F305654

General Info

Members Datasets Scaffolds Average Seq Length
199 147 152 169

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100956135|Ga0075428_1009561351
Length 188
Sequence MPTVPEPPCVAVRRVRPDDAARVRALRLEMLADSPLAFLETLDEAAARSHVEYQARIAMMATGDDRGQFVAERTPPGAGPFVGHAGGMAWPDDPLTTVIFAVYVAPAYRGTGVLGQLVAGVAAWSLAAGRPELLLEVVTGNHRALRAYQRLGFVDTGVRVPHPTIPVLTEQQLRRSAAASKAAQPTTA

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
3 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
4 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
5 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
6 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
7 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
8 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
9 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
10 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
11 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
12 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
13 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
14 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
15 2855683550 Micromonospora sp. RP3T Isolate Unclassified
16 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
17 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
18 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
19 2858868258 Micromonospora sp. MH33 Isolate Unclassified
20 2858882152 Micromonospora noduli MED15 Isolate Nodule
21 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
22 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
23 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
24 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
25 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
26 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
27 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
28 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
29 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
30 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
31 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
32 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
33 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
34 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
35 2902582711 Micromonospora sp. AP08 Isolate Unclassified
36 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
37 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
38 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
39 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
41 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
42 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
43 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
44 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
79 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
80 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
81 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
82 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
83 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
84 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
85 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
86 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
87 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
88 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
89 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
90 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
91 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
94 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
95 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
96 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
97 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
98 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
99 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
100 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
101 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
108 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
109 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
110 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
111 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
112 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
113 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
116 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
117 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
118 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
119 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
120 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
121 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
122 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
123 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
124 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
125 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
126 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
127 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
128 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
129 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
130 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
131 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
132 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
133 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
134 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
135 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
136 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
137 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
138 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
139 649633069 Micromonospora sp. L5 Isolate Unclassified
140 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
141 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
142 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
143 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
144 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
145 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
146 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
147 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.38
Metatranscriptomes 0
Isolates 23.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.54
Nodule 3.02
Rhizoplane 1.01
Rhizosphere 57.29
Stem 0
Stem Tuber 0
Unclassified 31.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10047674 3300003203 Bacteria 1458
2 JGI25406J46586_10061578 3300003203 Bacteria 1209
3 rootH1_10086052 3300003316 Bacteria 1267
4 rootH2_10120634 3300003320 Bacteria 2145
5 rootL2_10152081 3300003322 Bacteria 3722
6 Ga0070658_10164228 3300005327 Bacteria 1864
7 Ga0070683_100073019 3300005329 Bacteria 3204
8 Ga0070668_100058436 3300005347 Bacteria 2984
9 Ga0070668_100252875 3300005347 Bacteria 1463
10 Ga0070668_100460125 3300005347 Bacteria 1095
11 Ga0070669_100382512 3300005353 Bacteria 1148
12 Ga0070667_100139414 3300005367 Bacteria 2122
13 Ga0070663_100137400 3300005455 Bacteria 1862
14 Ga0070665_100268156 3300005548 Bacteria 1709
15 Ga0070665_100451598 3300005548 Bacteria 1295
16 Ga0068861_101283739 3300005719 Bacteria 711
17 Ga0068858_100055249 3300005842 Bacteria 3670
18 Ga0068860_100633510 3300005843 Bacteria 1076
19 Ga0068862_100089770 3300005844 Bacteria 2675
20 Ga0068862_101052619 3300005844 Bacteria 807
21 Ga0081539_10000205 3300005985 Bacteria 137262
22 Ga0081539_10000256 3300005985 Bacteria 122838
23 Ga0081539_10001325 3300005985 Bacteria 43208
24 Ga0081539_10003827 3300005985 Bacteria 17686
25 Ga0081539_10041948 3300005985 Bacteria 2670
26 Ga0081539_10275764 3300005985 Bacteria 734
27 Ga0075428_100023600 3300006844 Bacteria 6809
28 Ga0075428_100222333 3300006844 Bacteria 2038
29 Ga0075428_100956135 3300006844 Bacteria 908
30 Ga0075430_100002253 3300006846 Bacteria 15994
31 Ga0075430_100013255 3300006846 Bacteria 7024
32 Ga0075430_100283942 3300006846 Bacteria 1370
33 Ga0075431_100006963 3300006847 Bacteria 11246
34 Ga0075431_100326779 3300006847 Bacteria 1546
35 Ga0075429_100008851 3300006880 Bacteria 8749
36 Ga0075429_100213455 3300006880 Bacteria 1691
37 Ga0105245_10151614 3300009098 Bacteria 2192
38 Ga0114129_10022429 3300009147 Bacteria 8963
39 Ga0157372_11531655 3300013307 Bacteria 768
40 Ga0157375_10581180 3300013308 Bacteria 1280
41 Ga0157375_10671653 3300013308 Bacteria 1191
42 Ga0163163_11556646 3300014325 Bacteria 722
43 Ga0207692_10094156 3300025898 Bacteria 1631
44 Ga0207649_10417240 3300025920 Bacteria 1007
45 Ga0207689_10270965 3300025942 Bacteria 1405
46 Ga0207661_10517609 3300025944 Bacteria 1091
47 Ga0207651_11147806 3300025960 Bacteria 697
48 Ga0207668_10004263 3300025972 Bacteria 8384
49 Ga0207658_10016210 3300025986 Bacteria 5122
50 Ga0207703_10063542 3300026035 Bacteria 3027
51 Ga0207678_10080724 3300026067 Bacteria 2784
52 Ga0207675_100387558 3300026118 Bacteria 1375
53 Ga0207675_100835419 3300026118 Bacteria 935
54 Ga0207698_11176239 3300026142 Bacteria 781
55 Ga0268266_10139398 3300028379 Bacteria 2176
56 Ga0268266_10836790 3300028379 Bacteria 889
57 Ga0268265_10066632 3300028380 Bacteria 2784
58 Ga0268264_10301266 3300028381 Bacteria 1509
59 Ga0268264_10598186 3300028381 Bacteria 1087
60 Ga0307517_10056613 3300028786 Bacteria 3821
61 Ga0307517_10389263 3300028786 Bacteria 742
62 Ga0307515_10000990 3300028794 Bacteria 64910
63 Ga0307515_10057798 3300028794 Bacteria 5606
64 Ga0307512_10006478 3300030522 Bacteria 11856
65 Ga0307512_10021225 3300030522 Bacteria 5858
66 Ga0307513_10046120 3300031456 Bacteria 4757
67 Ga0307513_10306930 3300031456 Bacteria 1350
68 Ga0307513_10444626 3300031456 Bacteria 1022
69 Ga0307509_10013910 3300031507 Bacteria 9492
70 Ga0307509_10106354 3300031507 Bacteria 2824
71 Ga0307509_10137065 3300031507 Bacteria 2391
72 Ga0307408_100229205 3300031548 Bacteria 1520
73 Ga0307508_10000820 3300031616 Bacteria 36285
74 Ga0307508_10015503 3300031616 Bacteria 6943
75 Ga0307508_10118095 3300031616 Bacteria 2253
76 Ga0307508_10193725 3300031616 Bacteria 1634
77 Ga0307516_10079155 3300031730 Bacteria 3131
78 Ga0307516_10087194 3300031730 Bacteria 2956
79 Ga0307516_10122996 3300031730 Bacteria 2382
80 Ga0307516_10243275 3300031730 Bacteria 1497
81 Ga0307516_10243669 3300031730 Bacteria 1495
82 Ga0307413_10203130 3300031824 Bacteria 1433
83 Ga0307413_11005002 3300031824 Bacteria 715
84 Ga0307410_10042676 3300031852 Bacteria 3000
85 Ga0326468_10000361 3300031889 Bacteria 4813
86 Ga0307406_10034882 3300031901 Bacteria 3089
87 Ga0307406_10675982 3300031901 Bacteria 860
88 Ga0307406_10865544 3300031901 Bacteria 767
89 Ga0307406_11352974 3300031901 Bacteria 623
90 Ga0307407_10137031 3300031903 Bacteria 1574
91 Ga0307409_100025755 3300031995 Bacteria 4133
92 Ga0307416_100929366 3300032002 Bacteria 971
93 Ga0307416_101277336 3300032002 Bacteria 840
94 Ga0307411_10425116 3300032005 Bacteria 1105
95 Ga0307510_10153344 3300033180 Bacteria 1917
96 Ga0373938_0060076 3300034957 Bacteria 887
97 Ga0373940_0125173 3300035088 Bacteria 800
98 Ga0373951_0000012 3300035091 Bacteria 73071
99 Ga0373939_0157277 3300035114 Bacteria 832
100 Ga0373942_0002072 3300035207 Bacteria 4992
101 Ga0373935_0004251 3300035692 Bacteria 8399
102 Ga0373937_0345556 3300036401 Bacteria 1409
103 Ga0395899_0083091 3300037312 Bacteria 2329
104 Ga0395899_0117874 3300037312 Bacteria 1904
105 Ga0395899_0208782 3300037312 Bacteria 1358
106 Ga0395900_0069060 3300037418 Bacteria 3631
107 Ga0395900_0074994 3300037418 Bacteria 3477
108 Ga0395898_0079172 3300037466 Bacteria 3170
109 Ga0395898_0200134 3300037466 Bacteria 1907
110 Ga0395905_0060042 3300037471 Bacteria 3555
111 Ga0395905_0746605 3300037471 Bacteria 881
112 Ga0395901_0004351 3300038443 Bacteria 14289
113 Ga0395901_0341316 3300038443 Bacteria 1547
114 Ga0451797_0081967 3300041453 Bacteria 694
115 Ga0451835_0973105 3300041492 Bacteria 685
116 Ga0451835_1242584 3300041492 Bacteria 640
117 Ga0451849_0879013 3300041505 Bacteria 709
118 Ga0451843_1533643 3300041509 Bacteria 622
119 Ga0451853_1780732 3300041512 Bacteria 3759
120 Ga0451853_3030795 3300041512 Bacteria 1113
121 Ga0439463_041199 3300042016 Bacteria 1174
122 Ga0466960_1048787 3300044901 Bacteria 502
123 Ga0466967_0071816 3300045976 Bacteria 3100
124 Ga0495632_0041749 3300046519 Bacteria 2303
125 Ga0495632_0068037 3300046519 Bacteria 1717
126 Ga0495670_0325678 3300046691 Bacteria 825
127 Ga0496108_0000053 3300048911 Bacteria 125641
128 Ga0496117_0000071 3300048920 Bacteria 242170
129 Ga0496123_0402026 3300048926 Bacteria 623
130 Ga0496126_0109253 3300048929 Bacteria 2410
131 Ga0501042_0920640 3300049578 Unclassified 637
132 nmdc:mga05p37_21548_c1 3300050507 Bacteria 7809
133 nmdc:mga09592_3804_c1 3300050508 Bacteria 12149
134 nmdc:mga0qj67_1414_c1 3300050509 Bacteria 16794
135 nmdc:mga0qj67_31946_c1 3300050509 Bacteria 4104
136 nmdc:mga06r32_357847_c1 3300050510 Bacteria 1444
137 nmdc:mga06r32_37626_c1 3300050510 Bacteria 4578
138 nmdc:mga0sz30_582143_c1 3300050516 Unclassified 506
139 Ga0500644_0020694 3300053088 Bacteria 1960
140 Ga0500644_0032656 3300053088 Bacteria 1665
141 Ga0500644_0148268 3300053088 Bacteria 938
142 Ga0500646_0034125 3300053090 Bacteria 1410
143 Ga0500651_0071769 3300053093 Bacteria 2154
144 Ga0500641_0266439 3300053096 Bacteria 714
145 Ga0500569_096283 3300053109 Bacteria 965
146 Ga0500594_0038249 3300053118 Bacteria 1299
147 Ga0500658_0557525 3300053134 Bacteria 515
148 Ga0500579_079671 3300053143 Bacteria 1840
149 Ga0500600_0042736 3300053149 Bacteria 2609
150 Ga0500616_0000233 3300053153 Bacteria 87378
151 Ga0500611_116795 3300053727 Bacteria 707
152 Ga0500645_002451 3300053730 Bacteria 8239

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025942 Ga0207689_10270965 Ga0207689_102709652 136
2 3300048926 Ga0496123_0402026 Ga0496123_0402026_172_609 142
3 3300050516 nmdc:mga0sz30_582143_c1 nmdc:mga0sz30_582143_c1_43_483 142
4 3300048929 Ga0496126_0109253 Ga0496126_0109253_294_959 143
5 3300005367 Ga0070667_100139414 Ga0070667_1001394143 144
6 3300005842 Ga0068858_100055249 Ga0068858_1000552493 144
7 3300025986 Ga0207658_10016210 Ga0207658_100162102 144
8 3300026035 Ga0207703_10063542 Ga0207703_100635422 144
9 3300044901 Ga0466960_1048787 Ga0466960_1048787_17_451 144
10 3300053134 Ga0500658_0557525 Ga0500658_0557525_12_446 144
11 3300041492 Ga0451835_0973105 Ga0451835_0973105_64_519 149
12 3300003203 JGI25406J46586_10061578 JGI25406J46586_100615782 151
13 3300005985 Ga0081539_10000256 Ga0081539_1000025618 151
14 3300025920 Ga0207649_10417240 Ga0207649_104172401 151
15 3300031456 Ga0307513_10306930 Ga0307513_103069302 151
16 3300041505 Ga0451849_0879013 Ga0451849_0879013_145_603 151
17 3300041512 Ga0451853_1780732 Ga0451853_1780732_1045_1503 151
18 3300046519 Ga0495632_0068037 Ga0495632_0068037_655_1116 151
19 3300050509 nmdc:mga0qj67_1414_c1 nmdc:mga0qj67_1414_c1_6251_6745 153
20 iso_pu_bacteria 2858902515 2858902701 155
21 3300028794 Ga0307515_10000990 Ga0307515_1000099052 158
22 iso_pu_bacteria 2866065130 2866066943 158
23 3300006846 Ga0075430_100002253 Ga0075430_10000225313 160
24 3300009098 Ga0105245_10151614 Ga0105245_101516143 160
25 3300031507 Ga0307509_10106354 Ga0307509_101063541 160
26 3300031730 Ga0307516_10087194 Ga0307516_100871942 160
27 iso_pu_bacteria 2862993130 2862993803 161
28 3300053109 Ga0500569_096283 Ga0500569_096283_33_521 162
29 3300006846 Ga0075430_100283942 Ga0075430_1002839422 163
30 3300006847 Ga0075431_100326779 Ga0075431_1003267792 163
31 3300006880 Ga0075429_100213455 Ga0075429_1002134553 163
32 3300050510 nmdc:mga06r32_357847_c1 nmdc:mga06r32_357847_c1_201_692 163
33 iso_pu_bacteria 2751185782 2753270039 163
34 3300005985 Ga0081539_10001325 Ga0081539_1000132510 166
35 3300053730 Ga0500645_002451 Ga0500645_002451_5879_6385 166
36 3300003320 rootH2_10120634 rootH2_101206342 167
37 3300003322 rootL2_10152081 rootL2_101520812 167
38 3300005327 Ga0070658_10164228 Ga0070658_101642282 167
39 3300005329 Ga0070683_100073019 Ga0070683_1000730193 167
40 3300005347 Ga0070668_100058436 Ga0070668_1000584362 167
41 3300005347 Ga0070668_100460125 Ga0070668_1004601252 167
42 3300005353 Ga0070669_100382512 Ga0070669_1003825122 167
43 3300005548 Ga0070665_100268156 Ga0070665_1002681562 167
44 3300005548 Ga0070665_100451598 Ga0070665_1004515982 167
45 3300005719 Ga0068861_101283739 Ga0068861_1012837392 167
46 3300005843 Ga0068860_100633510 Ga0068860_1006335102 167
47 3300005844 Ga0068862_100089770 Ga0068862_1000897703 167
48 3300005844 Ga0068862_101052619 Ga0068862_1010526192 167
49 3300006844 Ga0075428_100023600 Ga0075428_1000236003 167
50 3300006846 Ga0075430_100013255 Ga0075430_1000132554 167
51 3300006847 Ga0075431_100006963 Ga0075431_1000069639 167
52 3300006880 Ga0075429_100008851 Ga0075429_1000088517 167
53 3300009147 Ga0114129_10022429 Ga0114129_100224292 167
54 3300013307 Ga0157372_11531655 Ga0157372_115316552 167
55 3300013308 Ga0157375_10671653 Ga0157375_106716532 167
56 3300025898 Ga0207692_10094156 Ga0207692_100941562 167
57 3300025944 Ga0207661_10517609 Ga0207661_105176092 167
58 3300025960 Ga0207651_11147806 Ga0207651_111478061 167
59 3300025972 Ga0207668_10004263 Ga0207668_100042636 167
60 3300026118 Ga0207675_100387558 Ga0207675_1003875581 167
61 3300026118 Ga0207675_100835419 Ga0207675_1008354191 167
62 3300026142 Ga0207698_11176239 Ga0207698_111762391 167
63 3300028379 Ga0268266_10139398 Ga0268266_101393982 167
64 3300028379 Ga0268266_10836790 Ga0268266_108367902 167
65 3300028380 Ga0268265_10066632 Ga0268265_100666323 167
66 3300028381 Ga0268264_10301266 Ga0268264_103012662 167
67 3300028381 Ga0268264_10598186 Ga0268264_105981862 167
68 3300031507 Ga0307509_10013910 Ga0307509_100139105 167
69 3300031616 Ga0307508_10000820 Ga0307508_1000082018 167
70 3300031824 Ga0307413_10203130 Ga0307413_102031302 167
71 3300035088 Ga0373940_0125173 Ga0373940_0125173_34_543 167
72 3300035114 Ga0373939_0157277 Ga0373939_0157277_156_668 167
73 3300035207 Ga0373942_0002072 Ga0373942_0002072_3997_4506 167
74 3300035692 Ga0373935_0004251 Ga0373935_0004251_1020_1529 167
75 3300041453 Ga0451797_0081967 Ga0451797_0081967_106_615 167
76 3300041509 Ga0451843_1533643 Ga0451843_1533643_68_571 167
77 3300050507 nmdc:mga05p37_21548_c1 nmdc:mga05p37_21548_c1_4785_5288 167
78 3300050508 nmdc:mga09592_3804_c1 nmdc:mga09592_3804_c1_2904_3407 167
79 3300050509 nmdc:mga0qj67_31946_c1 nmdc:mga0qj67_31946_c1_2904_3407 167
80 3300050510 nmdc:mga06r32_37626_c1 nmdc:mga06r32_37626_c1_379_882 167
81 iso_pu_bacteria 2501939600 2501944909 167
82 iso_pu_bacteria 2855683550 2855687468 167
83 iso_pu_bacteria 2856858025 2856859225 167
84 iso_pu_bacteria 649633069 649812906 167
85 3300036401 Ga0373937_0345556 Ga0373937_0345556_564_1070 168
86 3300048920 Ga0496117_0000071 Ga0496117_0000071_50484_51008 168
87 iso_pu_bacteria 2858868258 2858870183 168
88 iso_pu_bacteria 2902582711 2902584596 168
89 3300037312 Ga0395899_0117874 Ga0395899_0117874_652_1206 169
90 3300034957 Ga0373938_0060076 Ga0373938_0060076_148_669 170
91 3300037312 Ga0395899_0083091 Ga0395899_0083091_1644_2156 170
92 3300037418 Ga0395900_0069060 Ga0395900_0069060_2944_3456 170
93 3300037466 Ga0395898_0079172 Ga0395898_0079172_529_1041 170
94 3300037471 Ga0395905_0060042 Ga0395905_0060042_303_815 170
95 3300038443 Ga0395901_0004351 Ga0395901_0004351_3347_3859 170
96 3300046691 Ga0495670_0325678 Ga0495670_0325678_274_804 170
97 3300053153 Ga0500616_0000233 Ga0500616_0000233_22175_22705 170
98 3300031901 Ga0307406_10865544 Ga0307406_108655441 171
99 3300031903 Ga0307407_10137031 Ga0307407_101370313 171
100 3300032005 Ga0307411_10425116 Ga0307411_104251162 171
101 iso_pu_bacteria 2622736626 2623585299 171
102 3300005347 Ga0070668_100252875 Ga0070668_1002528752 172
103 3300005455 Ga0070663_100137400 Ga0070663_1001374002 172
104 3300013308 Ga0157375_10581180 Ga0157375_105811802 172
105 3300014325 Ga0163163_11556646 Ga0163163_115566462 172
106 3300026067 Ga0207678_10080724 Ga0207678_100807242 172
107 3300028794 Ga0307515_10057798 Ga0307515_100577983 172
108 3300031730 Ga0307516_10243669 Ga0307516_102436692 172
109 3300031824 Ga0307413_11005002 Ga0307413_110050021 172
110 3300031852 Ga0307410_10042676 Ga0307410_100426764 172
111 3300031901 Ga0307406_10675982 Ga0307406_106759821 172
112 3300032002 Ga0307416_100929366 Ga0307416_1009293661 172
113 3300032002 Ga0307416_101277336 Ga0307416_1012773361 172
114 3300049578 Ga0501042_0920640 Ga0501042_0920640_15_533 172
115 3300053088 Ga0500644_0032656 Ga0500644_0032656_330_848 172
116 3300053088 Ga0500644_0148268 Ga0500644_0148268_225_755 172
117 iso_pu_bacteria 2772190715 2772645418 172
118 iso_pu_bacteria 2831935698 2831937171 172
119 iso_pu_bacteria 2832004796 2832010132 172
120 iso_pu_bacteria 2855670206 2855674829 172
121 iso_pu_bacteria 2855676851 2855679386 172
122 iso_pu_bacteria 2857288857 2857290153 172
123 iso_pu_bacteria 2858848962 2858850128 172
124 iso_pu_bacteria 2858882152 2858885618 172
125 iso_pu_bacteria 2858888857 2858893890 172
126 iso_pu_bacteria 2858895516 2858900240 172
127 iso_pu_bacteria 2867302475 2867306041 172
128 iso_pu_bacteria 2867312974 2867317241 172
129 iso_pu_bacteria 2867319477 2867323058 172
130 iso_pu_bacteria 2867507094 2867510661 172
131 iso_pu_bacteria 2869048445 2869053854 172
132 iso_pu_bacteria 2869061728 2869063806 172
133 iso_pu_bacteria 2869068681 2869075011 172
134 iso_pu_bacteria 2880489317 2880494936 172
135 iso_pu_bacteria 2880495981 2880497396 172
136 iso_pu_bacteria 2929219909 2929225957 172
137 iso_pu_bacteria 2929226422 2929232618 172
138 iso_pu_bacteria 2996221748 2996222030 172
139 iso_pu_bacteria 8003830390 8003831219 172
140 iso_pu_bacteria 8003870546 8003876424 172
141 iso_pu_bacteria 8054704163 8054704290 172
142 iso_pu_bacteria 8054727385 8054731620 172
143 iso_pu_bacteria 8054734606 8054739936 172
144 iso_pu_bacteria 8057345674 8057346204 172
145 3300003316 rootH1_10086052 rootH1_100860522 173
146 3300005985 Ga0081539_10003827 Ga0081539_100038273 173
147 3300005985 Ga0081539_10275764 Ga0081539_102757641 173
148 3300006844 Ga0075428_100222333 Ga0075428_1002223333 173
149 3300006844 Ga0075428_100956135 Ga0075428_1009561351 173
150 3300028786 Ga0307517_10056613 Ga0307517_100566132 173
151 3300028786 Ga0307517_10389263 Ga0307517_103892631 173
152 3300030522 Ga0307512_10006478 Ga0307512_100064782 173
153 3300030522 Ga0307512_10021225 Ga0307512_100212251 173
154 3300031456 Ga0307513_10046120 Ga0307513_100461203 173
155 3300031456 Ga0307513_10444626 Ga0307513_104446262 173
156 3300031507 Ga0307509_10137065 Ga0307509_101370652 173
157 3300031548 Ga0307408_100229205 Ga0307408_1002292052 173
158 3300031616 Ga0307508_10015503 Ga0307508_100155033 173
159 3300031616 Ga0307508_10118095 Ga0307508_101180952 173
160 3300031616 Ga0307508_10193725 Ga0307508_101937253 173
161 3300031730 Ga0307516_10079155 Ga0307516_100791551 173
162 3300031730 Ga0307516_10122996 Ga0307516_101229961 173
163 3300031730 Ga0307516_10243275 Ga0307516_102432751 173
164 3300031889 Ga0326468_10000361 Ga0326468_100003614 173
165 3300031901 Ga0307406_10034882 Ga0307406_100348823 173
166 3300031995 Ga0307409_100025755 Ga0307409_1000257553 173
167 3300033180 Ga0307510_10153344 Ga0307510_101533443 173
168 3300035091 Ga0373951_0000012 Ga0373951_0000012_9860_10384 173
169 3300037312 Ga0395899_0208782 Ga0395899_0208782_109_630 173
170 3300037418 Ga0395900_0074994 Ga0395900_0074994_2095_2616 173
171 3300037466 Ga0395898_0200134 Ga0395898_0200134_758_1279 173
172 3300037471 Ga0395905_0746605 Ga0395905_0746605_51_572 173
173 3300038443 Ga0395901_0341316 Ga0395901_0341316_320_841 173
174 3300041492 Ga0451835_1242584 Ga0451835_1242584_106_630 173
175 3300041512 Ga0451853_3030795 Ga0451853_3030795_350_880 173
176 3300042016 Ga0439463_041199 Ga0439463_041199_531_1052 173
177 3300045976 Ga0466967_0071816 Ga0466967_0071816_1354_1875 173
178 3300046519 Ga0495632_0041749 Ga0495632_0041749_563_1087 173
179 3300048911 Ga0496108_0000053 Ga0496108_0000053_36443_36988 173
180 3300053088 Ga0500644_0020694 Ga0500644_0020694_918_1442 173
181 3300053090 Ga0500646_0034125 Ga0500646_0034125_630_1154 173
182 3300053093 Ga0500651_0071769 Ga0500651_0071769_1448_1972 173
183 3300053096 Ga0500641_0266439 Ga0500641_0266439_30_554 173
184 3300053118 Ga0500594_0038249 Ga0500594_0038249_498_1022 173
185 3300053143 Ga0500579_079671 Ga0500579_079671_955_1479 173
186 3300053149 Ga0500600_0042736 Ga0500600_0042736_1424_1948 173
187 3300053727 Ga0500611_116795 Ga0500611_116795_52_576 173
188 iso_pu_bacteria 2515154088 2515495405 173
189 iso_pu_bacteria 2515154129 2515720194 173
190 iso_pu_bacteria 2515154137 2515758223 173
191 iso_pu_bacteria 2515154202 2516084485 173
192 iso_pu_bacteria 2515154203 2516089567 173
193 iso_pu_bacteria 2675903059 2676485006 173
194 iso_pu_bacteria 8003856774 8003861127 173
195 iso_pu_bacteria 8055412473 8055412699 173
196 3300003203 JGI25406J46586_10047674 JGI25406J46586_100476741 174
197 3300005985 Ga0081539_10000205 Ga0081539_1000020559 174
198 3300005985 Ga0081539_10041948 Ga0081539_100419482 174
199 3300031901 Ga0307406_11352974 Ga0307406_113529741 174

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

29

153

0.84

PF08445

FR47

FR47-like protein

85

160

0.84

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

10

154

0.74

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

64

155

0.66

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ypu-assembly2.cif.gz_D orfe-coa-glycylthricin complex 0.8864 65 174
5c82-assembly1.cif.gz_A-2 crystal structure of nourseothricin acetyltransferase 0.8849 67 173
7ypu-assembly4.cif.gz_G orfe-coa-glycylthricin complex 0.8821 67 174
7ypu-assembly1.cif.gz_A orfe-coa-glycylthricin complex 0.876 63 174
3pp9-assembly2.cif.gz_C 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.8748 60 174
ID Description Score Start End Superfamily
af_A0A286YBP0_57_178_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8948 63 157 3.40.630.30
3v8hC00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.8898 129 174 3.30.572.10
af_Q54U46_65_201_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8897 78 161 3.40.630.30
af_C0H4R5_74_225_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8807 78 174 3.40.630.30
af_Q6H820_22_180_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8681 66 146 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A537J9X6-F1-model_v4 GNAT family N-acetyltransferase 0.9612 63 173 GO:0016747
AF-A0A260R2L0-F1-model_v4 deleted 0.9506 14 173
AF-A0A2P2FQJ5-F1-model_v4 Acetyltransferase 0.9415 11 173 GO:0016747
AF-A0A2V7PTP7-F1-model_v4 GNAT family N-acetyltransferase 0.9368 8 173 GO:0016747
AF-A0A7X7D547-F1-model_v4 GNAT family N-acetyltransferase 0.9339 11 174 GO:0016747

Feature Viewer

pLDDT pTM Quality
91.71 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map