F305729

General Info

Members Datasets Scaffolds Average Seq Length
199 145 199 290

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10479221|Ga0111539_104792211
Length 346
Sequence MNPVFIRVPFVVSSEVRWADNLSGMLTEAIRYFRVRDGRCYGVDVNRELKIDEHEGKVMKKLFRIHQSSGMHWVGNGFPVRSVFDYNGLGRELSPFLLLDYAAPYEFTPGKEKRGVGAHPHKGFETVTVAYQGELAHRDSSGGGGTIGPGDVQWMTAGNGIVHEEFHSQEFTRKGGPLQMVQLWVNLRAKDKTAKPRYQTLLKARIPTVELPDDAGSVRVIAGDCGGHRGAAKTFSPINLWDVNLRAGKSAELPLPDGHTTTFLVLSGEVTVNSERDAREGDLVIFARDGDGITVKAKADAKLLVMDGEPIAEPIVGHGPFVMNSRAEIQQAFEDYQLGRMGEILA

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
50 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
75 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
76 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
77 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
78 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
79 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
82 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
83 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
84 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
85 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
86 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
87 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
88 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
89 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
90 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
91 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
92 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
93 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
94 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
95 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
96 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
97 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
98 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
99 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
100 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
101 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
102 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
103 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
104 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
105 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
106 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
107 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
108 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
109 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
110 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
111 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
112 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
113 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
114 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
115 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
116 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
117 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
118 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
119 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
120 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
129 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
130 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
131 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
132 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
133 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
134 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
135 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
136 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
137 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
140 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
141 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
142 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
143 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
144 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
145 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.01
Nodule 0
Rhizoplane 1.01
Rhizosphere 97.99
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10044191 3300005328 Bacteria 2592
2 Ga0070683_100061706 3300005329 Bacteria 3485
3 Ga0070683_100089330 3300005329 Bacteria 2891
4 Ga0070670_100163698 3300005331 Bacteria 1928
5 Ga0068868_100045875 3300005338 Bacteria 3420
6 Ga0070660_100347462 3300005339 Bacteria 1221
7 Ga0070689_100312438 3300005340 Bacteria 1310
8 Ga0070661_100091931 3300005344 Bacteria 2247
9 Ga0070675_100029281 3300005354 Bacteria 4440
10 Ga0070671_100056688 3300005355 Bacteria 3259
11 Ga0070674_100032095 3300005356 Bacteria 3486
12 Ga0070673_100007081 3300005364 Bacteria 7363
13 Ga0070688_100005945 3300005365 Bacteria 6466
14 Ga0070688_100240360 3300005365 Bacteria 1285
15 Ga0070678_100009449 3300005456 Bacteria 5911
16 Ga0070678_100051996 3300005456 Bacteria 2972
17 Ga0070681_10072296 3300005458 Bacteria 3412
18 Ga0070681_10267384 3300005458 Bacteria 1621
19 Ga0068867_100102831 3300005459 Bacteria 2184
20 Ga0068853_100000009 3300005539 Bacteria 257819
21 Ga0070665_100022937 3300005548 Bacteria 6285
22 Ga0070704_100010994 3300005549 Bacteria 5523
23 Ga0070664_100017240 3300005564 Bacteria 5931
24 Ga0068857_100215394 3300005577 Bacteria 1753
25 Ga0068856_100252484 3300005614 Bacteria 1779
26 Ga0068859_100263893 3300005617 Bacteria 1814
27 Ga0068864_100067724 3300005618 Bacteria 3100
28 Ga0068864_100240634 3300005618 Bacteria 1677
29 Ga0068864_100560336 3300005618 Bacteria 1105
30 Ga0068851_10029067 3300005834 Bacteria 2734
31 Ga0068863_100078920 3300005841 Bacteria 3118
32 Ga0068863_100100198 3300005841 Bacteria 2753
33 Ga0068863_100511189 3300005841 Bacteria 1183
34 Ga0068858_100625078 3300005842 Bacteria 1046
35 Ga0097621_100009095 3300006237 Bacteria 7199
36 Ga0097621_100021137 3300006237 Bacteria 5026
37 Ga0068871_100049984 3300006358 Bacteria 3381
38 Ga0068871_100295838 3300006358 Bacteria 1420
39 Ga0075428_100392202 3300006844 Bacteria 1488
40 Ga0068865_100014496 3300006881 Bacteria 5009
41 Ga0097620_100263862 3300006931 Bacteria 1814
42 Ga0111539_10202601 3300009094 Bacteria 2314
43 Ga0111539_10258745 3300009094 Bacteria 2026
44 Ga0111539_10315278 3300009094 Bacteria 1820
45 Ga0111539_10479221 3300009094 Bacteria 1449
46 Ga0111539_10784201 3300009094 Bacteria 1109
47 Ga0105245_10138508 3300009098 Bacteria 2290
48 Ga0105241_10031236 3300009174 Bacteria 3987
49 Ga0105241_10106445 3300009174 Bacteria 2238
50 Ga0105242_10035625 3300009176 Bacteria 3990
51 Ga0105242_10146170 3300009176 Bacteria 2057
52 Ga0105248_10162990 3300009177 Bacteria 2514
53 Ga0105237_10186856 3300009545 Bacteria 2072
54 Ga0105238_10029157 3300009551 Bacteria 5623
55 Ga0105238_10067780 3300009551 Bacteria 3569
56 Ga0105246_10002616 3300011119 Bacteria 10894
57 Ga0105246_10086620 3300011119 Bacteria 2246
58 Ga0157369_10386310 3300013105 Bacteria 1453
59 Ga0157378_10018625 3300013297 Bacteria 6104
60 Ga0157378_10020723 3300013297 Bacteria 5782
61 Ga0157378_10100955 3300013297 Bacteria 2635
62 Ga0163162_10005090 3300013306 Bacteria 12668
63 Ga0163162_10207263 3300013306 Bacteria 2090
64 Ga0157372_10161019 3300013307 Bacteria 2594
65 Ga0157375_10381310 3300013308 Bacteria 1576
66 Ga0163163_10000002 3300014325 Bacteria 609846
67 Ga0163163_10000800 3300014325 Bacteria 26691
68 Ga0157379_10002199 3300014968 Bacteria 16229
69 Ga0157379_10150111 3300014968 Bacteria 2102
70 Ga0157376_10035415 3300014969 Bacteria 4038
71 Ga0163161_10021236 3300017792 Bacteria 4564
72 Ga0163161_10165821 3300017792 Bacteria 1686
73 Ga0209758_1000008 3300025297 Bacteria 1215263
74 Ga0207682_10014871 3300025893 Bacteria 3031
75 Ga0207707_10267778 3300025912 Bacteria 1481
76 Ga0207657_10302951 3300025919 Bacteria 1266
77 Ga0207649_10093859 3300025920 Bacteria 1970
78 Ga0207650_10006743 3300025925 Bacteria 7829
79 Ga0207650_10199252 3300025925 Bacteria 1603
80 Ga0207659_10007705 3300025926 Bacteria 6644
81 Ga0207659_10258340 3300025926 Bacteria 1416
82 Ga0207687_10229652 3300025927 Bacteria 1465
83 Ga0207686_10013500 3300025934 Bacteria 4521
84 Ga0207670_10004081 3300025936 Bacteria 7818
85 Ga0207670_10207273 3300025936 Bacteria 1493
86 Ga0207704_10078580 3300025938 Bacteria 2123
87 Ga0207711_10193148 3300025941 Bacteria 1856
88 Ga0207679_10110417 3300025945 Bacteria 2169
89 Ga0207667_10490424 3300025949 Bacteria 1247
90 Ga0207651_10007945 3300025960 Bacteria 5688
91 Ga0207651_10151338 3300025960 Bacteria 1806
92 Ga0207651_10243537 3300025960 Bacteria 1467
93 Ga0207640_10017560 3300025981 Bacteria 4189
94 Ga0207703_10079464 3300026035 Bacteria 2729
95 Ga0207639_10000004 3300026041 Bacteria 698784
96 Ga0207639_10233860 3300026041 Bacteria 1594
97 Ga0207648_10019216 3300026089 Bacteria 6167
98 Ga0207648_10042196 3300026089 Bacteria 4005
99 Ga0207676_10022515 3300026095 Bacteria 4635
100 Ga0207676_10040204 3300026095 Bacteria 3583
101 Ga0207674_10107812 3300026116 Bacteria 2762
102 Ga0207683_10000842 3300026121 Bacteria 28118
103 Ga0207683_10007007 3300026121 Bacteria 9666
104 Ga0207683_10580422 3300026121 Bacteria 1037
105 Ga0207698_10034089 3300026142 Bacteria 3707
106 Ga0268266_10020502 3300028379 Bacteria 5634
107 Ga0268264_10020759 3300028381 Bacteria 5368
108 Ga0265338_10066057 3300028800 Bacteria 3133
109 Ga0265332_10018921 3300031238 Bacteria 3040
110 Ga0265328_10021582 3300031239 Bacteria 2455
111 Ga0265329_10001432 3300031242 Bacteria 11495
112 Ga0265314_10000364 3300031711 Bacteria 62957
113 Ga0307414_10145188 3300032004 Bacteria 1863
114 Ga0307415_100050856 3300032126 Bacteria 2810
115 Ga0373944_0007017 3300035089 Bacteria 3011
116 Ga0373955_0169399 3300035172 Bacteria 1292
117 Ga0373924_0075735 3300035410 Bacteria 1425
118 Ga0373931_0032020 3300035691 Bacteria 2718
119 Ga0316582_0172055 3300036647 Bacteria 1471
120 Ga0395898_0069661 3300037466 Bacteria 3403
121 Ga0395905_0168882 3300037471 Bacteria 2055
122 Ga0439441_002537 3300042001 Bacteria 2590
123 Ga0451577_0307480 3300042876 Bacteria 1437
124 Ga0466969_0061986 3300044656 Bacteria 1816
125 Ga0466957_0014831 3300044842 Bacteria 4542
126 Ga0451576_0155652 3300045051 Bacteria 2384
127 Ga0451576_0253447 3300045051 Bacteria 1840
128 Ga0451576_0308390 3300045051 Bacteria 1656
129 Ga0466958_0002484 3300045836 Bacteria 9281
130 Ga0466967_0016180 3300045976 Bacteria 5871
131 Ga0466967_0120812 3300045976 Bacteria 2420
132 Ga0495592_0000006 3300046454 Bacteria 192981
133 Ga0495641_0013655 3300046461 Bacteria 4448
134 Ga0495651_0328958 3300046462 Bacteria 1016
135 Ga0495662_0002830 3300046476 Bacteria 8773
136 Ga0495664_0017469 3300046477 Bacteria 4102
137 Ga0495585_0028011 3300046492 Bacteria 3216
138 Ga0495628_0000235 3300046516 Bacteria 48651
139 Ga0495630_0107980 3300046517 Bacteria 2108
140 Ga0495630_0452868 3300046517 Bacteria 983
141 Ga0495666_0023768 3300046526 Bacteria 3031
142 Ga0495666_0024962 3300046526 Bacteria 2953
143 Ga0495652_0082116 3300046529 Bacteria 2657
144 Ga0495640_0214744 3300046533 Bacteria 1215
145 Ga0495586_0000275 3300046535 Bacteria 33057
146 Ga0495586_0089158 3300046535 Bacteria 1702
147 Ga0495645_0024475 3300046543 Bacteria 4381
148 Ga0495634_0038731 3300046642 Bacteria 3249
149 Ga0495599_0008601 3300046678 Bacteria 6213
150 Ga0495647_0007191 3300046681 Bacteria 3722
151 Ga0495658_0001071 3300046683 Bacteria 14415
152 Ga0495613_0017529 3300046689 Bacteria 5332
153 Ga0495636_0004573 3300047318 Bacteria 5419
154 Ga0495674_0023204 3300047319 Bacteria 5720
155 Ga0495680_0330684 3300047322 Bacteria 1065
156 Ga0495675_0132705 3300047444 Bacteria 1547
157 Ga0495684_0069785 3300047471 Bacteria 2672
158 Ga0496114_0238765 3300048917 Bacteria 1598
159 Ga0496115_0045226 3300048918 Bacteria 3514
160 Ga0501033_0002234 3300049570 Bacteria 16643
161 Ga0501033_0082131 3300049570 Bacteria 2363
162 Ga0501034_0014980 3300049571 Bacteria 7976
163 Ga0501034_0151580 3300049571 Bacteria 2294
164 Ga0501034_0163924 3300049571 Bacteria 2192
165 Ga0501036_0308282 3300049572 Bacteria 1324
166 Ga0501037_0019093 3300049573 Bacteria 5053
167 Ga0501038_0069994 3300049574 Bacteria 2979
168 Ga0501038_0113190 3300049574 Bacteria 2246
169 Ga0501043_0078524 3300049579 Bacteria 2593
170 Ga0501043_0315305 3300049579 Bacteria 1193
171 Ga0501046_0002562 3300049580 Bacteria 17013
172 Ga0501047_0142178 3300049581 Bacteria 2277
173 Ga0501047_0273066 3300049581 Bacteria 1536
174 Ga0501047_0557857 3300049581 Bacteria 969
175 Ga0501067_0001612 3300049583 Bacteria 12353
176 Ga0501069_0027919 3300049585 Bacteria 3094
177 Ga0501070_0002763 3300049586 Bacteria 15316
178 Ga0501071_0117109 3300049587 Bacteria 1973
179 Ga0501073_0002197 3300049589 Bacteria 14601
180 Ga0501073_0087140 3300049589 Bacteria 2172
181 Ga0501074_0003734 3300049590 Bacteria 10812
182 Ga0501076_0057917 3300049592 Bacteria 3078
183 Ga0501080_0147964 3300049742 Bacteria 2171
184 Ga0501083_0005960 3300049744 Bacteria 8628
185 Ga0501083_0088009 3300049744 Bacteria 2054
186 Ga0501035_0034298 3300049822 Bacteria 4612
187 Ga0501035_0053528 3300049822 Bacteria 3608
188 Ga0501035_0108939 3300049822 Bacteria 2428
189 Ga0501035_0425016 3300049822 Bacteria 1103
190 Ga0501044_0062769 3300049823 Bacteria 3797
191 Ga0501044_0116241 3300049823 Bacteria 2680
192 Ga0501045_0012478 3300049824 Bacteria 5983
193 nmdc:mga08y16_144130_c1 3300050511 Bacteria 2476
194 nmdc:mga08y16_301541_c1 3300050511 Bacteria 1651
195 Ga0495601_0200026 3300053077 Bacteria 1306
196 Ga0500595_001967 3300053119 Bacteria 10553
197 Ga0501084_0008855 3300054114 Bacteria 8331
198 Ga0501082_0004104 3300060353 Bacteria 12719
199 Ga0530510_0239231 3300061734 Bacteria 1351

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044656 Ga0466969_0061986 Ga0466969_0061986_16_822 247
2 3300049581 Ga0501047_0273066 Ga0501047_0273066_482_1276 264
3 3300044842 Ga0466957_0014831 Ga0466957_0014831_3540_4409 268
4 3300045836 Ga0466958_0002484 Ga0466958_0002484_4977_5846 268
5 3300045976 Ga0466967_0016180 Ga0466967_0016180_1120_1989 268
6 3300049581 Ga0501047_0557857 Ga0501047_0557857_136_954 272
7 3300005340 Ga0070689_100312438 Ga0070689_1003124381 275
8 3300025936 Ga0207670_10207273 Ga0207670_102072731 275
9 3300047444 Ga0495675_0132705 Ga0495675_0132705_339_1166 275
10 3300050511 nmdc:mga08y16_301541_c1 nmdc:mga08y16_301541_c1_149_976 275
11 3300046462 Ga0495651_0328958 Ga0495651_0328958_173_1003 276
12 3300046517 Ga0495630_0452868 Ga0495630_0452868_129_959 276
13 3300005618 Ga0068864_100067724 Ga0068864_1000677243 278
14 3300005841 Ga0068863_100100198 Ga0068863_1001001982 278
15 3300032126 Ga0307415_100050856 Ga0307415_1000508563 285
16 3300049570 Ga0501033_0002234 Ga0501033_0002234_15484_16341 285
17 3300049571 Ga0501034_0014980 Ga0501034_0014980_4798_5655 285
18 3300049573 Ga0501037_0019093 Ga0501037_0019093_4002_4859 285
19 3300049574 Ga0501038_0069994 Ga0501038_0069994_303_1160 285
20 3300049574 Ga0501038_0113190 Ga0501038_0113190_868_1725 285
21 3300049579 Ga0501043_0078524 Ga0501043_0078524_1105_1962 285
22 3300049580 Ga0501046_0002562 Ga0501046_0002562_7050_7907 285
23 3300049583 Ga0501067_0001612 Ga0501067_0001612_5237_6094 285
24 3300049585 Ga0501069_0027919 Ga0501069_0027919_1047_1904 285
25 3300049586 Ga0501070_0002763 Ga0501070_0002763_9268_10125 285
26 3300049589 Ga0501073_0002197 Ga0501073_0002197_8213_9070 285
27 3300049590 Ga0501074_0003734 Ga0501074_0003734_8889_9746 285
28 3300049592 Ga0501076_0057917 Ga0501076_0057917_829_1719 285
29 3300049742 Ga0501080_0147964 Ga0501080_0147964_683_1540 285
30 3300049744 Ga0501083_0005960 Ga0501083_0005960_2498_3355 285
31 3300049822 Ga0501035_0053528 Ga0501035_0053528_491_1348 285
32 3300049822 Ga0501035_0425016 Ga0501035_0425016_46_903 285
33 3300049823 Ga0501044_0116241 Ga0501044_0116241_1192_2049 285
34 3300049824 Ga0501045_0012478 Ga0501045_0012478_814_1671 285
35 3300054114 Ga0501084_0008855 Ga0501084_0008855_1568_2425 285
36 3300060353 Ga0501082_0004104 Ga0501082_0004104_6518_7408 285
37 3300005338 Ga0068868_100045875 Ga0068868_1000458752 286
38 3300005364 Ga0070673_100007081 Ga0070673_1000070812 286
39 3300005548 Ga0070665_100022937 Ga0070665_1000229374 286
40 3300006358 Ga0068871_100295838 Ga0068871_1002958381 286
41 3300009094 Ga0111539_10258745 Ga0111539_102587451 286
42 3300011119 Ga0105246_10086620 Ga0105246_100866202 286
43 3300013297 Ga0157378_10018625 Ga0157378_100186252 286
44 3300025927 Ga0207687_10229652 Ga0207687_102296522 286
45 3300025960 Ga0207651_10007945 Ga0207651_100079453 286
46 3300025960 Ga0207651_10243537 Ga0207651_102435372 286
47 3300028379 Ga0268266_10020502 Ga0268266_100205021 286
48 3300035691 Ga0373931_0032020 Ga0373931_0032020_975_1895 286
49 3300049570 Ga0501033_0082131 Ga0501033_0082131_792_1661 286
50 3300049571 Ga0501034_0151580 Ga0501034_0151580_438_1307 286
51 3300049581 Ga0501047_0142178 Ga0501047_0142178_297_1166 286
52 3300049822 Ga0501035_0034298 Ga0501035_0034298_99_959 286
53 3300049823 Ga0501044_0062769 Ga0501044_0062769_1845_2705 286
54 3300053077 Ga0495601_0200026 Ga0495601_0200026_366_1226 286
55 3300053119 Ga0500595_001967 Ga0500595_001967_9141_10001 286
56 3300005329 Ga0070683_100061706 Ga0070683_1000617064 287
57 3300005339 Ga0070660_100347462 Ga0070660_1003474622 287
58 3300005365 Ga0070688_100240360 Ga0070688_1002403601 287
59 3300005456 Ga0070678_100009449 Ga0070678_1000094492 287
60 3300005458 Ga0070681_10072296 Ga0070681_100722961 287
61 3300005459 Ga0068867_100102831 Ga0068867_1001028313 287
62 3300005539 Ga0068853_100000009 Ga0068853_100000009119 287
63 3300005614 Ga0068856_100252484 Ga0068856_1002524842 287
64 3300005617 Ga0068859_100263893 Ga0068859_1002638933 287
65 3300006237 Ga0097621_100021137 Ga0097621_1000211374 287
66 3300006844 Ga0075428_100392202 Ga0075428_1003922021 287
67 3300006881 Ga0068865_100014496 Ga0068865_1000144962 287
68 3300006931 Ga0097620_100263862 Ga0097620_1002638623 287
69 3300009094 Ga0111539_10202601 Ga0111539_102026011 287
70 3300009094 Ga0111539_10315278 Ga0111539_103152782 287
71 3300009094 Ga0111539_10784201 Ga0111539_107842011 287
72 3300009098 Ga0105245_10138508 Ga0105245_101385082 287
73 3300009176 Ga0105242_10146170 Ga0105242_101461703 287
74 3300009177 Ga0105248_10162990 Ga0105248_101629903 287
75 3300009545 Ga0105237_10186856 Ga0105237_101868563 287
76 3300009551 Ga0105238_10067780 Ga0105238_100677802 287
77 3300013105 Ga0157369_10386310 Ga0157369_103863102 287
78 3300013297 Ga0157378_10100955 Ga0157378_101009553 287
79 3300013307 Ga0157372_10161019 Ga0157372_101610192 287
80 3300014968 Ga0157379_10150111 Ga0157379_101501113 287
81 3300017792 Ga0163161_10021236 Ga0163161_100212363 287
82 3300025912 Ga0207707_10267778 Ga0207707_102677781 287
83 3300025919 Ga0207657_10302951 Ga0207657_103029512 287
84 3300025934 Ga0207686_10013500 Ga0207686_100135003 287
85 3300025938 Ga0207704_10078580 Ga0207704_100785802 287
86 3300025941 Ga0207711_10193148 Ga0207711_101931482 287
87 3300025949 Ga0207667_10490424 Ga0207667_104904241 287
88 3300026035 Ga0207703_10079464 Ga0207703_100794643 287
89 3300026041 Ga0207639_10000004 Ga0207639_10000004381 287
90 3300026041 Ga0207639_10233860 Ga0207639_102338602 287
91 3300026089 Ga0207648_10019216 Ga0207648_100192162 287
92 3300026121 Ga0207683_10007007 Ga0207683_100070076 287
93 3300028800 Ga0265338_10066057 Ga0265338_100660572 287
94 3300031238 Ga0265332_10018921 Ga0265332_100189213 287
95 3300031239 Ga0265328_10021582 Ga0265328_100215821 287
96 3300031242 Ga0265329_10001432 Ga0265329_1000143211 287
97 3300031711 Ga0265314_10000364 Ga0265314_1000036411 287
98 3300032004 Ga0307414_10145188 Ga0307414_101451883 287
99 3300035089 Ga0373944_0007017 Ga0373944_0007017_1254_2117 287
100 3300042876 Ga0451577_0307480 Ga0451577_0307480_163_1068 287
101 3300045976 Ga0466967_0120812 Ga0466967_0120812_764_1627 287
102 3300046454 Ga0495592_0000006 Ga0495592_0000006_146923_147786 287
103 3300046476 Ga0495662_0002830 Ga0495662_0002830_2814_3677 287
104 3300046477 Ga0495664_0017469 Ga0495664_0017469_2800_3663 287
105 3300046516 Ga0495628_0000235 Ga0495628_0000235_20947_21810 287
106 3300046526 Ga0495666_0023768 Ga0495666_0023768_1255_2118 287
107 3300046529 Ga0495652_0082116 Ga0495652_0082116_1727_2590 287
108 3300046535 Ga0495586_0000275 Ga0495586_0000275_1819_2682 287
109 3300046543 Ga0495645_0024475 Ga0495645_0024475_1271_2134 287
110 3300046678 Ga0495599_0008601 Ga0495599_0008601_5287_6150 287
111 3300048918 Ga0496115_0045226 Ga0496115_0045226_1222_2145 287
112 3300049571 Ga0501034_0163924 Ga0501034_0163924_81_965 287
113 3300049822 Ga0501035_0108939 Ga0501035_0108939_1457_2320 287
114 3300005549 Ga0070704_100010994 Ga0070704_1000109942 288
115 3300009094 Ga0111539_10479221 Ga0111539_104792211 288
116 3300009176 Ga0105242_10035625 Ga0105242_100356254 288
117 3300014325 Ga0163163_10000800 Ga0163163_100008006 288
118 3300025926 Ga0207659_10258340 Ga0207659_102583401 288
119 3300026121 Ga0207683_10580422 Ga0207683_105804221 288
120 3300035172 Ga0373955_0169399 Ga0373955_0169399_316_1224 288
121 3300035410 Ga0373924_0075735 Ga0373924_0075735_52_960 288
122 3300037471 Ga0395905_0168882 Ga0395905_0168882_630_1496 288
123 3300045051 Ga0451576_0253447 Ga0451576_0253447_95_961 288
124 3300045051 Ga0451576_0308390 Ga0451576_0308390_426_1334 288
125 3300046492 Ga0495585_0028011 Ga0495585_0028011_387_1253 288
126 3300046535 Ga0495586_0089158 Ga0495586_0089158_316_1224 288
127 3300047319 Ga0495674_0023204 Ga0495674_0023204_4496_5404 288
128 3300047322 Ga0495680_0330684 Ga0495680_0330684_104_1012 288
129 3300047471 Ga0495684_0069785 Ga0495684_0069785_703_1611 288
130 3300049572 Ga0501036_0308282 Ga0501036_0308282_306_1172 288
131 3300049579 Ga0501043_0315305 Ga0501043_0315305_283_1149 288
132 3300049587 Ga0501071_0117109 Ga0501071_0117109_1042_1908 288
133 3300049589 Ga0501073_0087140 Ga0501073_0087140_1149_2015 288
134 3300049744 Ga0501083_0088009 Ga0501083_0088009_723_1589 288
135 3300050511 nmdc:mga08y16_144130_c1 nmdc:mga08y16_144130_c1_98_1138 288
136 3300061734 Ga0530510_0239231 Ga0530510_0239231_446_1312 288
137 3300005365 Ga0070688_100005945 Ga0070688_1000059453 289
138 3300005577 Ga0068857_100215394 Ga0068857_1002153942 289
139 3300005618 Ga0068864_100240634 Ga0068864_1002406342 289
140 3300005841 Ga0068863_100511189 Ga0068863_1005111892 289
141 3300009174 Ga0105241_10031236 Ga0105241_100312363 289
142 3300009551 Ga0105238_10029157 Ga0105238_100291575 289
143 3300011119 Ga0105246_10002616 Ga0105246_100026165 289
144 3300013306 Ga0163162_10207263 Ga0163162_102072632 289
145 3300014325 Ga0163163_10000002 Ga0163163_1000000242 289
146 3300014968 Ga0157379_10002199 Ga0157379_100021995 289
147 3300025297 Ga0209758_1000008 Ga0209758_1000008418 289
148 3300025936 Ga0207670_10004081 Ga0207670_100040816 289
149 3300026095 Ga0207676_10040204 Ga0207676_100402043 289
150 3300026116 Ga0207674_10107812 Ga0207674_101078123 289
151 3300028381 Ga0268264_10020759 Ga0268264_100207594 289
152 3300037466 Ga0395898_0069661 Ga0395898_0069661_1104_1982 289
153 3300005328 Ga0070676_10044191 Ga0070676_100441912 290
154 3300005329 Ga0070683_100089330 Ga0070683_1000893302 290
155 3300005331 Ga0070670_100163698 Ga0070670_1001636981 290
156 3300005344 Ga0070661_100091931 Ga0070661_1000919312 290
157 3300005354 Ga0070675_100029281 Ga0070675_1000292814 290
158 3300005355 Ga0070671_100056688 Ga0070671_1000566883 290
159 3300005356 Ga0070674_100032095 Ga0070674_1000320951 290
160 3300005456 Ga0070678_100051996 Ga0070678_1000519962 290
161 3300005458 Ga0070681_10267384 Ga0070681_102673841 290
162 3300005564 Ga0070664_100017240 Ga0070664_1000172405 290
163 3300005618 Ga0068864_100560336 Ga0068864_1005603362 290
164 3300005834 Ga0068851_10029067 Ga0068851_100290672 290
165 3300005841 Ga0068863_100078920 Ga0068863_1000789202 290
166 3300005842 Ga0068858_100625078 Ga0068858_1006250781 290
167 3300006237 Ga0097621_100009095 Ga0097621_1000090955 290
168 3300006358 Ga0068871_100049984 Ga0068871_1000499844 290
169 3300009174 Ga0105241_10106445 Ga0105241_101064453 290
170 3300013297 Ga0157378_10020723 Ga0157378_100207234 290
171 3300013306 Ga0163162_10005090 Ga0163162_100050905 290
172 3300013308 Ga0157375_10381310 Ga0157375_103813101 290
173 3300014969 Ga0157376_10035415 Ga0157376_100354152 290
174 3300017792 Ga0163161_10165821 Ga0163161_101658212 290
175 3300025893 Ga0207682_10014871 Ga0207682_100148713 290
176 3300025920 Ga0207649_10093859 Ga0207649_100938592 290
177 3300025925 Ga0207650_10006743 Ga0207650_100067435 290
178 3300025925 Ga0207650_10199252 Ga0207650_101992521 290
179 3300025926 Ga0207659_10007705 Ga0207659_100077052 290
180 3300025945 Ga0207679_10110417 Ga0207679_101104173 290
181 3300025960 Ga0207651_10151338 Ga0207651_101513381 290
182 3300025981 Ga0207640_10017560 Ga0207640_100175603 290
183 3300026089 Ga0207648_10042196 Ga0207648_100421962 290
184 3300026095 Ga0207676_10022515 Ga0207676_100225155 290
185 3300026121 Ga0207683_10000842 Ga0207683_100008424 290
186 3300026142 Ga0207698_10034089 Ga0207698_100340894 290
187 3300036647 Ga0316582_0172055 Ga0316582_0172055_306_1178 290
188 3300042001 Ga0439441_002537 Ga0439441_002537_1178_2068 290
189 3300045051 Ga0451576_0155652 Ga0451576_0155652_47_952 290
190 3300046461 Ga0495641_0013655 Ga0495641_0013655_3289_4164 290
191 3300046517 Ga0495630_0107980 Ga0495630_0107980_397_1272 290
192 3300046526 Ga0495666_0024962 Ga0495666_0024962_99_974 290
193 3300046533 Ga0495640_0214744 Ga0495640_0214744_290_1165 290
194 3300046642 Ga0495634_0038731 Ga0495634_0038731_1649_2524 290
195 3300046681 Ga0495647_0007191 Ga0495647_0007191_83_958 290
196 3300046683 Ga0495658_0001071 Ga0495658_0001071_11385_12260 290
197 3300046689 Ga0495613_0017529 Ga0495613_0017529_134_1009 290
198 3300047318 Ga0495636_0004573 Ga0495636_0004573_3649_4533 290
199 3300048917 Ga0496114_0238765 Ga0496114_0238765_649_1521 290

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05726

Pirin_C

Pirin C-terminal cupin domain

240

342

0.98

PF02678

Pirin

Pirin

77

185

0.94

PF17954

Pirin_C_2

Quercetinase C-terminal cupin domain

225

307

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tfq-assembly1.cif.gz_A crystal structure of the pirin family protein redox-sensitive bicupin yhak bound to copper ion from yersinia pestis 0.9905 3 282
6d0p-assembly4.cif.gz_D 1.88 angstrom resolution crystal structure of quercetin 2,3-dioxygenase from acinetobacter baumannii 0.9754 1 284
7tfq-assembly1.cif.gz_A crystal structure of the pirin family protein redox-sensitive bicupin yhak bound to copper ion from yersinia pestis 0.9733 3 282
6d0p-assembly4.cif.gz_D 1.88 angstrom resolution crystal structure of quercetin 2,3-dioxygenase from acinetobacter baumannii 0.9588 1 284
5jct-assembly1.cif.gz_A crystal structure of human pirin in complex with a chemical probe pyrrolidine 24 0.9146 1 284
ID Description Score Start End Superfamily
6d0pC02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9608 12 285 2.60.120.10
6d0pC02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9551 12 285 2.60.120.10
af_C0P2Q1_61_325_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9333 12 281 2.60.120.10
af_Q54UY3_141_293_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9291 146 281 2.60.120.10
af_Q5M827_137_273_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9198 147 280 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A3C0W432-F1-model_v4 Quercetin 2,3-dioxygenase 0.9944 38 130 GO:0051213
AF-A0A0H3GMM9-F1-model_v4 Cytoplasmic protein 0.9931 1 285 GO:0046872
AF-A0A1F4H2Y6-F1-model_v4 deleted 0.9921 1 285
AF-A0A1T4Y1G3-F1-model_v4 Quercetin 2,3-dioxygenase 0.9909 1 285 GO:0046872
AF-A0A5B9QI90-F1-model_v4 Quercetin 2,3-dioxygenase (EC 1.13.11.24) 0.9908 2 287 GO:0008127
GO:0046872

Feature Viewer

pLDDT pTM Quality
93.56 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map