F305594

General Info

Members Datasets Scaffolds Average Seq Length
199 143 398 147

Family's Representative Sequence

Representative Sequence 3300005842|Ga0068858_100255492|Ga0068858_1002554922
Length 158
Sequence MTPSEATPPQEPAAQDGLAIRLTEAPFDPGALLGAFAAGRTETGAVATFTGLARGETLELEAYPGFTEAEIGRIAEQARARFDLHGVMILHRVGRIAPGEPIVFVATAASHRRAAFEACDFLMDYLKSRAPFWKKEHGPGGARWIEPTAQDHADRDRW

Samples

Sample ID Description Type Environment
1 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
2 3300003502 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM Metagenome Rhizosphere
3 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
4 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
39 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
40 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
41 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
76 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
77 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
78 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
79 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
80 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
81 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
82 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
83 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
84 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
85 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
86 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
87 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
88 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
89 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
90 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
91 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
92 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
93 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
94 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
95 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
96 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
97 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
98 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
99 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
100 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
101 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
102 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
103 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
104 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
105 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
106 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
107 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
108 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
109 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
110 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
111 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
115 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
116 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
118 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
119 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
120 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
121 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
122 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
123 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
124 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
125 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
126 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
127 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
128 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
129 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
130 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
131 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
132 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
133 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
134 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
135 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
136 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
137 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
138 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
139 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
140 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
141 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
142 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
143 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.6
Nodule 0
Rhizoplane 1.01
Rhizosphere 73.37
Stem 0
Stem Tuber 0
Unclassified 1.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068858_100255492 3300005842 Bacteria 1665
2 JGI26143J51219_1003873 3300003502 Bacteria 705
3 Ga0055530_10000803 3300003791 Bacteria 26071
4 Ga0055540_1034655 3300003792 Bacteria 1134
5 Ga0070658_10503092 3300005327 Bacteria 1047
6 Ga0070670_100000007 3300005331 Bacteria 318672
7 Ga0070677_10000162 3300005333 Bacteria 22856
8 Ga0068869_100585266 3300005334 Bacteria 941
9 Ga0070666_10184286 3300005335 Bacteria 1465
10 Ga0070692_10000049 3300005345 Bacteria 22402
11 Ga0070668_100000129 3300005347 Bacteria 47127
12 Ga0070668_100000860 3300005347 Bacteria 21102
13 Ga0070667_100000293 3300005367 Bacteria 56352
14 Ga0070667_100045488 3300005367 Bacteria 3691
15 Ga0070681_10113884 3300005458 Bacteria 2643
16 Ga0070681_10276748 3300005458 Bacteria 1590
17 Ga0070698_100436677 3300005471 Bacteria 1244
18 Ga0070679_100354548 3300005530 Bacteria 1414
19 Ga0068853_100227297 3300005539 Bacteria 1706
20 Ga0070665_100000689 3300005548 Bacteria 45116
21 Ga0070665_100000692 3300005548 Bacteria 44982
22 Ga0068855_100043889 3300005563 Bacteria 5294
23 Ga0068855_100169204 3300005563 Bacteria 2475
24 Ga0068857_100190522 3300005577 Bacteria 1868
25 Ga0068856_100894226 3300005614 Bacteria 907
26 Ga0068852_100060226 3300005616 Bacteria 3295
27 Ga0068859_100016476 3300005617 Bacteria 7423
28 Ga0068864_100000225 3300005618 Bacteria 51133
29 Ga0068864_100237982 3300005618 Bacteria 1686
30 Ga0068863_100005029 3300005841 Bacteria 13036
31 Ga0068858_100025069 3300005842 Bacteria 5550
32 Ga0068860_100000047 3300005843 Bacteria 213287
33 Ga0068862_100000396 3300005844 Bacteria 47054
34 Ga0068862_100024666 3300005844 Bacteria 5047
35 Ga0097620_100016477 3300006931 Bacteria 7423
36 Ga0105240_10044701 3300009093 Bacteria 5625
37 Ga0105242_10064523 3300009176 Bacteria 3019
38 Ga0105248_10056770 3300009177 Bacteria 4393
39 Ga0105248_10194521 3300009177 Bacteria 2285
40 Ga0105238_10179285 3300009551 Bacteria 2095
41 Ga0105238_10207802 3300009551 Bacteria 1934
42 Ga0105249_10000550 3300009553 Bacteria 34737
43 Ga0105249_10247729 3300009553 Bacteria 1765
44 Ga0157370_10357001 3300013104 Bacteria 1347
45 Ga0157369_10244486 3300013105 Bacteria 1874
46 Ga0157369_10410315 3300013105 Bacteria 1405
47 Ga0163162_12030598 3300013306 Bacteria 659
48 Ga0157372_12521996 3300013307 Bacteria 590
49 Ga0163163_10829254 3300014325 Bacteria 988
50 Ga0157380_10606354 3300014326 Bacteria 1084
51 Ga0157379_10013057 3300014968 Bacteria 7273
52 Ga0157379_10461594 3300014968 Bacteria 1174
53 Ga0157379_10464626 3300014968 Bacteria 1170
54 Ga0213872_10004183 3300021361 Bacteria 7759
55 Ga0209676_1000376 3300025292 Bacteria 82203
56 Ga0209050_1000737 3300025298 Bacteria 47468
57 Ga0209051_1000637 3300025303 Bacteria 40331
58 Ga0209257_1003447 3300025304 Bacteria 13566
59 Ga0207697_10337415 3300025315 Bacteria 669
60 Ga0207682_10001303 3300025893 Bacteria 11447
61 Ga0207680_10003976 3300025903 Bacteria 6979
62 Ga0207680_10318247 3300025903 Bacteria 1087
63 Ga0207707_10180214 3300025912 Bacteria 1845
64 Ga0207707_10187270 3300025912 Bacteria 1806
65 Ga0207695_10000837 3300025913 Bacteria 56634
66 Ga0207695_10012685 3300025913 Bacteria 10093
67 Ga0207660_10121019 3300025917 Bacteria 1982
68 Ga0207660_10544699 3300025917 Bacteria 943
69 Ga0207652_10174947 3300025921 Bacteria 1927
70 Ga0207694_10066733 3300025924 Bacteria 2807
71 Ga0207650_10000030 3300025925 Bacteria 235824
72 Ga0207706_10101232 3300025933 Bacteria 2535
73 Ga0207711_10000998 3300025941 Bacteria 27132
74 Ga0207667_10250378 3300025949 Bacteria 1812
75 Ga0207667_10787704 3300025949 Bacteria 948
76 Ga0207712_10000941 3300025961 Bacteria 21018
77 Ga0207712_10175344 3300025961 Bacteria 1679
78 Ga0207668_10000042 3300025972 Bacteria 103877
79 Ga0207668_10000197 3300025972 Bacteria 41484
80 Ga0207658_10000318 3300025986 Bacteria 48562
81 Ga0207658_10024400 3300025986 Bacteria 4231
82 Ga0207703_10017231 3300026035 Bacteria 5638
83 Ga0207703_10202087 3300026035 Bacteria 1766
84 Ga0207639_10278369 3300026041 Bacteria 1470
85 Ga0207639_10867161 3300026041 Bacteria 843
86 Ga0207678_10390856 3300026067 Bacteria 1203
87 Ga0207641_10000532 3300026088 Bacteria 42714
88 Ga0207676_10000227 3300026095 Bacteria 48869
89 Ga0207676_10190711 3300026095 Bacteria 1803
90 Ga0207698_10059086 3300026142 Bacteria 2975
91 Ga0207698_10651913 3300026142 Bacteria 1043
92 Ga0209996_1012677 3300027395 Bacteria 1134
93 Ga0209995_1001947 3300027471 Bacteria 3231
94 Ga0209982_1003799 3300027552 Bacteria 2157
95 Ga0209970_1002714 3300027614 Bacteria 2990
96 Ga0209983_1003503 3300027665 Bacteria 3345
97 Ga0209971_1001307 3300027682 Bacteria 6193
98 Ga0268266_10000705 3300028379 Bacteria 45155
99 Ga0268266_10002241 3300028379 Bacteria 21062
100 Ga0268265_10000661 3300028380 Bacteria 34194
101 Ga0268265_10012679 3300028380 Bacteria 5720
102 Ga0268264_10000205 3300028381 Bacteria 120743
103 Ga0268264_10156420 3300028381 Bacteria 2049
104 Ga0265327_10000757 3300031251 Bacteria 50106
105 Ga0307408_100518943 3300031548 Bacteria 1046
106 Ga0307408_100893746 3300031548 Bacteria 813
107 Ga0307413_10117310 3300031824 Bacteria 1795
108 Ga0307413_10486708 3300031824 Bacteria 987
109 Ga0307409_100368342 3300031995 Bacteria 1362
110 Ga0307416_100172448 3300032002 Bacteria 2016
111 Ga0307416_100182882 3300032002 Bacteria 1967
112 Ga0307414_10505514 3300032004 Bacteria 1070
113 Ga0307414_10557657 3300032004 Bacteria 1022
114 Ga0307414_10564193 3300032004 Bacteria 1016
115 Ga0307414_10603438 3300032004 Bacteria 984
116 Ga0307415_101382343 3300032126 Bacteria 670
117 Ga0307415_101867902 3300032126 Unclassified 582
118 Ga0307510_10196223 3300033180 Bacteria 1560
119 Ga0373927_0361529 3300035695 Bacteria 957
120 Ga0373933_0148587 3300035724 Bacteria 1483
121 Ga0436364_1480844 3300037853 Bacteria 1341
122 Ga0436361_0512620 3300039447 Bacteria 7635
123 Ga0436363_0664855 3300039450 Bacteria 1078
124 Ga0436363_1182881 3300039450 Bacteria 1018
125 Ga0436363_1205711 3300039450 Bacteria 730
126 Ga0466967_0033277 3300045976 Bacteria 4362
127 Ga0466967_0295198 3300045976 Bacteria 1558
128 Ga0466967_1921389 3300045976 Unclassified 589
129 Ga0495639_0338658 3300046475 Bacteria 754
130 Ga0495584_0226628 3300046491 Bacteria 950
131 Ga0495583_0058671 3300046506 Bacteria 1727
132 Ga0495620_0024684 3300046515 Bacteria 2855
133 Ga0495631_0075304 3300046518 Bacteria 1457
134 Ga0495631_0241617 3300046518 Bacteria 770
135 Ga0495643_0007089 3300046522 Bacteria 7274
136 Ga0495654_0027056 3300046530 Bacteria 2943
137 Ga0495609_0018393 3300046538 Bacteria 3238
138 Ga0495597_0007402 3300046542 Bacteria 5577
139 Ga0495622_0024769 3300046557 Bacteria 2802
140 Ga0495668_0058296 3300046616 Bacteria 2131
141 Ga0495625_0052503 3300046660 Bacteria 2919
142 Ga0495625_0055112 3300046660 Bacteria 2837
143 Ga0495669_0000014 3300046684 Bacteria 140832
144 Ga0495669_0000322 3300046684 Bacteria 26232
145 Ga0495687_015059 3300047443 Bacteria 3947
146 Ga0495677_0019757 3300047445 Bacteria 2442
147 Ga0495677_0025441 3300047445 Bacteria 2147
148 Ga0495593_0079847 3300047673 Bacteria 1693
149 Ga0496106_0002485 3300048909 Bacteria 13733
150 Ga0496106_0575427 3300048909 Bacteria 903
151 Ga0496117_0139883 3300048920 Bacteria 1452
152 Ga0496118_0427403 3300048921 Bacteria 679
153 Ga0496119_0133557 3300048922 Bacteria 1349
154 Ga0496121_0000334 3300048924 Bacteria 98442
155 Ga0496124_0291281 3300048927 Bacteria 1185
156 Ga0501034_0188332 3300049571 Bacteria 2026
157 Ga0501043_0422341 3300049579 Bacteria 1005
158 Ga0501048_0635751 3300049582 Bacteria 766
159 Ga0501070_0968273 3300049586 Bacteria 661
160 Ga0501073_1123992 3300049589 Bacteria 540
161 Ga0501035_0263705 3300049822 Bacteria 1460
162 Ga0501044_0033285 3300049823 Bacteria 5417
163 Ga0501044_0365123 3300049823 Bacteria 1361
164 Ga0501044_0377635 3300049823 Bacteria 1333
165 nmdc:mga0sz30_91063_c1 3300050516 Bacteria 1327
166 Ga0500578_0146868 3300053086 Bacteria 1471
167 Ga0500643_000968 3300053087 Bacteria 17812
168 Ga0500643_011198 3300053087 Bacteria 3286
169 Ga0500643_012828 3300053087 Bacteria 2987
170 Ga0500643_064588 3300053087 Bacteria 1023
171 Ga0500646_0044444 3300053090 Bacteria 1261
172 Ga0500651_0068591 3300053093 Bacteria 2208
173 Ga0500566_0117066 3300053094 Bacteria 1441
174 Ga0500641_0000623 3300053096 Bacteria 12805
175 Ga0500641_0000654 3300053096 Bacteria 12478
176 Ga0500641_0016438 3300053096 Bacteria 2755
177 Ga0500556_0001771 3300053104 Bacteria 8077
178 Ga0500556_0005318 3300053104 Bacteria 3640
179 Ga0500562_006813 3300053108 Bacteria 2882
180 Ga0500562_011122 3300053108 Bacteria 2284
181 Ga0500572_047636 3300053111 Bacteria 1267
182 Ga0500595_002363 3300053119 Bacteria 9424
183 Ga0500608_001746 3300053122 Bacteria 7762
184 Ga0500614_006437 3300053123 Bacteria 2470
185 Ga0500642_0195877 3300053130 Bacteria 941
186 Ga0500658_0422530 3300053134 Bacteria 609
187 Ga0500559_0011233 3300053136 Bacteria 3827
188 Ga0500590_005058 3300053148 Bacteria 6314
189 Ga0500604_0084603 3300053151 Bacteria 1029
190 Ga0500616_0022871 3300053153 Bacteria 3488
191 Ga0500620_110459 3300053155 Bacteria 963
192 Ga0500622_0008525 3300053156 Bacteria 5727
193 Ga0500622_0025800 3300053156 Bacteria 3103
194 Ga0500622_0191496 3300053156 Bacteria 937
195 Ga0500636_0033015 3300053177 Bacteria 3065
196 Ga0500576_064698 3300053725 Bacteria 1589
197 Ga0500625_075098 3300053729 Bacteria 1492
198 Ga0500645_000730 3300053730 Bacteria 20251
199 Ga0500596_002130 3300053735 Bacteria 3936
200 Ga0068858_100255492
201 JGI26143J51219_1003873
202 Ga0055530_10000803
203 Ga0055540_1034655
204 Ga0070658_10503092
205 Ga0070670_100000007
206 Ga0070677_10000162
207 Ga0068869_100585266
208 Ga0070666_10184286
209 Ga0070692_10000049
210 Ga0070668_100000129
211 Ga0070668_100000860
212 Ga0070667_100000293
213 Ga0070667_100045488
214 Ga0070681_10113884
215 Ga0070681_10276748
216 Ga0070698_100436677
217 Ga0070679_100354548
218 Ga0068853_100227297
219 Ga0070665_100000689
220 Ga0070665_100000692
221 Ga0068855_100043889
222 Ga0068855_100169204
223 Ga0068857_100190522
224 Ga0068856_100894226
225 Ga0068852_100060226
226 Ga0068859_100016476
227 Ga0068864_100000225
228 Ga0068864_100237982
229 Ga0068863_100005029
230 Ga0068858_100025069
231 Ga0068860_100000047
232 Ga0068862_100000396
233 Ga0068862_100024666
234 Ga0097620_100016477
235 Ga0105240_10044701
236 Ga0105242_10064523
237 Ga0105248_10056770
238 Ga0105248_10194521
239 Ga0105238_10179285
240 Ga0105238_10207802
241 Ga0105249_10000550
242 Ga0105249_10247729
243 Ga0157370_10357001
244 Ga0157369_10244486
245 Ga0157369_10410315
246 Ga0163162_12030598
247 Ga0157372_12521996
248 Ga0163163_10829254
249 Ga0157380_10606354
250 Ga0157379_10013057
251 Ga0157379_10461594
252 Ga0157379_10464626
253 Ga0213872_10004183
254 Ga0209676_1000376
255 Ga0209050_1000737
256 Ga0209051_1000637
257 Ga0209257_1003447
258 Ga0207697_10337415
259 Ga0207682_10001303
260 Ga0207680_10003976
261 Ga0207680_10318247
262 Ga0207707_10180214
263 Ga0207707_10187270
264 Ga0207695_10000837
265 Ga0207695_10012685
266 Ga0207660_10121019
267 Ga0207660_10544699
268 Ga0207652_10174947
269 Ga0207694_10066733
270 Ga0207650_10000030
271 Ga0207706_10101232
272 Ga0207711_10000998
273 Ga0207667_10250378
274 Ga0207667_10787704
275 Ga0207712_10000941
276 Ga0207712_10175344
277 Ga0207668_10000042
278 Ga0207668_10000197
279 Ga0207658_10000318
280 Ga0207658_10024400
281 Ga0207703_10017231
282 Ga0207703_10202087
283 Ga0207639_10278369
284 Ga0207639_10867161
285 Ga0207678_10390856
286 Ga0207641_10000532
287 Ga0207676_10000227
288 Ga0207676_10190711
289 Ga0207698_10059086
290 Ga0207698_10651913
291 Ga0209996_1012677
292 Ga0209995_1001947
293 Ga0209982_1003799
294 Ga0209970_1002714
295 Ga0209983_1003503
296 Ga0209971_1001307
297 Ga0268266_10000705
298 Ga0268266_10002241
299 Ga0268265_10000661
300 Ga0268265_10012679
301 Ga0268264_10000205
302 Ga0268264_10156420
303 Ga0265327_10000757
304 Ga0307408_100518943
305 Ga0307408_100893746
306 Ga0307413_10117310
307 Ga0307413_10486708
308 Ga0307409_100368342
309 Ga0307416_100172448
310 Ga0307416_100182882
311 Ga0307414_10505514
312 Ga0307414_10557657
313 Ga0307414_10564193
314 Ga0307414_10603438
315 Ga0307415_101382343
316 Ga0307415_101867902
317 Ga0307510_10196223
318 Ga0373927_0361529
319 Ga0373933_0148587
320 Ga0436364_1480844
321 Ga0436361_0512620
322 Ga0436363_0664855
323 Ga0436363_1182881
324 Ga0436363_1205711
325 Ga0466967_0033277
326 Ga0466967_0295198
327 Ga0466967_1921389
328 Ga0495639_0338658
329 Ga0495584_0226628
330 Ga0495583_0058671
331 Ga0495620_0024684
332 Ga0495631_0075304
333 Ga0495631_0241617
334 Ga0495643_0007089
335 Ga0495654_0027056
336 Ga0495609_0018393
337 Ga0495597_0007402
338 Ga0495622_0024769
339 Ga0495668_0058296
340 Ga0495625_0052503
341 Ga0495625_0055112
342 Ga0495669_0000014
343 Ga0495669_0000322
344 Ga0495687_015059
345 Ga0495677_0019757
346 Ga0495677_0025441
347 Ga0495593_0079847
348 Ga0496106_0002485
349 Ga0496106_0575427
350 Ga0496117_0139883
351 Ga0496118_0427403
352 Ga0496119_0133557
353 Ga0496121_0000334
354 Ga0496124_0291281
355 Ga0501034_0188332
356 Ga0501043_0422341
357 Ga0501048_0635751
358 Ga0501070_0968273
359 Ga0501073_1123992
360 Ga0501035_0263705
361 Ga0501044_0033285
362 Ga0501044_0365123
363 Ga0501044_0377635
364 nmdc:mga0sz30_91063_c1
365 Ga0500578_0146868
366 Ga0500643_000968
367 Ga0500643_011198
368 Ga0500643_012828
369 Ga0500643_064588
370 Ga0500646_0044444
371 Ga0500651_0068591
372 Ga0500566_0117066
373 Ga0500641_0000623
374 Ga0500641_0000654
375 Ga0500641_0016438
376 Ga0500556_0001771
377 Ga0500556_0005318
378 Ga0500562_006813
379 Ga0500562_011122
380 Ga0500572_047636
381 Ga0500595_002363
382 Ga0500608_001746
383 Ga0500614_006437
384 Ga0500642_0195877
385 Ga0500658_0422530
386 Ga0500559_0011233
387 Ga0500590_005058
388 Ga0500604_0084603
389 Ga0500616_0022871
390 Ga0500620_110459
391 Ga0500622_0008525
392 Ga0500622_0025800
393 Ga0500622_0191496
394 Ga0500636_0033015
395 Ga0500576_064698
396 Ga0500625_075098
397 Ga0500645_000730
398 Ga0500596_002130

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02391

MoaE

MoaE protein

22

129

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ap8-assembly1.cif.gz_A crystal structure of human molybdopterin synthase catalytic subunit (mocs2b) 0.9822 28 117
2omd-assembly1.cif.gz_B crystal structure of molybdopterin converting factor subunit 2 (aq_2181) from aquifex aeolicus vf5 0.9576 32 117
2q5w-assembly1.cif.gz_E the x-ray crystal structure of molybdopterin synthase from staphylococcus aureus 0.9487 30 127
2omd-assembly1.cif.gz_A crystal structure of molybdopterin converting factor subunit 2 (aq_2181) from aquifex aeolicus vf5 0.944 33 119
8hlg-assembly1.cif.gz_B crystal structure of moae 0.9349 28 126
ID Description Score Start End Superfamily
5mpoC00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9764 28 119 3.90.1170.40
af_Q6AY59_40_191_3.90.1170.40 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9653 28 127 3.90.1170.40
2omdA00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.944 33 119 3.90.1170.40
af_P91500_195_340_3.90.1170.40 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9309 25 128 3.90.1170.40
2qieK00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9244 28 129 3.90.1170.40
ID Description Score Start End GO Terms
AF-A0A1X7EFI5-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) 0.9939 59 139 GO:0006777
GO:0030366
AF-A0A3S4XU29-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) 0.9888 28 139 GO:0006777
GO:0030366
AF-A0A2X1KLB8-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) 0.9885 28 139 GO:0006777
GO:0030366
AF-A0A7W0X4M0-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) 0.9885 56 140 GO:0006777
AF-A0A258HSL7-F1-model_v4 deleted 0.9861 40 140

Map