1508
199 nmdc:mga0a205_690749_c1 3300050515 Bacteria 870
200 Ga0105245_12753720
201 Ga0070683_100976803
202 Ga0070683_101436526
203 Ga0070690_101158320
204 Ga0070680_100851011
205 Ga0068868_101017077
206 Ga0068868_101600822
207 Ga0070687_100573758
208 Ga0070668_102196974
209 Ga0070674_100569168
210 Ga0070688_100513321
211 Ga0070714_100770725
212 Ga0070708_101169975
213 Ga0070663_100217383
214 Ga0070663_101048707
215 Ga0070681_10098663
216 Ga0070685_10292547
217 Ga0070685_10404816
218 Ga0070707_101878990
219 Ga0070698_101989015
220 Ga0070684_100386139
221 Ga0070693_101540463
222 Ga0070665_100306594
223 Ga0070665_100581440
224 Ga0070665_101272261
225 Ga0068855_100678077
226 Ga0068854_100638951
227 Ga0068852_100536615
228 Ga0068859_101095220
229 Ga0068864_100378405
230 Ga0068861_100865926
231 Ga0068861_101527118
232 Ga0068870_10357971
233 Ga0068870_10972811
234 Ga0068863_100111394
235 Ga0068863_102220096
236 Ga0068858_100040819
237 Ga0068858_100250606
238 Ga0068862_100798667
239 Ga0075432_10177214
240 Ga0097621_100943837
241 Ga0075428_100044063
242 Ga0075428_100351766
243 Ga0075428_101559745
244 Ga0075430_100016579
245 Ga0075431_100001630
246 Ga0075429_100001103
247 Ga0068865_100449695
248 Ga0097620_101094957
249 Ga0111539_12918432
250 Ga0105245_10240102
251 Ga0105247_10094582
252 Ga0114129_10003646
253 Ga0114129_10979539
254 Ga0105243_10520606
255 Ga0105243_10703480
256 Ga0105243_12628269
257 Ga0105241_12291325
258 Ga0105242_11446141
259 Ga0105248_12046891
260 Ga0105237_11229228
261 Ga0105238_10000033
262 Ga0105238_12620110
263 Ga0105239_10541790
264 Ga0105239_11140838
265 Ga0105239_12414225
266 Ga0105246_10378626
267 Ga0157329_1001023
268 Ga0157371_10219935
269 Ga0157374_12155092
270 Ga0157374_12206991
271 Ga0163162_12166826
272 Ga0157375_10379223
273 Ga0157375_10908969
274 Ga0163163_10127098
275 Ga0163163_11277743
276 Ga0157377_10186171
277 Ga0157377_11057103
278 Ga0157379_10133873
279 Ga0157379_11068680
280 Ga0206356_11031193
281 Ga0206354_11626567
282 Ga0207688_10043437
283 Ga0207688_10665304
284 Ga0207647_10342461
285 Ga0207707_10152055
286 Ga0207646_10793069
287 Ga0207694_10000012
288 Ga0207659_10421884
289 Ga0207687_10101112
290 Ga0207687_11108186
291 Ga0207664_11317756
292 Ga0207664_11407535
293 Ga0207706_10521758
294 Ga0207706_11022928
295 Ga0207686_10748686
296 Ga0207709_10242231
297 Ga0207704_10405283
298 Ga0207704_10689209
299 Ga0207665_10848869
300 Ga0207691_10376601
301 Ga0207689_10549367
302 Ga0207661_10783257
303 Ga0207661_10918527
304 Ga0207661_11944800
305 Ga0207668_10603793
306 Ga0207640_11229470
307 Ga0207677_10114831
308 Ga0207677_10391610
309 Ga0207677_10477551
310 Ga0207677_11923170
311 Ga0207703_10047063
312 Ga0207639_12291303
313 Ga0207678_10259739
314 Ga0207641_11897466
315 Ga0207676_10425922
316 Ga0207674_10368157
317 Ga0207674_11477286
318 Ga0207675_100133338
319 Ga0207675_100609456
320 Ga0207683_10082835
321 Ga0207698_10899703
322 Ga0207428_10280196
323 Ga0268266_10449920
324 Ga0268265_10402468
325 Ga0307408_100494919
326 Ga0307413_10554666
327 Ga0326468_10001296
328 Ga0307412_10194783
329 Ga0307416_100036690
330 Ga0307414_10172834
331 Ga0307414_10526563
332 Ga0307411_10307022
333 Ga0307411_10554606
334 Ga0307411_11725520
335 Ga0316574_0492949
336 Ga0436360_0065505
337 Ga0436363_0463624
338 Ga0439465_0019850
339 Ga0451791_0868814
340 Ga0451793_0346949
341 Ga0451835_1259832
342 Ga0451853_1632642
343 Ga0439433_0144918
344 Ga0439452_013537
345 Ga0439452_026640
346 Ga0439462_0111951
347 Ga0439462_0139397
348 Ga0439463_078327
349 Ga0439446_0153972
350 Ga0450916_045074
351 Ga0466966_0181754
352 Ga0466957_0039872
353 Ga0466960_0041472
354 Ga0466959_0030736
355 Ga0466959_0169060
356 Ga0466959_0271823
357 Ga0466958_0158720
358 Ga0466958_0420392
359 Ga0466967_0055906
360 Ga0466967_0937612
361 Ga0466967_1277936
362 Ga0495584_0189930
363 Ga0495686_0000003
364 Ga0495615_0007937
365 Ga0496101_0735181
366 Ga0496102_0351490
367 Ga0496103_0045457
368 Ga0496104_0026230
369 Ga0496108_0305910
370 Ga0496108_0407637
371 Ga0496108_0552011
372 Ga0496108_1699635
373 Ga0496109_0114688
374 Ga0496109_0598550
375 Ga0496110_0007554
376 Ga0496110_0763623
377 Ga0496114_0021105
378 Ga0496115_0259624
379 Ga0501034_0468858
380 Ga0501069_0343987
381 Ga0501074_0101432
382 Ga0501077_0129517
383 Ga0501079_0121639
384 Ga0501080_0086046
385 Ga0501045_0039437
386 nmdc:mga05p37_4047_c1
387 nmdc:mga05p37_740040_c1
388 nmdc:mga09592_11705_c1
389 nmdc:mga09592_12589_c1
390 nmdc:mga09592_434890_c1
391 nmdc:mga0qj67_22158_c1
392 nmdc:mga0qj67_2409_c1
393 nmdc:mga0qj67_415635_c1
394 nmdc:mga06r32_1257_c1
395 nmdc:mga08y16_150333_c1
396 nmdc:mga08y16_1530864_c1
397 nmdc:mga08y16_353822_c1
398 nmdc:mga0a205_690749_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02148

zf-UBP

Zn-finger in ubiquitin-hydrolases and other protein

38

105

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ida-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8704 1 92
2ida-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8278 1 92
3phd-assembly1.cif.gz_B crystal structure of human hdac6 in complex with ubiquitin 0.8157 3 83
7zyu-assembly1.cif.gz_A hdac6 znf domain inhibitor - darpin (designed ankyrin repeat protein) f10 0.809 3 83
6tbm-assembly1.cif.gz_Q structure of saga bound to tbp, including spt8 and dub 0.8016 19 88
ID Description Score Start End Superfamily
2idaA01 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.9219 1 87 3.30.40.10
2idaA01 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.9024 1 87 3.30.40.10
af_Q9GRV2_34_127_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8952 20 90 3.30.40.10
af_Q4DD96_272_345_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.892 19 83 3.30.40.10
af_A4HRG6_422_490_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8794 19 83 3.30.40.10
ID Description Score Start End GO Terms
AF-A0A7W1B4V7-F1-model_v4 UBP-type zinc finger domain-containing protein 1.004 19 80 GO:0008270
AF-A0A656TSE6-F1-model_v4 deleted 1.001 20 86
AF-A0A5N8YYI3-F1-model_v4 UBP-type zinc finger domain-containing protein 0.9997 19 85 GO:0008270
AF-A0A2V8LYP2-F1-model_v4 UBP-type domain-containing protein 0.9981 3 83 GO:0008270
AF-A0A1H3IX77-F1-model_v4 Ubiquitin-hydrolase Zn-finger-containing protein 0.9974 31 83 GO:0008270
GO:0016787

Map